Tag: plasmids

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf

Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …

The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …

Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …

I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.

A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.

Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.

Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.

This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:

Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA

From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.

Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-

Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK

In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.

So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.

Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20201030 Open Topic / Watch The Water / Fake News Drain-Circling Psychosis / Why I'm Shilling Novavax / Calling All Prayer Warriors

Free speech, yada, yada, yada. But don’t give Komrade Kamala any excuses to shut us down. This has been addressed elsewhere. Such as HERE:

TERMS OF SERVICE: https://wqth.wordpress.com/2019/01/01/dear-maga-open-topic-20190101/

YOU KNOW THE DRILL.

Give them nothing but one more day to rue, and the wailing and gnashing of teeth.

Remain CIVIL and possibly even GENTEEL.

Today we have FOUR SHORT LESSONS in politically incorrect WOLFTHINK.

Watch The Water

One of the beautiful things that the Q team did, as part of not only its “comms”, but also its psy-opping, and its deniability, was to communicate to us in double, triple, and higher entendres. It was poetry, which not only made it CUNNING, but also ATTRACTIVE, INSPIRING, and even BEAUTIFUL.

Sure, SOME people will “read things in” wrongly, or too little, or too much, but overall, SOME will figure out TRUE THINGS, and what they figure out will spread.

The GENIUS of the COMMS is a proof unto itself.

I cannot tell you if Q originally intended for us to “get” WATER ISLAND as a sly tip in “WATCH THE WATER”, but OMG – it’s a GOLD MINE, intended or not.

Thanks to ValCur, who is NOT ValJar, I researched a photo and was led to THIS ARTICLE:

I simply CANNOT recommend this article highly enough.

LINK: https://www.politico.com/news/2020/01/28/james-biden-lobbyist-virgin-islands-099318

This is real corruption, and the article both explains it, and EXCUSES IT.

This article is trying to IMMUNIZE Biden against damage from not just this story, but also the deeper parts of the scandal, by PRESENTING and CONTROLLING one of the lesser parts. You can read the “excusing of corruption” at every step. It’s intentionally demoralizing – like – “yeah, he will get away with it, because, well, lookie here, this might just be innocent because of THIS.”

Likewise, there is NO mention of Jeffrey Epstein ANYWHERE in the article. And yet, Water Island is SO CLOSE to Epstein Island, and so convenient for traffic to it, utterly unobserved, that it really makes one think Politico is deliberately walling off Epstein by poking up a smaller scandal in the way and saying “nothing to see here – why don’t you just GO HOME?”

Here is how to locate Water Island on the map above.

Epstein Island is located at the circular location marker up and to the left (NW) of the added text. That marker is RIGHT ON Little St. James, a.k.a. Epstein Island. There is another, adjacent, island of similar but slightly larger size, just up and to the left (NW) of that – this is Great St. James. Epstein also bought THAT island – SECRETLY – the story is NASTY and INTRIGUING, and is described HERE:

https://en.wikipedia.org/wiki/Great_Saint_James,_U.S._Virgin_Islands

Great St. James is off the shore of the BIGGER island to the left, St. Thomas. The capitol city in the center is Charlotte Amalie, clearly labeled in the map. Just below and slightly to the left (SSW) of the label for Charlotte Amalie, and really almost part of the city, is Water Island – unlabeled in the map above.

In this map of St. Thomas and surrounding smaller islands, you can clearly see both Water Island in the center, and Epstein’s two islands in the lower right corner, unlabeled, southeast of the hamlet of Red Hook. Hassel Island, next to Water Island, is mostly uninhabited, and serves as an historical park.

Water Island is a bit like a gated community, although it’s not all that ritzy. I will include a link to a HUGE, high-resolution image of it. Here is a smaller image:

Here is the BIG IMAGE from another angle: Big Aerial Image of Hassel and Water Islands

NOW – if you are wondering about how to get from Water Island to Epstein Island, then you may want to get distracted by discrediting theories of submarines, based on the fascinating history of submarines on St. Thomas, and military activities on both St. Thomas and Water Island. However, to be quite frank, it’s just easier to hop on a boat. As you can see in the above picture, boats are everywhere, and there is so much boat traffic, it’s quite easy to lose track of any one boat, let alone any one passenger.

