Dear MAGA: 20230507 Open Topic

This Rejoice & Praise God Sunday Open Thread, with full respect to those who worship God on the Sabbath, is a place to reaffirm our worship of our Creator, our Father, our King Eternal.

It’s also a place to read, post, and discuss news that is worth knowing and sharing. Please post links to any news stories that you use as sources or quote from.

In the QTree, we’re a friendly and civil lot. We encourage free speech and the open exchange and civil discussion of different ideas. Topics aren’t constrained, and sound logic is highly encouraged, all built on a solid foundation of truth and established facts.

We have a policy of mutual respect, shown by civility. Civility encourages discussions, promotes objectivity and rational thought in discourse, and camaraderie in the participants – characteristics we strive toward in our Q Tree community.

Please show respect and consideration for our fellow QTreepers. Before hitting the “post” button, please proofread your post and make sure your opinion addresses the issue only, and does not confront or denigrate the poster. Keep to the topic – avoid “you” and “your”. Here in The Q Tree, personal attacks, name-calling, ridicule, insults, baiting, and other conduct for which a penalty flag would be thrown are VERBOTEN.

In The Q Tree, we’re compatriots, sitting around the campfire, roasting hot dogs, making s’mores, and discussing, agreeing, and disagreeing about whatever interests us. This board will remain a home for those who seek respectful conversations.

Please also consider the Guidelines for posting and discussion printed here: 
https://www.theqtree.com/2019/01/01/dear-maga-open-topic-20190101/


On this day and every day –

God is in Control
. . . and His Grace is Sufficient, so . . .
Keep Looking Up


Hopefully, every Sunday, we can find something here that will build us up a little . . . give us a smile . . . and add some joy or peace, very much needed in all our lives.

“This day is holy to the Lord your God;
do not mourn nor weep.” . . .
“Go your way, eat the fat, drink the sweet,
and send portions to those for whom nothing is prepared;
for this day is holy to our Lord.
Do not sorrow,
for the joy of the Lord is your strength.”


Glory to God 2

So, how is God is glorified through us? There are many ways to do this but today let’s look at just one way we can glorify God.

GLORIFY GOD BY BELIEVING IN HIM

If the chief end of man is to glorify God then, this is only truly possible when we are most satisfied in Him. Straight away we see something significant here. When we think of praise or glory that is given to someone, sometimes it can be of gratitude and other times we can think of it as a chore, or something we need to do in order to obtain favor. When we think of giving glory to God, we can often and very easily fall into the trap of thinking of it as a demand and that, it just has to be done.

From the Christian and Biblical viewpoint this is the very opposite of the intent. We fail to understand that everything God requires of us is “ultimately” for our good. God is for us and not against us. In order to fully fulfill the reason for our creation, then what God’s Word says is that; it is only when we glorify God, fulfilling our very purpose – it is then and only then that our souls are truly satisfied, feel complete and fulfilled. Anything outside of this will keep us wanting and unfulfilled, no matter what and how we try to fill that hole. By glorifying God, we are pursuing our joy in Him.

In order for us to come to the place of pursuing our joy in Him and glorying God, it is essential for us to be saved. We must come in repentance of our sins and believe in the Lord Jesus Christ through faith in Him, accepting the free gift of the sacrifice of the Christ on the cross as an atonement for our sins.

In this way we will stand justified before God the Father. Hebrews 11:6 says “And without faith it is impossible to please Him, for whoever would draw near to God must believe that He exists and the He rewards those who seek Him.”

If we reject the reason for our creation, which is to glorify God, and we reject Christ by not believing in His Name, then God’s Word also explains and shows us the outcome of pursuing our satisfaction outside of God. Jeremiah 2:12-13 says “Be appalled, O heavens, at this; be shocked, be utterly desolate, declares the LORD, for My people have committed two evils; they have forsaken Me, the fountain of living waters, and hewed out cisterns for themselves, broken cisterns that can hold no water.” God’s Word says that God is against anyone that does not seek their joy in God.

Again in Deuteronomy 28:47-48 saying “Because you did not serve the LORD your God with joyfulness and gladness of heart,  because of the abundance of all things, therefore you shall serve your enemies whom the LORD will send against you.” And this is exactly what some people are doing. Worshiping their enemy.

Our ultimate enemy is Satan, and those without faith are enslaved to do the things that are of him and not of God. Those who are not of God, are in fact serving the purpose of their enemy – the devil, who wants to completely destroy us and keep us from the Father in heaven.

So, for those in this situation, wake up and do not serve our enemy any longer, but serve the living God who is for us and not against us. As it says in 1 Corinthians 15:34 “Wake up from your drunken stupor, as is right, and do not go on sinning.”

