Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do?


TL;DR –

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.


The central dogma of molecular biology. They shilled the blue arrows to the masses as lies about safety, while hiding the special red arrow and actually working to open it up for business.


Show-Time (Introduction)

I have finally realized that I need to spell out, in as many ways as needed, what is really going on with SARS-CoV-2 and these derived mRNA vaccines.

I had hoped that people would see the implications of the science which is now open to us, with the publication of first the Jaenish paper, then the De Marinis paper, and finally the Mehedi paper. I have commented extensively on each one of these papers, including very recently on the Mehedi paper, which really makes things obvious. I had thought that somebody more notable than me would try to make the point I am about to make. Sadly, nobody has, so it looks like I’m going to have to do it.

These vaccines are designed to BEGIN to change us on a fundamental level which is not exactly the same as the “transhumanism” that constitutes most of the “clickbait” against the vaccines. It’s similar, but it’s not the same. What we see in the clickbait is a distraction from the actual danger, which is not strange and distant and unbelievable, but is in fact right here, and right now, and very believable, once you understand it.

The truth is a lot more like GATTACA, and a lot less like Transcendence.

It’s already starting, and the infrastructure is being set up. The first step has actually been accomplished, and it was in many ways a HUGE success.

Humans ARE being engineered right in front of our eyes. I hope that you can see this point by the end of this article.

They (meaning WEF and its backers) hacked the human cell nucleus on a population genome level. They created a “Trojan” virus that appears to have “zero-dayed” the human cell nucleus. Artfully, the hack is a lot like state-level “APT” (advanced persistent threat) computer hacks, in that it gets in and holds the door open. Of course, better models can be created, but the self-replicating crowbar for the cell nucleus has obviously arrived, and its imperial version of SPQR is PRRARSV.

THAT is the fundamental advance that was achieved here.

I have to say, it was ingenious and “admirable”, in several senses – scientific, military, and criminal. Of course, your mileage may vary on “admirable”. Many will consider it “diabolical”.

What we are facing is the immediate REAL danger of biological engineering and eugenics, which was employed in a fantasy way, as a technical MacGuffin, in various episodes and productions in the Star Trek universe.

This is a scene from Star Trek II: The Wrath of Khan. These two people are “superhumans” who (according to the story) proved to be disastrous for Earth, during our current century (more or less). The one on the right is “Khan” – obviously in homage to Genghis Khan and his relatives, who ruled much of Asia for centuries.

Don’t get lost in the fantasy stuff. THAT is not the big danger. Stick around for an explanation of the reality which is actually upon us.

Here is how Wikipedia describes Khan, but more importantly, where he CAME FROM.


Khan Noonien Singh is a fictional character in the Star Trek science fiction franchise, who first appeared as the main antagonist in the Star Trek: The Original Series episode “Space Seed” (1967), and was portrayed by Ricardo Montalbán, who reprised his role in the 1982 film Star Trek II: The Wrath of Khan. In the 2013 film Star Trek Into Darkness, he is portrayed by Benedict Cumberbatch.

Khan had controlled more than a quarter of the Earth during the Eugenics Wars of the 1990s.[1] After being revived from suspended animation in 2267 by the crew of the Starship Enterprise, Khan attempts to capture the starship but is thwarted by James T. Kirk and exiled to Ceti Alpha V, where he has the chance to create a new society with his people. In Star Trek II: The Wrath of Khan, set fifteen years after “Space Seed”, Khan escapes his exile and sets out to exact revenge upon Kirk.

In Star Trek Into Darkness, set in the alternate continuity established in Star Trek (2009), Khan is awakened almost a decade before the events of “Space Seed“. Khan is given the false identity John Harrison and coerced by Admiral Marcus into building weapons for Section 31 and Starfleet in exchange for the lives of Khan’s crew. He ultimately rebels and comes into conflict with the crew of Enterprise.


OK – so what are the “Eugenics Wars”?

Back to Wikipedia…..


When the original series of Star Trek was produced, the 1990s were several decades away, and so various elements of the backstory to Star Trek are set in that era, particularly the Eugenics Wars. The references to the Eugenics Wars and to a nuclear war in the 21st century are somewhat contradictory.