NOW – here is the interesting point from the article. It’s how the Bidens were basically GIVEN a nice parcel of land on Water Island by a lobbyist friend.

  • The Bidens bought a desirable plot of land.
  • The Bidens split the land into three subplots.
  • The Bidens then SOLD one subplot to the lobbyist for the FULL PRICE of the FULL PLOT.
  • This left the Bidens with over 2/3 of the land FOR FREE – GRATIS – by being OVERPAID for part of it.
  • The Bidens then secured LOAN MONEY from the lobbyist using the other two plots as collateral.

Now, if that’s confusing, it’s supposed to be. It’s money laundering. What the lobbyist did was give the Bidens PROPERTY, and then let them CASH IN on it with loans.

Say, didn’t the Bidens get money from the Chinese that way, too? Some of it as cash – some of it as LOANS?

Whatever. It’s all very ugly.

Now, the REAL question is whether Hunter Biden was ever on Epstein Island.

I think we’re about to find out.

Get your popcorn now.

And now for a scandal closer to home.

OMG! A LIBTARD POSTED ON THE Q TREE!

Fake News Drain-Circling Psychosis

We got one comment in MODERATION which – well – this person is, shall we say, not a good fit for this site. She is welcome to visit our Gab Group where people can individually “turn her off”, but since we can’t do it here, she did NOT survive “Wolf’s Extreme Vetting“.

This is a MAGA site. If you take BASIC ISSUE with our purpose, you’re probably going to disrupt our day-to-day purpose, which is to support TRUMP. Can’t have that.

However, I think it’s worthwhile to consider what she had to say, so here it is.

House of Heart 9 hours ago · houseofheartweb.wordpress.com

20201012: Amy Coney Barrett Confirmation Hearing For SCOTUS

All of these folks need to watch the real news and stop the brainwash they are getting from Fox. Amy Barrett will go down as the the SCJ selected by an impeached president in an effort to get himself re-elected so that he can’t be criminally charged for his wrong doings . He couldn’t care less about abortion , our healthcare or whether we live or die. His lack of action to mitigate Covid 19 has made that quite clear. He. did stack the court with far right conservatives in his plan to deprive us of a legitimate vote to rid us if this non-patriot when he refuses to concede and takes away our right to choose a president by putting the decision before the stacked far right Supreme Court that he has weaponized. Save our democracy, despite your hatred of Obama, save our democracy. Wake up , America can’t take four more years of the criminality of the Trump family.

This is, I’m fairly certain, the mentality of people who are still voting for Joe Biden. Now, first of all, many of us here don’t even watch Fox News, since it’s basically the OUTER LIMITS of establishment “allowed” thinking. Sure, there are some great journalists there, like Tucker Carlson, but then again, those are exactly the “far right” personalities that this poster surely rejects.

But as for “real news” – HEY BABY – that is US.

The news – the real news – is something we have to ferret out, past all the lies.

While I’m not going to respond to all of the specific “accusations against Trump” here, I think some are worth addressing.

First, I want to assure this poster (HoH, hereafter) that Amy Coney Barrett is not going to do all the bad things that she (HoH) is afraid of, although Justice Barrett will make SOME decisions which will be INCONVENIENT for Democrat POLICY and POLITICS. However, Barrett will likely UPHOLD liberal policies which are soundly rooted in law, and thus, the poster HoH will be PLEASANTLY SURPRISED on occasion. Possibly many occasions, if she’s just a deluded liberal, and not a lying leftist.