The word of God shows us the path that we should take in order to find our joy in God. When we pursue this joy in Christ, then it will lead us to glorify God. When we believe in the name of the Lord Jesus Christ, then we will  find our ultimate joy in Him. Psalm 37:4 says “Delight in the Lord; And He will give you the desires of your heart.”, and again in Psalm 100:1-2 saying “Make a joyful noise to the Lord, all the earth! Serve the LORD with gladness! Come into His presence with singing!”

So by believing, we not only glorify God and find our fulfillment in Christ, but there is also great joy in doing so.

But it does not stop at only believing; this is just the beginning. The life that pleases and glorifies God is one that “keeps on growing in knowledge”. It is continually seeking to know God better.

2023·05·06 Joe Biden Didn’t Win Daily Thread

Joining The Herd Of Lemmings

I’ve had cause to consider a few things. Maybe we’re going about it the wrong way, and we need to ditch Trump

Yeah, NO

Trump all the way! Why? Because being hated by the people who hate him is a sign of impeccable character, that’s why.

The haters can go fuck themselves with rusty twelve gauge bore brushes. I’d prefer ten gauge but that’s kind of scarce, so…I’m willing to compromise.

The RINO’s Dilemma

The RINOs who who have burrowed in and taken over most GOP organizations, from the state down to local organizations, have quite a dilemma on their hands, and most of them have their heads too far up their asses to realize it.

OK, I’m not talking about the liberal in a Republican area, who knows they’re in the wrong party, but is there because it’s the only game in their town; they hope to capture a nomination someday, at which point they’re guaranteed to be elected…otherwise, they never will be. These people are a hazard in any heavily conservative area.

No, I’m talking about the guys who are a little bit conservative and want to do some good by going into politics, and they’re in a closely matched area, closely enough that they can join the party they are most aligned with and still have a chance. They think the Democrats…particularly the ones who end up running for office…are nuts.

They don’t think much better of the Deplorable types, either. A bunch of bumpkins whose hearts are in the right place, mostly…OK a bit extreme. But they think Deplorables can’t understand that first you have to get elected, then work within the system to change things…a slow process. They genuinely want many of the things Deplorables want…just not as much. The government is spending too much. Or they need to spend money on highways instead of welfare for illegal immigrants. But they want to work within the system to get these things done.

Or maybe they think things are pretty close to ideal right now, and they want to nail it in place.

The problem is, that means they don’t stand for anything in particular. And it shows. They’re about as unappetizing to the electorate as a puddle of dog vomit. The folks in the middle, who they think they are appealing to because they themselves are not extreme, would honestly prefer a clear-spoken radical to someone who qualifies everything they say to the point where they sound like they don’t believe anything at all.

The problem these “Mild RINOs” have, is they just can’t see that. And the reason they just can’t see that, is their entire sense of self-worth is tied up in not seeing that. In their minds, they’ve worked tirelessly for their party, to keep those crazy Democrats out…only to have to constantly fight with a small number of crazy Republicans–who are only liabilities if they end up as candidates. They’ve fought the good fight, and if they can just find the right candidate, someone with some charisma, they might stop the crazies…without being too beholden to the OTHER crazies. In the meantime it’s not working. What’s a responsible guy in politics to do?

They simply cannot understand that the Republicans can’t succeed as the party of nothing in particular. Not really in the past, and certainly not today when people are starting to realize that no matter what they do in the voting booth, the country is still about to fly off a precipice. If they did see it, they’d suddenly have two choices: Go away and let the GOP succeed, or stay and fight. But “go away” isn’t really an option, because what’s the point of having a party now owned by the crazies, win?

Well, they have a dilemma…and WE, therefore have a problem. And we would have that problem even IF they realized that they had a problem…that they were the problem.

No one ever thinks they are the bad guy. Even Epstein probably thought he was the good guy. Right up to the moment where he didn’t kill himself.

So if you ever wonder why these unappetizing dufuses cling on even when their fingernails are being left behind…that’s why. They don’t understand no one wants them, and can’t imagine that no one should want them. And oftentimes their greatest pride is in all the hard work they’ve done for the party. They’re not going to give that up; it’d be psychological suicide.

If you’ve worked with these people, there’s a good chance you like them and consider some of them your friends. But even if so…we’re going to have to give them a good, hard shove. Because America is more important than those milquetoasts’ egos.

Justice Must Be Done

The prior election must be acknowledged as fraudulent, and steps must be taken to prosecute the fraudsters and restore integrity to the system.

Nothing else matters at this point. Talking about trying again in 2022 or 2024 is hopeless otherwise. Which is not to say one must never talk about this, but rather that one must account for this in ones planning; if fixing the fraud is not part of the plan, you have no plan.