The episode “Space Seed” establishes the Eugenics Wars, and has them lasting from 1992 to 1996. The Eugenics Wars are described as a global conflict in which the progeny of a human genetic engineering project, most notably Khan Noonien Singh, established themselves as supermen and attempted world domination. Spock calls them “the last of your so-called World Wars”, and McCoy identifies this with the Eugenics Wars.


OK – don’t get me wrong. I’m not saying it’s EXACTLY like Star Trek, although I do subscribe to the folk notion that Star Trek is a VERY good predictor of things that are likely to happen.

What I AM saying is that genetic engineering of humanity has already started, and now I’m going to explain why this is so.

We will take a brief tour into the PAST, before we return to the future. If a light bulb comes on, keep it lit!


You cannot uninvent the genetic Tommy-gun, nor the gun moll who knows how to code.

Bonnie & Clyde of the Nucleus

BANKS make a really great analogy of the cell nucleus.

  • they’re common and everywhere
  • they contain valuable stuff that needs to be protected yet dispersed
  • they have high security
  • things need to traffic securely in and out of them

Breaking into a bank with very high security is a lot like what the spike protein does. But the spike protein doesn’t do it alone. THAT is an important point from the three papers I keep mentioning. The spike protein has a PARTNER who has all the plans.

OK – just for the record – this is going to deviate a little bit from the ACTUAL story of Bonnie and Clyde. Just warning you – it will get weird.

The spike protein and the spike protein mRNA are a PAIR, and together, they are able to not only break into the bank, but to totally take it over, and keep it taken over. And then to take over more banks.

Here is how it works.

The spike protein is Clyde. He’s got a gun, and he causes all kinds of trouble with it. He’s the “action” guy. He knows how to break into banks, mostly because he has a phony ID that always gets him in. The phony ID says PRRARSV in big letters on it, which makes all the bank guards at Cell Nucleus Bank and Trust say “Why, welcome, Mr. Barrow! We’re pleased to see you at the bank today! Come right on in!”

Or, to use a different analogy…..

These bank guards are such chumps, but it works every time.

Well, here is the problem for the bank. When Clyde goes in, he always brings his partner Bonnie. And SHE is trouble. She’s not so good with a gun or a fake ID, but she is a real scam artist, who knows how to get into the bank and embezzle the hell out of it.

Bonnie gets into the cell nucleus bank, and with some help from Clyde, she gets a permanent job there. Bonnie and Clyde are set for life. None of this “grab the cash, run out, get caught, and die in a hail of bullets” shit. No sir! THIS Bonnie and Clyde are smart.

Bonnie trains many of the new girls at the bank – and like the pod people in “Invasion of the Body Snatchers”, she turns every last one of them into exact copies of HERSELF. NASTY! So all these fresh Bonnies are trained by the bank and sent out to get into new banks.

But wait! Bonnie can’t get into banks. Bonnie doesn’t have a gun or a fake ID! How can she get into more banks?

Easy! Bonnie and all her Bonnie clones have the power of multiplication – not just to make more copies of each one herself, but to make more Clydes. Bonnie makes more copies of herself while she’s IN the bank, and she makes copies of Clyde while she’s OUT of the bank.

So every Bonnie that leaves the bank, creates hundreds of new Clydes on the outside. The next time Bonnie wanders near a bank, there are bound to be dozens of Clydes just hanging around, ready to escort her, and maybe even other gals [important], into the bank. If no Bonnie is already working there, she gets a job, and the process starts over.

The KEY POINT is that BONNIE makes the CLYDES who can get her, or women like her, into the next bank.

Bonnie can’t get into the bank, and Clyde can’t get a job in the bank, but together, they can make a living by embezzling banks.

Side Note: This is a beautiful example of a contradiction in the Marxist sense. Proteins and nucleic acids can’t do certain things alone, and thus NEED EACH OTHER.

Once Bonnie is on the payroll, this fact introduces a permanent security problem in the bank, and for all other banks.

And why is that?

Once Bonnie is on the payroll, you can’t get rid of her.

She will just create more Bonnies and more Clydes, and they will scam more banks.

In terms of banks, banks can resist just Clyde or just Bonnie, but they can’t resist the pair.

In terms of the cell nucleus, it can resist the spike protein or the spike mRNA, but it cannot resist both of them together.