The impeached president stuff, of course, means nothing without a conviction. Bill Clinton survived impeachment, so there is nothing to score here, but I hesitate to use that comparison, because it is a FALSE SYMMETRY. Bill Clinton’s impeachment MATTERED. Trump’s impeachment was blatantly FALSE, and the work of criminals. Fake News consternation aside, Adam Schiff is in trouble for falsely accusing Trump and furthering a HOAX PROSECUTION.

Hoaxes matter. And so do SOME impeachments.

Why did Bill Clinton’s impeachment matter? It was just about SEX – right?

Yes – that is TRUE, although technically it was about LYING about sex. And THAT betrays the much deeper problem of BETRAYAL.

I am now of a belief that CHINA has targeted a particular type of politician who they believe will SELL OUT AMERICA. Bill Clinton and Joe Biden are specific examples of this kind of politician.

  • politically amoral or sociopathic
  • sexually immoral
  • willing to take bribes
  • married to a spouse PERSONALLY invested in the politician’s success
  • spouse will support illegalities and immoralities
  • pol is FAITHLESS to the spouse – betrayal is second nature
  • both pol and spouse do not return ANGER to blackmail or betrayal, but DEEPEN TIES instead

These are politicians who LIGHT UP China’s “Blue-Gold-Yellow” (BGY) program by giving up intelligence, taking bribes, and being faithless to spouse, God and country.

Trump has done nothing like what Bill Clinton did, even when he “dated around”, shall we say, before and between marriages.

Bill Clinton betrayed our country. He took money from China to do things not in the interests of the United States. All of Trump’s alleged “betrayals” have proven to have been manufactured LIES by people who DID get in bed with China, Russia, Ukraine or Iran.

As for Trump “not really caring” about abortion, healthcare, and OUR LIVES – sorry. Look for the big picture here to not be delusional. Just one – healthcare – Trump FORCED Republicans to accept HIS POSITION on OUR pre-existing conditions. And on COVID-19, we see that he sacrificed HIS ECONOMY to not take a chance on OUR LIVES.

Which brings us to COVID-19.

This is a good one. Trump WINS here, if you dig even slightly below the weak lies of the Biden Coupists. I could get into the deeper weeds of what is REALLY going on here – where I draw in some of the stuff that will appears momentarily in the NEXT parts of this post, but I’m setting aside those items for now.

Why? Because it turns out that viruses are vastly more complicated and subtle than we realized, and most people are not really aware of the nastier parts of the story, which “real science” ADMITS, but kinda slides over to the side of the discussion table, and gets all COUGH COUGH about the nastier parts.

Most people in this world will be SHOCKED when they understand. They will be shocked at how science SCREWED UP in how it responded to the truth about viruses, too. Firing Judy Mikovits did NOT make the complexity of the truth go away – it just delayed things.

And COVID-19 has a lot to do with that. It was a CHEAP MOVE in science, to FORCE Trump to “buy in” to a moneyed and “almost true” but irresponsible position which PROTECTS Tony Fauci.

Nope. We’re going to stick to the SLIGHTLY PHONY STORY – the “standard theory” of viruses, without the problems and the lies – we’re going to PLAY ALONG with what gets printed on the glossy pages in the check-out line – the simple story that leaves the nasty REALITY of viruses OUT, so that MONEY can be obtained through vaccines which treat the part of the story we’re allowed to see.

That is where Trump played along, too, but ACTUALLY CARED about treating people, and BOOM – we have real treatments like HCQ, Regeneron, and (bad as it is) remdesivir. We have vaccines that will work on a subset of colds, although, sadly, SOME OF THEM may cause cancers, immune disorders, and immunodeficiency as well, long term, if you take the wrong ones, and we don’t know which ones those are. It’s rough science, with some very nasty “known unknowns”.

But we’ll deal with it. Soon.

Stocks are already banking on Novavax making money due to its older technology evading concerns on mRNA and DNA, and rightly so. This despite the fact that mRNA and viral vector vaccines are running ahead in terms of trials.

STAY TUNED.