Lawyer Appeasement Section

OK now for the fine print.

This is the WQTH Daily Thread. You know the drill. There’s no Poltical correctness, but civility is a requirement. There are Important Guidelines,  here, with an addendum on 20191110.

We have a new board – called The U Tree – where people can take each other to the woodshed without fear of censorship or moderation.

And remember Wheatie’s Rules:

1. No food fights
2. No running with scissors.
3. If you bring snacks, bring enough for everyone.
4. Zeroth rule of gun safety: Don’t let the government get your guns.
5. Rule one of gun safety: The gun is always loaded.
5a. If you actually want the gun to be loaded, like because you’re checking out a bump in the night, then it’s empty.
6. Rule two of gun safety: Never point the gun at anything you’re not willing to destroy.
7. Rule three: Keep your finger off the trigger until ready to fire.
8. Rule the fourth: Be sure of your target and what is behind it.

(Hmm a few extras seem to have crept in.)

Spot (i.e., paper) Prices

Last week:

Gold $1,991.60
Silver $25.15
Platinum $1,084.00
Palladium $1,588.00
Rhodium $9,300.00

This week, 3PM Mountain Time, markets have closed for the weekend.

Gold $2,018.60
Silver $25.77
Platinum $1070.00
Palladium $1,567.00
Rhodium $8,600.00

Gold came within ten dollars of its all time high close on Thursday, it was in the $2050+ range. It got pushed down HARD for Friday.

Fuck Joe B*d*n

Due to complaints about foul language, I’ve censored the most objectionable word in the title of this section.

B*d*n, you don’t even get ONE scoop of ice cream today.

(Please post this somewhere permanent, as it will continue to be true; the SOB will never deserve a scoop.)

Obligatory PSAs and Reminders

China is Lower than Whale Shit

Remember Hong Kong!!!

中国是个混蛋 !!!
Zhōngguò shì gè hùndàn !!!
China is asshoe !!!

China is in the White House

Since Wednesday, January 20 at Noon EST, the bought-and-paid for His Fraudulency Joseph Biden has been in the White House. It’s as good as having China in the Oval Office.

Joe Biden is Asshoe

China is in the White House, because Joe Biden is in the White House, and Joe Biden is identically equal to China. China is Asshoe. Therefore, Joe Biden is Asshoe.

But of course the much more important thing to realize:

Joe Biden Didn’t Win

乔*拜登没赢 !!!
Qiáo Bài dēng méi yíng !!!
Joe Biden didn’t win !!!

DEAR MAGA: TGIF Open Thread 20230505

As it is derby weekend, the Friday cocktail is:

Classic Bourbon Mint Julep

Ingredients

  • 4 to 5 mint sprigs, leaves only
  • 2 sugar cubes, or 1/2 ounce simple syrup
  • 2 1/2 ounces bourbon whiskey
  • Mint sprig, for garnish

Steps to Make It

  1. Gather the ingredients.Ingredients to make classic mint julep
  2. Place the mint leaves and sugar or simple syrup into a julep cup, collins glass, or double old-fashioned glass. Muddle well to dissolve the sugar and release the oil and aroma of the mint.Pour simple syrup into cup.
  3. Add the bourbon. Fill the glass with crushed ice and stir well until the glass becomes frosty. Garnish with a mint sprig.Stirting ice in mint julep.

When finished with said drink, look for a place to lie down.

Okay, onward….

Badlands News Brief – May 5, 2023

Midsized Regional Lenders See Selloffs As First Republic Collapse Spooks Investors

Why Some Transgender People Are Turning On Bud Light After Mulvaney Drama

China, Trump and Covid-19

Report: Unprecedented Rise in Hate Crimes against American Churches

Economics, politics, and war are all one thing

Why the Bud Light Boycott Is Working

For now. Another link down the list is a reality check on the whole thing.

Report: FBI Assists Ukraine in Fighting ‘Disinformation’ on Facebook

In other news, water is wet.

Unrigging Our Elections

The FBI’s Catholicism Memo Is No Laughing Matter | Opinion

Thread from Robert Kennedy, Jr., on crypto. He just made the case against him being president.

‘I think he’s in trouble’: Growing number of Ron DeSantis donors and allies hope for a shake-up

De-dollarization: Not a matter of if, but when

So it seems. However, there are those out there who disagree.

IRS, EPA, SBA and other non-law enforcement federal agencies arming to the teeth with exotic weapons and bulk ammo purchases: ‘A culture of militarization has permeated across the federal bureaucracy’

Good thing the populace has guns.

The emboldened left has a new target at Fox News: Jesse Watters…..

Predicted. Maria Bartiromo and Judge Jeanine won’t be far behind.