Which pair, oddly, is exactly what the vaccines create.

WHAT ARE THE CHANCES?


We can use other analogies, using banks, which emphasize the spike protein more.

Imagine a bank that was convinced to crank out KEYS TO THE BANK, and to send out these keys. Imagine thousands of keys to the bank being sent out by the bank into the community, perhaps in a really stupid PR stunt.

God knows WHO is going to get into the bank now.

God knows WHAT is going to get into the genome now.

Are you starting to see what they did?


Fact Checking the Fact Checkers on DNA Change

The absolute best way for me to convince you that they really said these vaccines could not do what they are now proven to be doing, is to simply play back the words of the “fact checkers”.

See if you can spot how many LIES are told in this video.

If you’re not spotting the lies, read THIS ARTICLE.

AND – by the way – this video is a GREAT explanation of the way things NORMALLY work. It’s totally out to lunch on the way things ACTUALLY work.

Did you spot the lies? Tell me what you found in the comments.

This video is not alone – there are HUNDREDS OF THEM.

There are also hundreds if not thousands of articles of a similar nature. I’m just going to pick one of them – the one that happened to have the graphic I used above. That article is dated from MARCH of 2021 – right when the authorities were hard-selling the “vaccines”.


mRNA Covid-19 vaccines: Facts vs Fiction

MARCH 10, 2021

By: Maria Elisa Almeida Goes
Editing: Offspring Magazine Editorial Team
Images: Nina Lautenschläger.

LINK: https://www.phdnet.mpg.de/offspring/Covid-19_vaccines

ARCHIVE: https://archive.fo/irZec


Interestingly, this archive was made only 5 months ago. It was very likely archived by Wikipedia or somebody else who is shilling the false explanation, when faced with the emerging science showing nuclear translocation and genomic incorporation. But it’s perfect for me to preserve evidence.

As an aside, I find it terribly sad that this particular lover of “Max Planck” era scientific history, lived to see one of Planck’s namesake organizations lying about science on a grand scale, but yet here we are.

Let me just pull out the most relevant section. I was planning on highlighting ALL of the lies, fibs, evasions, etc., but there are so many, I decided to only highlight or [comment on] the most horrible and ironic.


mRNA vaccines will not alter your DNA, this is why:

Concerns about the effects mRNA vaccines over the integrity of our DNA also exist. Thankfully, you do not need to worry about this. Such an event would challenge everything scientists know about basic cell biology, and is so improbable, that one can actually call it impossible.

The main reason for that is that, besides being chemically and structurally different from DNA, mRNA is located in a different cellular compartment. While DNA is enclosed in the nucleus, mRNA is produced in the nucleus, but is quickly exported to the cytoplasm with a one-way ticket: it does not come back. In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction. Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.  Additionally, the RNA molecule is charged and carries the same charge as the nucleus, so as our 6th grade physics taught us, like charges repel, and hence the RNA molecule is physically repelled by the nucleus. [Note added by Wolf – WHAT THE HELL???]

One might also argue [HA! You TOADS! Yes, one “might”!] that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example. The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines. [OH, THE IRONY]

For the same reasons, mRNA vaccines cannot affect your unborn children. This would require genomic mutations [oh, really!] in the reproductive cells – sperm and egg – since only these could potentially be transmitted to the next generation. [AND???!!!]

Speaking of children, you might have heard that Covid-19 vaccines would cause infertility in women [why don’t you just stop there, and not go on to one bad hypothesis?] because antibodies against the spike protein could mistakenly attack placenta cells, due to an alleged similarity with a placental protein called syncytin-1. There is no scientific evidence supporting this claim – and, in fact, the two proteins are barely similar, sharing only 4 sequential amino acids out of 538. [This did seem to be a bit of a miss. Nevertheless, what new hypothesis explains all the pregnancy problems?]