But most of all, Trump did the smart things – the obvious things – and they worked. He did NOT listen to the lies that closing borders would be ineffective. Trump closed the borders and saved lives – although CHINA lied even earlier, and got cases here in January and even December.

It’s very clear to me how our Democrat-allied medical bureaucrats, in league with China, tried to carry out a coup using a new coronavirus and a media scare. When all is revealed, there will be many firings, and convictions, too.

But not yet. We’re “Biden” our time, so to speak.

As for the rest of HoH’s comment – well – it’s mostly a very “Fake News” perspective. Fake News hates Trump, and more importantly hates people like ME, because they’re invested in decades of lies. Those lies are coming undone. WE are not the ones hiding the evidence presented by the other side.

COUGH.

houseofheartweb.wordpress.com

Help yourself. Convince us. But not here.

You will not disrupt our TRUTH-SEEKING ALTERNATIVE to the FAKE NEWS.

My mother saw the SAME THING happen to the Nazis. When the Nazi regime fell apart, like the decades-long leftist infiltration is falling apart now, or when ANY socialist regime falls apart, the TRUTH makes a certain sector of the old socialist guard just GO NUTS.

As the DRAIN IS CIRCLED, the cries get shriller, and the ear-covering gets ridiculous.

“Good Obama” – “Good Joe Biden” – “Good Fuehrer” – it’s all the same. They were PHONIES propped up by the media, and when the media falls, THEY FALL.

Trump is not propped up by the media. He SHUNNED their approval from the beginning.

ASK WHY.

There will be people – the “true believers” – who cannot FACE THE DIFFICULT TRUTHS. They won’t CALL the corruption what it is – they won’t even look at it.

The Nazis did not ALLOW discussion of the truth. They – like the communists they are SO SIMILAR TO, would DISRUPT any discussion of the truth. They would keep everything they didn’t want OUT OF THE NEWS and HIDDEN from the People. If people TALKED about it, those voices were DISRUPTED or SQUELCHED. Often BRUTALLY.

THAT is socialism, and we’re SHUTTING IT DOWN.

We WILL NOT live under it. Period.

Join Gab. My advice. Left or right. The TRUTH will come for you there. Like it or not.

I wish House of Heart well in her travels.

Vaya con Dios.

And, if you don’t believe in God, stay classy, and vaya con Dior.

Why I’m Shilling Novavax

BEGIN TL;DR /

I have recently seen or heard a variety of things (I will explain – see WHY below), which have combined to convince me that mRNA and *especially* DNA vaccines are TOO RISKY relative to the *actual* dangers of the China Virus, to be a SAFE choice for people who are NOT in a high-risk category relative to COVID-19 infection.

Now, this is just my personal stance at the moment, and it is subject to change. But right now, my opinion is as follows:

For people not at great risk of harm from the DISEASE, it pays to WAIT until the sum of ALL POSSIBLE RISKS of any particular individual vaccine, experienced over the LIKELY REMAINDER OF LIFE, falls below the known risks of the disease for that person RIGHT NOW.

This is a pure RISK / BENEFIT analysis, using both KNOWN SCIENCE and SCIENTIFIC UNKNOWNS.

This is EXACTLY in keeping with Trump’s family’s INDIVIDUAL DECISIONS on COVID-19 treatments. Trump himself took TWO experimental treatments. His wife and son, both younger, took NO experimental treatments.

If we were dealing with airborne Ebola – WHICH WE ARE NOT – then it would make sense to give most people mRNA and DNA vaccines and “hope for the best”. That is NOT THE CASE, and we need to stop pretending that it is. The “COVID hype” has FAILED, and those who continue it, need to be made to answer for it. It’s time for HONESTY.

Thus, FOR YOUR KIDS of FUTURE KIDS, and for anybody not at high risk, I recommend the Novavax vaccine as less risky for long-term development of CANCER and IMMUNE DISORDERS, both of which are foreseeable potential risks of nucleic acid vaccine biotechnologies, which risks cannot be properly tested for, in the short term, in my opinion.