They are Males, but They’re Not Men

Trends in Number of COVID-19 Vaccinations in the US

Dropping like a rock.

Why these boycotts are working

They are sending a message, yes.

Stuck in a Groove of Negativity and Hopelessness

Why a Veterans-Owned Freeze Dried Beef Company Unabashedly Embraces an America First Worldview

BOMBSHELL! Bud Light Parent Company, AB Inbev, is Going to be Fine. BOOM!

Agree, but for a number of other reasons, namely that American conservatives are not their only customers. A message is being sent – and has been received – but the effort is not going to submarine the company.

The Real Reason Why the Pharmaceutical Industry Is Spending Far More on Television Advertising Than Anyone Else

And from Sundance:

Position Reversed Again – Nashville Police Refuse to Release Transgender Audrey Hale Christian Murder Manifesto

The California Contagion – PacWest Teters on Becoming the Next Regional Bank to Collapse as Regional Banking Stocks Continue Severe Drops

Merrick Garland Delivers Speech Following Conviction of Four J6 Defendants for “Sedition” – Seditious Conspiracy

Comrades, today after ordering the slow drums to resound loudly, U.S. Attorney General Merrick Garland delivered remarks celebrating the conviction of four Americans who were charged with Seditious Conspiracy for their conduct on January 6, 2021.   Together with federal enforcer Christopher Wray and Deputy AG Lisa Monaco at his side, AG Merrick Garland warns everyone to stay obeyance with the dictates and fiats of the regime.

Drama drama drama.

Tweety Tweets:

Boycotting the “news” programming is actually more important than consumer goods in the long run.

And so many of the people I know who watch FOX are actually pretty smart.

Leave it up to the Italians to lead on this matter.

FINALLY!

MEME STASH:

https://twitter.com/PuppiesIover/status/1654168372882309144
https://twitter.com/_B___S/status/1654183368588656640

And now for the business portion of the post borrowed from Tuesday:

Guidelines for posting and discussion on this site were outlined by our host, WolfM00n. Please, review them from time to time.

The discourse on this site is to be CIVIL – no name calling, baiting, or threatening others here is allowed. Those who are so inclined may visit Wolf’s other sanctuary, the U-Tree, to slog it out. There is also a “rescue” thread there for members of the Tree to rendezvous if the main site goes kablooey. A third site has been added for site outages of longer duration.

This site is a celebration of the natural rights endowed to humans by our Creator as well as those enshrined in the Bill of Rights adopted in the founding documents of the United States of America. Within the limits of law, how we exercise these rights is part of the freedom of our discussion. In that spirit, though, threats of violence real or hypothetical are out of bounds.

Fellow tree dweller the late Wheatie gave us some good reminders on the basics of civility in political discourse:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And Auntie DePat’s requests:

If you see something has not been posted, do us all a favor, and post it. Please, do not complain that it has not been done yet.

The scroll wheel on your mouse can be your friend. As mature adults, please use it here in the same manner you would in avoiding online porn.

_____________________________________________________

JOHN 14:1-6

1“Let not your hearts be troubled; believe in God, believe also in me. 2In my Father’s house are many rooms; if it were not so, would I have told you that I go to prepare a place for you? 3And when I go and prepare a place for you, I will come again and will take you to myself, that where I am you may be also. 4And you know the way where I am going.” 5Thomas said to him, “Lord, we do not know where you are going; how can we know the way?” 6Jesus said to him, “I am the way, and the truth, and the life; no one comes to the Father, but by me.

SATIRE!

Have a good weekend!

DEAR MAGA: Open Thread 20230504

HAPPY STAR WARS DAY!

Diving in:

Badlands News Brief – May 3, 2023

Miriam Grossman talks powerfully with Dr. J.P. about the forgotten victims of the trans

The Dissident Right Loses Its Voice—for Now

Patrick Bet-David Offers Tucker Carlson A Home At Valuetainment!

$100,000,000 contract. Any number of professional athletes are probably thinking they pursued the wrong career.

Ford posts $1.76B 1Q profit largely on gas-powered vehicles

The customer base is always right.

WHO’S NEW PANDEMIC PREVENTION PLAN: FIRST FOCUS – RESPIRATORY PATHOGENS

Trying to scare us again?

OPEC Commences New Production Cuts

As if gas wasn’t already too expensive.

EXCLUSIVE: GOP Takes on Biden Executive Election Takeover

Could $100 Million Loan from Chinese State Bank to Rupert Murdoch Explain Tucker’s Ouster?

Half of America’s banks are potentially insolvent – this is how a credit crunch begins

Vegetable Oils Linked To Ovarian Toxicity, ‘Estrogenic Properties’ In New Study

Another source of phyto-estrogen.