Still, you might want to ask why pregnant women are excluded from the vaccination campaigns [wait a minute….not in the US], and why, during clinical trials, women are asked to use contraceptive methods that will avoid pregnancy [because there might be a problem?]. Again, this is not a red flag. Any clinical trial for a potential vaccine or drug will exclude children, pregnant women, old people and people with specific underlying conditions. Initially, trials are designed to obtain major insights whether the developed pharmaceutical product works at all, in healthy adults. Once safety and efficacy are determined [read what you just said before that, where you excluded safety as a motive], tests are expanded to smaller groups that at first were set aside. Excluding pregnant women from trials only shows that trials are being done systematically and following standard protocols. [I’m sorry, but this sounds like happy horseshit, lady.]


Let’s concentrate on the lies most relevant to this discussion. I’ll isolate them and respond to each one.


In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction.

This is EXACTLY what was found with the spike protein that was produced by the full spike mRNA. What a coincidence! See De Marinis for proof that it happens, and Mehedi for WHY. OH – because there’s a nuclear location signal! Was it a “known” one, and if so, who knew it and who didn’t? If some people knew, and others didn’t, wouldn’t that make it like a “zero day” on the nucleus?

Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.

OH! But isn’t that SO STRANGE that the Mehedi work shows that the spike protein LITERALLY “traffics” the spike protein mRNA into the nucleus? WELL AHHHHH’LLLLL BE! So maybe this explains the nuclear DNA modification that is seen in the De Marinis results. Yes? Maybe? Come on, girl – you’re a scientist at a prestigious institute. Put on your big girl pants and hypothesize with me! You can do it! This is undergraduate, “smart-alec guy in the back of introductory class raises his hand” stuff! And when you were in that class, you thought the same sorts of things but didn’t raise your hand. Maybe it’s time to be brave!

One might also argue that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example.

This should have been your really big hint, girl. Our local accountant named cthulhu realized that Fauci’s HIV interests and his bat virus interests had remarkable similarities, both in what he himself did, and in what he was studying. “This isn’t Fauci’s first rodeo.” Ask yourself – why was Fauci interested in this? Could it have been the same reason that Doudna was so interested in CRISPR-Cas9? The desire for WRITE PERMISSIONS on the genome?

The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines.

Thank you, my lying lady. You have just provided me with a huge clue, by the process of “liar subtraction” – a form of deductive reasoning. We know from De Marinis that genomic incorporation and modification is a fact. We know from Mehedi that “nuclear trafficking” (your point 2) is a fact. This means that it is almost certain that the spike protein ALSO acts as a promoter of reverse transcription (your point 1). You said it – not me. That sure seems convenient, doesn’t it? My question is now – DID YOU KNOW THIS? Were you part of the plot? Or was the person who reminded you of these things part of the plot? Or were we all part of the plot, when I, too, mindlessly parroted the “central dogma” as a defense of mRNA vaccines?

I’m willing to confess that I was wrong. I will admit to my part in promoting the conspiracy. Will you?


But their defenses get worse.

There are now MSM “fact checks” which specifically try to walk back the implications of both the Jaenisch and De Marinis papers, and you can bet there will be similar fact checks on Mehedi’s paper. There has likewise been pressure on those authors to DOWNPLAY the significance of their own works. To me, this is the height of bullshit.


Jaenisch Paper Downplay

Fact Check-Controversial MIT study does not show that mRNA vaccines alter DNA

LINK: https://www.reuters.com/article/factcheck-coronavirus-vaccines-idUSL1N2PK1DC

ARCHIVE: https://archive.fo/vJwBk


De Marinis Paper Downplay:

Swedish study on COVID vaccines and DNA misinterpreted

LINK: https://apnews.com/article/Fact-Check-COVID-Vaccine-Sweden-Study-986569377766

ARCHIVE: https://archive.fo/vJwBk


Rather than take these arguments apart myself, I ask you all to take a first crack at the different techniques used, by clicking the links and observing the UNETHICAL SKEPTICISM. Much of this does not require a science background.

In particular, knowing what we know now, after the Mehedi work, I think it should be very clear how much the media went to bat for the vaccines without honestly questioning the “authorities”.

I will confirm your findings in the comments, and catch any straggler sins of science.

To me, this media mendacity is all simple, stupid, and predictable.

“Nothing to see here!”

Frankly, it changes nothing for me, if any of these authors get talked into walking back their own work, because push-back on critical work is a common phenomenon in the history of science. Not all scientists are capable of weathering the storm. Here are TWO that did. Both got Nobel prizes, by the way.