On the other hand, for those in high-risk COVID groups who need vaccines NOW, and particularly the elderly, any of the vaccines that show short-term safety and efficacy are reasonable risk choices, relative to any possible but unknown long-term consequences.

/END TL;DR

BEGIN WHY /

In my opinion, the risks of mRNA and DNA vaccines are like DES was for children of women who took it – they are LONG-TERM risks, and potentially transmissible to children.

We have been GASLIT into the “need” to take new, relatively untested vaccines, and “hoping for the best”.

NO. Just NO.

In my opinion, ONLY people either (1) at high risk of DEATH from COVID-19, due to age and/or comorbidities, OR (2) those who are willing to BRAVELY VOLUNTEER, at the risk of late-in-life cancer or immune disorders, possibly even to their children, to find out if mRNA and DNA vaccines are actually SAFE long term, should take the “novel” mRNA or DNA vaccines.

It will be YEARS before we know if these technologies are either guaranteed safe or controllably safe (meaning we know how to make them safe against ALL potential gotchas).

I’m not saying that we should not make and in some cases TAKE these vaccines. I’m saying that these vaccines have KNOWN and EASILY FORESEEABLE LONG-TERM RISKS, and we are NOT being open and honest about those risks.

The Chinese are being very cautious about the new vaccine technologies, both because they are a bit behind, and because they are basically letting Americans experiment on Americans. However, the Chinese are also taking risks just by pushing primarily the very oldest-style vaccines, which are at extremely high risk of immune enhancement phenomena.

Because the Novavax vaccine is using BOTH modern technology which evades immune enhancement, AND established technology which has a proven safety record, and is NOT taking RISKS inherent to mRNA and DNA technologies, I am of the opinion that it is the most THEORETICALLY SAFE of the vaccines thus far.

I would give Novavax to my own children without worry, based on what I know now. I would only give an mRNA or DNA alternative to an OLDER RELATIVE or one with a serious comorbidity. If my parents were alive right now, both thus being VERY old with SERIOUS comorbidities, I would almost certainly advise that they get the first available vaccine, since all the front-runners appear to be headed for approval when phase 3 tests are done, IMO.

Now – let me explain my position.

Regarding viruses and vaccines, I am quite familiar with the broader topics in biology, biochemistry, pharmacology, and other relevant sciences, and even the “basics” of how viruses and vaccines work. However, I was NOT aware of the nitty-gritty of viruses and vaccines until recently, as I began to try to understand the different vaccine and therapeutic offerings which are coming in Operation Warp Speed.

I was shocked, at the beginning, to discover that the very first coronavirus vaccine mentioned in my news feed, the Inovio offering, was in fact a DNA vaccine. I had to DIG to discover that aspect. It was not even mentioned in the “top-level” Twitter-mediated links. Indeed, I had to dig just to find Bill Gates mentioned.

The details of the Inovio vaccine are quite interesting.

Digging into the OTHER vaccines in the running, I discovered that for every DNA vaccine, there were several mRNA vaccines (m = “messenger”) also in the running, and the mRNA vaccines were actually more advanced in terms of clinical trials.

The above list is the state of things in MAY, as far as vaccines in clinical trials. Now, jump to July.

Now, I could have spent a lot of time reading paywall-slipping scientific literature (very difficult for poor “people’s scientists” like me to find), trying to come to my own opinion about the safety of mRNA and DNA vaccines, but I found a faster way to “poll scientists past the fake news” – that was simply to raise the red flag on RNA and DNA vaccines, and see how fast the industry shot down my red flag. If mRNA and DNA vaccines were obviously and inherently safe, there should have been a DOGPILE of both scientists and shills to “correct” me.

Instead, there were CRICKETS.