Covid Hospital Protocols Destroyed Thousands of American Families

Men of the West, On the Cusp

The GOP Has a Gen Z Problem

As gen z grows up, they will change. Every generation before them did.

An Age of Repoliticization

A Paleoconservative Return

‘Which NBA team would have her?’ Riley Gaines on Brittney Griner backing transgender athletes

The Crisis of American Journalism

How many more bank failures will it take to shake Americans’ confidence in the ‘full faith and credit’ of the U.S. government?

The Morning Briefing: Forget Biden, AI Might Kill Us First

Legacy of the Bavarian Illuminati – Part 1

Pentagon-Funded Censorship Firm Graphika Began Monitoring Covid “Disinfo” On Dec. 16, 2019 – Two Weeks Before WHO Knew Covid Existed

‘The DeSantis people are rookies’: Even Trump critics say he’s running circles around DeSantis

Housing Stick Save or Blow Off Top?

Same playbook, different decade. Yes, they are trying this $#!+ again.

The Decline & Fall of Fox News Has Finally Arrived!

TWEETS:

https://twitter.com/JosephJFlynn1/status/1653719119760433152

It’s a Tabernacle Light. No Tabernacle Light ever started a fire.

Oh, well.

https://twitter.com/CounterproPepe/status/1653490013034926081

MEMES:

https://twitter.com/fasc1nate/status/1653595640654438417
https://twitter.com/_B___S/status/1653474511579168786
https://twitter.com/Figensport/status/1653831645504348160

In honor of Star Wars Day:

____________________________________

And now for the business portion.

Please review our HOST and site owner’s Guidelines for posting and discussion for this site. Wolf is kind enough to put up with *most* of us and our antics after thorough vetting. Violators of the baiting and deliberately attempting to divide the group rules WILL face consequences.

The discourse on this site is to be CIVIL – no name calling, baiting, or threatening others here is allowed. Company manners are appreciated. Those who are so inclined may visit Wolf’s other sanctuary, the U-Tree, to slog out discussions best saved for a wrestling mat. If, for some reason, this site is not available, head over to the UTree and visit the post at the top of the list or the closest rescue thread.

This site is a celebration of the natural rights endowed to humans by our Creator as well as those enshrined in the Bill of Rights adopted in the founding documents of the United States of America. Within the limits of law, how we exercise these rights is part of the freedom of our discussion.

THAT MEANS THAT ALL OF US HERE ARE ENTITLED TO OUR OPINIONS AND PREJUDICES, ETC., SO LONG AS THEY CAUSE NO PHYSICAL HARM TO OTHERS OR DOXX OUR FELLOW TREE DWELLERS.

All opinions here are valued for the diversity they bring to the issues, and the shaping of understanding regarding topics for which many of us do not have all information. Correcting the record on any one topic is appreciated.

Be careful in expressing thoughts as we would all like to think well of the rest of the group, and ill-thought out comments have a way of wrecking that for everyone.

Fellow tree dweller, the late Wheatie, gave us some good reminders on the basics of civility in political discourse:

  1. No food fights
  2. No running with scissors
  3. If you bring snacks, be sure they are made with bacon

Auntie DePat’s requests as we are all supposedly adults and don’t just play them on TV like the body doubles pretending to be the squatter in chief:

If you see something has not been posted, do us all a favor, and post it. Please, do not complain that it has not been done yet.

The scroll wheel on your mouse can be your friend. As mature adults, please use it here in the same manner you would in avoiding online porn.

Thank you so much for any and all attention to such details. It is GREATLY appreciated by more than one party here.

____________________________________________________

ACTS 13:13-25

13Now Paul and his company set sail from Paphos, and came to Perga in Pamphyl’ia. And John left them and returned to Jerusalem; 14but they passed on from Perga and came to Antioch of Pisid’ia. And on the sabbath day they went into the synagogue and sat down. 15After the reading of the law and the prophets, the rulers of the synagogue sent to them, saying, “Brethren, if you have any word of exhortation for the people, say it.” 16So Paul stood up, and motioning with his hand said: “Men of Israel, and you that fear God, listen. 17The God of this people Israel chose our fathers and made the people great during their stay in the land of Egypt, and with uplifted arm he led them out of it. 18And for about forty years he bore with them in the wilderness. 19And when he had destroyed seven nations in the land of Canaan, he gave them their land as an inheritance, for about four hundred and fifty years. 20And after that he gave them judges until Samuel the prophet. 21Then they asked for a king; and God gave them Saul the son of Kish, a man of the tribe of Benjamin, for forty years. 22And when he had removed him, he raised up David to be their king; of whom he testified and said, `I have found in David the son of Jesse a man after my heart, who will do all my will.’ 23Of this man’s posterity God has brought to Israel a Savior, Jesus, as he promised. 24Before his coming John had preached a baptism of repentance to all the people of Israel. 25And as John was finishing his course, he said, `What do you suppose that I am? I am not he. No, but after me one is coming, the sandals of whose feet I am not worthy to untie.’