A classic case, emphasizing a field aversion among an establishment group to a field solution emerging from deductive reasoning, was Van’t Hoff and tetrahedral carbon. Basically, a doctoral candidate in an applied science school had the temerity to take an old hypothesis and revive it as the solution to a very significant current problem. The guy was good – he went on to win a Nobel prize for other work. However, many chemists, especially older ones, rejected the idea, in my opinion by not prioritizing explanatory power over their own abstract philosophical preconceptions. The fact that important people rejected an elegant solution of remarkable utility and truth shows how bad group-think problems can be in science.

Another case was Rick Smalley and C60 (buckminsterfullerene). The linked article accurately describes the initial skepticism that people had for “soccer ball carbon” or “bucky balls”.

The Nature letter describing C60 was attractive and logical, but seeing a line in a mass spectrum did not convince all scientists of the discovery of a new allotrope of carbon. During the period 1985-1990, the Curl/Smalley team at Rice and Kroto at Sussex managed to amass a wide range of circumstantial evidence to support the fullerene structure proposal. Full acceptance came when Wolfgang Krätschmer of the Max Planck Institute for Nuclear Physics in Heidelberg, Germany, and Donald Huffman of the University of Arizona, with their students Konstantinos Fostiropoulos and Lowell Lamb, succeeded in synthesizing C60 in sufficient quantities to allow structural characterization.

I personally remember colleagues assuring me that Smalley was loony, demented, senile, past his prime, or at best something along the lines of “a nice guy, but clearly deluded and obsessed with an error.” The doubt about C60 as reality – particularly as a stable reality – ran thick. And that doubt was WRONG from the very beginning.


Scientists right now are NOT THINKING, and they’re letting the MEDIA push them around.

Scientists are also letting guys like Anthony FAUCI push them around, mainly by the horrible federal grant system, and by the psychology of woke universities, both designed to control science.

And that doesn’t even begin to address other malign interests altering science and medicine in dishonest ways.


Some Actual Speculation – Why Would They Push These Clearly Defective Shots So Hard?

You want some actual “conspiracy theorizing”? Here it is.

Let me go back to my “TLDR” again…..

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.

There are reasons to suspect depopulation as a motive for these vaccines, and both Gail Combs and I have written extensively about this. I continue to believe that this is part of the motivation of the “complex event” we have been undergoing, between virus and vaccine.

Depopulation is very important to these people.

MALTHUSIANS AND EUGENISTS MAKE A CASE FOR POPULATION CONTROL

DEPOPULATION – NEVER LET A CRISIS GO TO WASTE

The Population Control Shot – Introduction

The Population Control Shot – Understanding the Peoples Climate Temple

Likewise, there are many other motives, ranging from mercenary profits, to promoting gene therapy, to “Covid communism”, and beyond. Many of these roads lead back to WEF – the World Economic Forum. One of those roads may be an actual attempt to commit humanity to a future of genetic engineering as a kind of fait accompli.

Just listen to Yuval Noah Harari talk about changing humanity. A few times he talks about “we”, “I”, “me”, “my”, and “our” programs of genetic engineering of humanity. It’s not just creepy and megalomaniacal – it seems quite self-assured.

WEF’s interest in genetic transformation of humanity cannot be understated. You will note in the above video, the presence of Jennifer Doudna – the Nobel laureate who (IMO) was most responsible for pushing CRISPR gene editing technology forward. Here is the full video.

I have discussed the technology recently here:

Dear KMAG: 20230213 Joe Biden Didn’t Win ❀ Open Topic / Introduction to CRISPR/Cas9 Gene Editing Technology

This is a particularly good explanation for those who want to dig into the science a little.

So how does CRISPR-Cas9 connect to the spike protein?

I have mentioned that the spike not only is proven to have nucleus-opening properties and cell nuclear mRNA-trafficking properties, but it likely has reverse-transcribing properties as well. Thus, it may have utility in facilitating certain varieties of genomic incorporation of genetic material beyond its own spike mRNA. I’m leaving that open very broadly. We don’t really know how far the “nuclear translocation of mRNA” capabilities of the spike protein actually go.

But even just the incorporation of its own instructions into the cellular genome, makes the spike protein highly relevant to CRISPR-Cas9 gene editing technology.