What I did next was even more desperate. I started calling these vaccines “genetic modification” – a direct and specific accusation, which should have been SHOT DOWN HARD WITH SOUND SCIENCE if genetic incorporation of some kind was not a risk. That meme spread, and I watched what happened.

Instead of saying “GENES CANNOT BE MODIFIED BY THESE VACCINES!”, there was several kinds of weak counter-arguments, based on definitions, assertions, and ideals. Nobody ever “did the John Kasich” and said “Vaccines can’t modify your genes – that’s crazy talk!” There was dancing around the core accusation – never even an attempt at a solid rebuttal.

Now, you have to understand – I’ve gotten “that’s crazy talk” for a whole lot more obviously REAL stuff than this plausible but kinda freaky idea, that vaccines might mess with your genes. I found that VERY surprising. I know how scientists and left-wing “science is real” types love to correct other people, and most of all “errant scientists”, when they step on thin ice.

Was I actually on SOLID GROUND?

Leave it to a “Twitter Angel” to sneak up on me and drop a huge hint – “CRISPR” – in a reply. The person accused COVID-19 vaccines of INTENTIONALLY modifying our genes.

One quick search to validate, and…..

WHOA, NELLY!

It turns out that there ARE, IN FACT, VACCINES which depend on genetic modification. They use CRISPR-Cas9 technology to make gene insertions.

That headline actually HIDES the current state of research – in which WORKING VACCINES which “edit the genes of T cells” are not just someday, but RIGHT NOW, and showing desirable results.

Read the article!

LINK: https://www.statnews.com/2019/02/19/crispr-might-work-when-vaccines-fail/

ARCHIVE: https://archive.fo/8QtlZ

HOWEVER, as far as I can tell, NONE of the current coronavirus vaccines – NONE of them – intentionally edit genes.

However, you would be shocked not only how easy that is to do – meaning EDITING your DNA – what’s even more shocking is how easily it is to do badly, and cause problems.

AS RETROVIRUSES, IN FACT, DO.

However, before I get to retroviruses, which “seal the deal” for me on making the sign of the cross at mRNA and DNA vaccines, I need to talk about TWO other things.

First, CANCER.

The October 19, 2020 issue of Molenium Magazine, a.k.a. Chemical & Engineering News, has a really great cover story, on a tumor phenomenon known somewhat generally as “circular DNA”, more commonly as “extrachromosomal DNA” (ecDNA), and also as “extrachromosomal circular DNA” (eccDNA), but be careful, because for whatever weird historical reasons, ALL of it seems to be circular, and ecDNA is regarded as a subset of eccDNA, rather than the other way around.

Let’s repeat for clarity.

This article is about “little circles of DNA”, referred to as ecDNA, or extra-chromosomal DNA, which seem to be tied to tumor resistance and survival. ecDNA is the name traditionally associated with the little circles of DNA prevalent in TUMORS.

It’s an exciting and active area of research, and I highly recommend the article. Note that the author is Ryan Cross, who has done all kinds of great vaccine reporting for C&EN.

LINK: https://cen.acs.org/pharmaceuticals/oncology/curious-DNA-circles-make-treating/98/i40

Now, let me explain why this freaked me out.

What do you know, the Inovio DNA vaccine for coronavirus injects you with little circular bits of DNA, too!

That image is from a GREAT slideshow, which explains the FANTASTIC (and I mean it) probable and in some cases PROVEN upside of the technology.

You will note, as you watch the slideshow, that the technology is even useful AGAINST virus-caused cancers, by increasing immunity to those specific viruses. The POSITIVES on the technology are GREAT.

https://www.slideshare.net/Companyspotlight/inovio-sep13pres

But what about the downside? What are the RISKS of new technology so similar to what it is being used against – meaning little bits of DNA or RNA that CAUSE tumors?

Well, there’s nothing in the slideshow. But let’s ask ON OUR OWN.

NOW – the circular DNA used by the vaccine is referred to as a plasmid.