_____________________________________________________

SATIRE

Dear KAG: 20230503 Open Thread

Stopping off at Yellowstone….

Cover image: Old Faithful Geyser erupting at sunset is a photograph by Thomas Elsnab

Are we ready kids?

Starting with banking:

JP Morgan boss plays down risk of crisis after second biggest bank failure in US history

. . . The Truth About What the Banking Crisis REALLY Means for Your Money

Three More Banks See Stock Trading HALTED, Financial Sector Collapse Contagion Accelerates as Migrant INVASION Staged for US Southern Border

Tucker, Blackrock and the SIFI Two-Step

That one is a frightening read. Right now, the only thing standing between the Deep State and American retirement savings is Jerome Powell.

On to Bud Light:

The Untold Story of the Bud Light Fiasco

🚨JUST IN: Bud Light sales numbers for the week of April 22nd just dropped.

Someday, it will be known as the “My Pillow Effect.” That was the first boycott that really worked to take down woke companies.

Pro-life issues:

Coca-Cola Shareholders Reject Proposal to Stop Selling Products in Pro-Life States

Pro-Life Activists Owe Donald Trump Their Support in 2024

National Abortion Ban Is a Trap for 2024 Republicans

This really is an issue for the states, not the federal government. Changing hearts and minds on the matter is the job of faith leaders.

Everything else:

Badlands News Brief – May 3, 2023

Survey shows 41% of young LGBTQ people contemplated suicide in the last year

We have a mental health crisis on our hands.

A Woman is not a Cat

The New Robber Barons

Now Progressives are Sneering at Economics

Tucker Carlson and the Silk Purse

The Other Hills to Die On

The Conservative Case for Getting Sued Into Oblivion

Winning the Culture War in an Age of Incoherence

Exclusive – Rep. Lance Gooden: DeSantis Is ‘Not Quite Ready’ for the Presidency

“In my heart, I thought I would probably eventually be on board with the Trump team, but I wanted to do my due diligence first and be able to actually honestly say that I had vetted the candidates, the serious candidates,” he said. “And I spoke with DeSantis. He was a nice guy, but I realized he’s not quite ready to be in Washington and in the presidency. I think he’s done a decent job as governor and should probably finish out his term and focus on that.”

“But we just can’t afford someone coming to the White House that doesn’t have experience and doesn’t know what they’re doing in the situation they’re in, and when we have an option, and that option is Donald Trump, that has the experience that knows how to defeat these people — and by people, I mean, the Democrats who are seeking to destroy our nation — it just seems crazy to me that we wouldn’t rally behind him and support his campaign, and so that’s what I’m doing,” he added.

We Must Seize the Means of Propaganda

Why Do We Know What We Know?

Bipartisan group, including Gaetz and Ocasio-Cortez, unveil bill to ban lawmakers from owning stocks

We’ll see how far they get with this given the gravy train the politicians are riding.

Pfizer’s COVID-19 Vaccine Sales Crash as Company Reports Drop in Revenue

Guess there’s no demand anymore.

Tweets!

Systematic destruction in action.

Nothing new under the sun.

The liberals always defend Justice Thomas. That says something about the man.

Oh, well.

https://twitter.com/RealJamesWoods/status/1653466523087032320

MEMES!

They don’t make ’em like this anymore.

Have a good day y’all.

(I don’t remember who brought this to a daily in the comments, but thanks.)

And, of course, the obligatory George Carlin:

Per the Boss:

https://youtu.be/NBE-uBgtINg

And now for the obligatory message from our sponsors:

Here at the Q tree we believe in the concept of CIVIL open free speech and the discussion that fleshes out ideas. When commenting and participating in the OPEN discussion on this thread all comments MUST NOT CONTAIN personal threats, baiting, name calling, or other anti-social words fomenting hate, violence or destruction. Our host Wolfm00n has strict rules about that.

Fellow tree dweller, the late Wheatie, gave us some good reminders on the basics of civility in political discourse:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone

Please, stock up on blanks for celebratory gunfire, be ready to swing from the chandeliers…and no messing with the nuclear weapons.

Please remember to remain locked and loaded and ready for trouble should the insurrectionists try to invade your space.

Those who have things to say that do not fit the generally accepted limits of “civil” discussion, Wolf has provided a venue known as the UTree. You’re welcome to visit over there and say hi to anyone hanging out over there. The “Rescue Thread” is also over there. In the event a rendezvous of the tree is needed, please check it out, as well as the newest rescue venue.