We can’t REALLY be sure what happens if the spike protein code gets into egg or sperm DNA, and goes on to be a “feature” of every human cell of a “spike baby”, but I can say one thing – if that gene can be REMOVED during in vitro fertilization (IVF) by CRISPR-Cas9 technology, to the betterment of the child, then it’s very likely going to be demanded by elite parents, to assure a healthy baby.

So – I ask again – WHAT ARE THE CHANCES?

What are the chances, that people who are gung-ho on the “solution” of genetic modification of humanity – you know – like WEF – would have anything to do with releasing a virus and promoting a vaccine that would almost FORCE us into that future?

I think that this era is a lot like the chemical revolution of the late 1800s, precisely when Van ‘t Hoff was dealing with chemical theory. Figures like Malone and Doudna operate in the time of our own biological revolution. Remember Rockefeller, and what he did to science and medicine back during the chemical revolution. Well, now we have Gates and what HE did to science and medicine during the biological revolution.

Personally, I think it’s high time for us to stop taking shit from the corporate media – and particularly the “fact checkers” like Reuters and the AP – as they LIE to our faces about science – as they deny reality on behalf of the corporate titans behind them.

These mRNA vaccines are DEFECTIVE relative to how they were sold to us – very likely by intention – and the media and media organizations have LIED to us about those vaccines in the most scurrilous ways. The media has defended LIES and defrauded all of us.

You don’t have to be FOR or AGAINST gene editing per se, to be against LYING, DEFRAUDING, and FORCING IT ON THE WORLD by a criminal conspiracy.

We need to demand TRUTH about the vaccines, or the SHUTTERING of these “media” companies and organizations, which have cosigned onto crimes against humanity.

Demand no less. TRUTH or BREAK-UP. Media that lies and conceals is USELESS and a hindrance to REAL SCIENCE.

W

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you.


TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic incorporation found for both the virus and the vaccines. The special key and the mRNA shepherding can be considered to be defects in any spike vaccine that has them.

¡Muy explosivo!


Due to comments by WSB and Valerie Curren, I realized that I had to do this post.

Also, NONE of the “bigs” are talking about this, but it is HUGE, if only people will read the paper.

By sheer luck, I was alerted to this new development ASAP on Twitter.

A follower of mine, who I had followed back, posted on Twitter the link to a paper with this title:

Nuclear translocation of spike mRNA and protein is a novel feature of SARS-CoV-2

I immediately realized what this was about.

It’s about how the SARS-CoV-2 (COVID) virus spike protein and its mRNA get into the cell nucleus – an extremely important point which WSB has been hitting on over and over. It’s very important, because THAT is how “genomic incorporation” happens. And genomic incorporation is what HIV does – what retroviruses do. They “get into” the DNA and leave cookies, so to speak.

Sometimes, they leave enough cookies, that the whole virus comes back out, fully functional, and ready to infect. Sometimes, they only leave enough junk in the DNA to cause some damage. Sometimes, they leave enough to change us – and that is why human DNA is filled with “viral leftovers”.

In principle, mRNA technology should NOT do this. We were TOLD that mRNA technology could not do this. But somebody LIED TO US. And not only that – NOBODY – from Bill Gates on down – ever apologized to us about lying, or even about just “being mistaken”.

We’ll get to that later.

You will recall that there are two papers I love to mention.

One is the “Jaenisch paper”, which describes how the SARS-CoV-2 virus manages to get some of its genetic instructions for the spike protein into the DNA of cells.

LINK: https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1

ARCHIVE: https://archive.fo/XWC52


The other is the “De Marinis paper”, which describes how the Pfizer vaccine did the same thing to human liver cells in vitro – meaning that in an experiment using cells in culture, the Pfizer vaccine got its mRNA sequences into the DNA genetic material of human liver cells, and it did so in a matter of minutes.

McCullough got in a lot of trouble with Twitter for posting this, even though it was utterly true. Now we know that the government was trying to shut it down. They likely used the technicality of McCullough’s very VALID speculation (stated as speculation and concern), which turned out to be correct, IMSO.