Plasmid is another name for a small circle of DNA. Not only are plasmids of certain natures very similar to the circular DNA (ecDNA) expressed BY tumors in humans (see above article), the plasmids of some bacteria can actually CAUSE tumors, e.g., the “Ti plasmid”, which stands for Tumor-inducing plasmid, which infects and causes galls to form in plants, by hijacking their cells using DNA.

LINK: https://en.wikipedia.org/wiki/Ti_plasmid

Now – I’m not arguing that plasmid-based vaccines, working as they are SUPPOSED TO WORK, are going to cause cancer, or are even LIKELY to cause cancer. But I’m not going to exclude the possibility – the KNOWN UNKNOWN – that if something goes wrong, they MIGHT cause cancer.

To see how REASONABLE it is to associate cancer with eccDNA of various kinds, just read about those “names” for the circular DNA that I was just mentioning. BOTH Wikipedia articles have extensive sections on the role of these types of DNA in cancer.

https://en.wikipedia.org/wiki/Extrachromosomal_DNA

https://en.wikipedia.org/wiki/Extrachromosomal_circular_DNA

And now, let’s make things even WORSE, by adding VIRUSES and IMMUNE DISORDERS.

Now – I’m not a “true believer” in Judy Mikovits. However, her obsession with XMRVs (a type of retrovirus) has really forced me to understand just how much of a MESS viruses actually are. The REALITY of retroviruses is GODAWFUL. Viruses, and particularly retroviruses, have made a complete MESS of RNA and DNA. They LITERALLY write themselves into the genome like GRAFFITI IN BOOKS, and they’ve damn near filled the books. Worse still, they started doing it so long ago, and have done it so much – to the point that some think retroviruses are RESPONSIBLE for DNA evolving as a solution to genetic storage – that I’m not even sure that this history occurred ON THIS PLANET.

It is extremely worthwhile to read the following, including the sections on gene therapy and CANCER, to understand the BASICS of retroviruses.

LINK: https://en.wikipedia.org/wiki/Retrovirus

All of this is not enough to “know” that DNA and mRNA vaccines are going to do anything “bad” in the long term. But it is VERY apparent that DNA and RNA are a MESS – the “cental dogma” of untouchable, royally decreeing DNA is a laughable LIE, and vaccine biology operates in a china shop filled with blind lunatics on bicycles, drunk bears, and children with firehoses.

Everything taken together, I simply don’t trust the new mRNA and DNA vaccines to have figured out known unknowns, let alone unknown unknowns, that won’t become evident for 75 years and 2 generations.

My advice? Avoid the part of the “central dogma” that is blatantly untrue – that DNA is “read-only” except by blessed mechanisms.

PROTEIN IS SAFETY (disregarding snake venoms, of course). If you are risk averse, PROTEIN like NOVAVAX is where to take your chances.

Thus, you will be seeing me shilling primarily for Novavax, particularly to the vaccine hesitant, the young, the healthy, and the future or present parents. I will shill the other stuff to the other folks.

Now you know why.

Calling All Prayer Warriors

I get a lot of revelations in the shower, but they’re usually of a scientific or political nature, not a religious one.

This one just hit me like a ton of bricks, but gentle as a breeze. When in my mind, troubled by the days ahead, I uttered the words HAND OF GOD – I immediately felt a powerful understanding and peace wash over me – PEACE AND STRENGTH – and right then, I knew that this was something that must be shared.

We need to pray for the HAND OF GOD to descend on us with power, comfort, and STRENGTH, so that we may stand firm and resolute – to NOT be incited to violence – to stand for PEACE when the easy solution is WAR.

To not be afraid, but rather to be confident. To go forth strongly and with PURPOSE, clear in our righteousness, filled with mercy and understanding.

Remember it, when you are troubled.

HAND OF GOD.

And your troubles will be swept away, with POWER not your own.

SO…..

We have just FOUR DAYS until the election.

MAKE THE MOST OF THEM.

CALM. STEADY. TO VICTORY.

W