Auntie DePat’s requests:

If you see something has not been posted, do us all a favor, and post it. Please, do not complain that it has not been done yet.

The scroll wheel on your mouse can be your friend. As mature adults, please use it here in the same manner you would in avoiding online porn.

Thank you so much for any and all attention to such details. It is GREATLY appreciated by more than one party here.

One other vital note:

Please, review these rules that our host Wolfm00n outlined toward the beginning of the growth of the tree itself. it won’t take long.

__________________________________________________

1 CORINTHIANS 15:1-8

1Now I would remind you, brethren, in what terms I preached to you the gospel, which you received, in which you stand, 2by which you are saved, if you hold it fast — unless you believed in vain. 3For I delivered to you as of first importance what I also received, that Christ died for our sins in accordance with the scriptures, 4that he was buried, that he was raised on the third day in accordance with the scriptures, 5and that he appeared to Cephas, then to the twelve. 6Then he appeared to more than five hundred brethren at one time, most of whom are still alive, though some have fallen asleep. 7Then he appeared to James, then to all the apostles. 8Last of all, as to one untimely born, he appeared also to me.

PSALMS 19:2-5

1The heavens are telling the glory of God; and the firmament proclaims his handiwork. 2Day to day pours forth speech, and night to night declares knowledge. 3There is no speech, nor are there words; their voice is not heard; 4yet their voice goes out through all the earth, and their words to the end of the world. In them he has set a tent for the sun,

JOHN 14:6-14

6Jesus said to him, “I am the way, and the truth, and the life; no one comes to the Father, but by me. 7If you had known me, you would have known my Father also; henceforth you know him and have seen him.” 8Philip said to him, “Lord, show us the Father, and we shall be satisfied.” 9Jesus said to him, “Have I been with you so long, and yet you do not know me, Philip? He who has seen me has seen the Father; how can you say, `Show us the Father’? 10Do you not believe that I am in the Father and the Father in me? The words that I say to you I do not speak on my own authority; but the Father who dwells in me does his works. 11Believe me that I am in the Father and the Father in me; or else believe me for the sake of the works themselves. 12“Truly, truly, I say to you, he who believes in me will also do the works that I do; and greater works than these will he do, because I go to the Father. 13Whatever you ask in my name, I will do it, that the Father may be glorified in the Son; 14if you ask anything in my name, I will do it.

As always, prayers for the fight against that which seeks to enslave us are welcome.

Please include: President Donald Trump, the Q team, our soldiers in the field, special forces, tactical units, first responders and those working behind the scenes…and any and all people with family members in the hospital, COVID or not.

And…members of the QTree who no longer participate for one reason or another.

It is quite clear, as per Wolf’s message from July, that we are under spiritual attack. Building up a robust arsenal of prayer and discipline is a must in fighting the enemy and his minions.

In that spirit, the Prayer to St. Michael the Archangel from Tuesday’s threads, and the Breastplate of St. Patrick, not to mention the Litany of Humility are favorites recommended by exorcists in spiritual warfare.

SATIRE SECTION

Dear KAG: 20230502 Open Thread

Cover image: wallpaper collection, no artist given.

Ready?

Tuberculosis, Tucker Carlson, Joe Rogan

The Accomplishments of President Trump

N. Carolina justices hand GOP big wins with election rulings

Senate passes measure to roll back truck emissions rule

Justice Samuel Alito: ‘This Made Us Targets of Assassination’

. . . The Death of the Dollar, the Rise of the “Digital Dollar,” and Why Central Banks Are Stockpiling Gold [UPDATED]

Badlands News Brief – May 1, 2023

Epstein’s Private Calendar Reveals Prominent Names, Including CIA Chief, Goldman’s Top Lawyer

Jack Dorsey Criticizes Sale of Twitter to Elon Musk

Too late.

Costa Rican sloth antibiotics offer hope for human medicine

The Bidens want ‘all books’ available to students, so I got the D.C. library to buy Tara Reade’s memoir

Sure, why not. There are very few libraries in the nation that are complete repositories. Library of Congress is…and a few colleges perhaps. Seriously, that’s a lot of books.

Government’s Antitrust Case Against Google Moves Forward

Progress at the speed of glacier.

500 Australians Join World’s First COVID Vaccine Injury Class Action Lawsuit

Justice is not going to be swift on this, that’s for sure.

“Yapping Puppy” Brian Kilmeade Lashes Out at Steve Bannon After He Loses Nearly 2/3s of Tucker’s Audience in Less than One Week

The headline makes that one worth it.

Why Tucker Carlson was Doomed

Yes, RFK Jr Can Give Joe Biden a Run for His Money for One Reason

Conservatism, Inc. Fiddles While the Republic Burns

I love the signs of red pills in the morning.