LINK: https://www.mdpi.com/1467-3045/44/3/73

LINK: https://portal.research.lu.se/en/publications/intracellular-reverse-transcription-of-pfizer-biontech-covid-19-m


These papers explain ALMOST everything. When I saw the Jaenisch paper, I predicted that we would see the De Marinis paper. MEANING – when I saw that the virus could get mRNA into the DNA, I predicted that the vaccine might get its mRNA into the DNA, too. And yes, I was right. Clearly others thought the same thing, and decided to investigate.

Now, after the De Marinis paper, it seemed very obvious to me that one did not need any kind of special conditions or reverse transcription promoters to get the vaccine mRNA to incorporate.

That bothered me, and I suspected, at the time, that MAYBE – just maybe – the spike protein ITSELF was somehow causing genomic incorporation – that it functioned as a kind of reverse transcription promoter.

Well, it sure looks like that is the case.

According to the discoveries revealed in the new paper, which I have taken to calling the “Mehedi paper”, there is a special sequence in the spike protein that acts like a “key to the nucleus” – and this sequence is found in NO other coronavirus spike protein.

LINK: https://www.frontiersin.org/articles/10.3389/fmicb.2023.1073789/full

ARCHIVE: https://archive.fo/kW9Bd

Here is the abstract of the new paper.


Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes severe pathophysiology in vulnerable older populations and appears to be highly pathogenic and more transmissible than other coronaviruses. The spike (S) protein appears to be a major pathogenic factor that contributes to the unique pathogenesis of SARS-CoV-2. Although the S protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.


Let me put that in plainer English.


COVID-19 really hurts old people and seems to be both deadlier and easier to catch than other coronaviruses. The spike protein seems to be why. Although the spike protein is a surface protein that normally would not do this, it might be predicted to get into the cell nucleus because it has a special sequence “PRRARSV,” a known key to the nucleus which appears in no other coronavirus. Sure enough, the COVID spike protein gets into the nucleus of infected cells. What’s more, the mRNA for COVID spike protein also gets into the nucleus. What happens is that the spike mRNA collects near the spike protein, which helps it get in. While a different protein called the “nucleoprotein” of many coronaviruses is known to get into the nucleus of cells, the penetration of the cell nucleus by BOTH the spike protein AND the mRNA for it, seems to be a unique new feature of the SARS-CoV-2 virus.


Once you read it in plain English, it’s much more mind-blowing.

Now – I really recommend that you read the rest of the paper, but it’s really just technical details about what was mentioned in the abstract. Those details can help you gauge the expectedness or unexpectedness of things, but I have tried to do that as best as I could in the translation.

At this point, you should have all kinds of questions.

  • could this defect of the vaccines have been predicted?
  • should it have been predicted?
  • did the Chinese know this when they sent us the sequence?
  • did we know it when we got the sequence?
  • would NOT using the full spike protein have prevented this?
  • if so, why did we use the full spike protein anyway?
  • would the “forbidden” Winfried Stöcker RBD vaccine have avoided this?
  • if so, why was his vaccine suppressed by the German government?
  • does this affect the Peter Hotez vaccine, Corbevax?
  • if not, why didn’t his vaccine get promoted through the process quicker?
  • is nuclear penetration a common problem with mRNA technology?
  • how did this “key” get into the sequence? Naturally or not?
  • could “directed evolution” of the spike have yielded this?
  • why wasn’t this clear from the moment we got the sequence?
  • did people know this and hide the information?
  • were key people like Bill Gates (their side) and Robert Malone (our side) aware of this possibility?

The last question is a gift to WSB and her virologist friend. I am by default a defender of Dr. Malone, but WSB and her friend are long-time skeptics of the technology, and thus of Dr. Malone. In all fairness, I think we have to ask EVERYBODY the same questions.

  • Did people KNOW that mRNA technology had this vulnerability?
  • Does this look any more like an engineered bioweapon, designed to get into the nucleus?
  • Was this thing made by nature, by people, or by somebody with more advanced technology?
  • What is the purpose of getting into the nucleus, if it is designed to do that?

That should be enough. I will leave some links to prior comments I have made, in an appendix, hopefully added later.

Thank you.

W

John Fink and James Coburn discuss case in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

PS – A great interview of our site mascot!

https://thehollywoodinterview.blogspot.com/2008/02/james-coburn-hollywood-interview.html