We Must Declare Jihad Against A.I.

JOHN PILGER: FROM YELLOW JOURNALISM TO CHINA BASHING, THE MEDIA’S ENDURING ROLE IN PROMOTING WAR

CHRIS HEDGES: THE ENEMY FROM WITHIN

Will there ever be accountability for Mass Murder by Covid “vaccine”?

Time will tell. The tide hasn’t completely turned yet.

Guardians of the Pedophiles: Epstein, James Gunn, Disney, Mossad, CIA, Balenciaga, Former Presidents, Globalists

One of the Most Transformative Moments in Money Since Jekyll Island

‘The Godfather of A.I.’ Leaves Google and Warns of Danger Ahead

The Soros Tripwire

Tweet hopper:

If nothing else, he’s red pilling many on the vaccine industry.

Dress for how you want to be treated. Yes, it’s my mantra.

Whistleblowers are appearing more and more.

Meme & Fun hopper:

I’ve got a lot more than this, but I need to save some for tomorrow:

https://twitter.com/fasc1nate/status/1652924473052413952
https://twitter.com/fasc1nate/status/1652893765449707520

Something to remember, always.

Per the boss’s instruction:

I’d throw in a few Rockefellers and Rothschilds also.

Of course, this does not mean committing felonies, but standing up to the forces that want to tear this nation – and humanity apart. The very people XVII told us will be destroyed by the time this movie comes to an end are currently roaming the halls of power…supposedly. It’s a sickening sight.

Guidelines for posting and discussion on this site were outlined by our host, WolfM00n. Please, review them from time to time.

The discourse on this site is to be CIVIL – no name calling, baiting, or threatening others here is allowed. Those who are so inclined may visit Wolf’s other sanctuary, the U-Tree, to slog it out. There is also a “rescue” thread there for members of the Tree to rendezvous if the main site goes kablooey. A third site has been added for site outages of longer duration.

This site is a celebration of the natural rights endowed to humans by our Creator as well as those enshrined in the Bill of Rights adopted in the founding documents of the United States of America. Within the limits of law, how we exercise these rights is part of the freedom of our discussion.

Fellow tree dweller, the late Wheatie, gave us some good reminders on the basics of civility in political discourse:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And Auntie DePat’s requests:

If you see something has not been posted, do us all a favor, and post it. Please, do not complain that it has not been done yet.

The scroll wheel on your mouse can be your friend. As mature adults, please use it here in the same manner you would in avoiding online porn.

Thank you so much for any and all attention to such details. It is GREATLY appreciated by more than one party here.

__________________________________________________

1 JOHN 5:1-5

1Every one who believes that Jesus is the Christ is a child of God, and every one who loves the parent loves the child. 2By this we know that we love the children of God, when we love God and obey his commandments. 3For this is the love of God, that we keep his commandments. And his commandments are not burdensome. 4For whatever is born of God overcomes the world; and this is the victory that overcomes the world, our faith. 5Who is it that overcomes the world but he who believes that Jesus is the Son of God?

PSALMS 37:3-6, 30-31

3Trust in the LORD, and do good; so you will dwell in the land, and enjoy security. 4Take delight in the LORD, and he will give you the desires of your heart. 5Commit your way to the LORD; trust in him, and he will act. 6He will bring forth your vindication as the light, and your right as the noonday. 30The mouth of the righteous utters wisdom, and his tongue speaks justice. 31The law of his God is in his heart; his steps do not slip.

MATTHEW 10:22-25

22and you will be hated by all for my name’s sake. But he who endures to the end will be saved. 23When they persecute you in one town, flee to the next; for truly, I say to you, you will not have gone through all the towns of Israel, before the Son of man comes. 24“A disciple is not above his teacher, nor a servant above his master; 25it is enough for the disciple to be like his teacher, and the servant like his master. If they have called the master of the house Be-el’zebul, how much more will they malign those of his household.

109

Anonymous ID: hHkrVD7x No.148156632 
Nov 5 2017 20:06:36 (EST)

Anonymous ID: pqW40Wgk No.148156518 
Nov 5 2017 20:05:48 (EST)

>>148154137

St. Michael the Archangel, defend us in battle. Be our protection against the wickedness and snares of the devil. May God rebuke him, we humbly pray. And do thou, Prince of the Heavenly Hosts, by the power of God, cast down to Hell Satan and all his evil spirits, who prowl about the world seeking the ruin of souls. Amen.

>>148156518
Amen brother.
Q

As always, prayers for the fight against that which seeks to enslave us are welcome. Via con Dios.

Satire

That’s more true than satire.

https://twitter.com/Travis_in_Flint/status/1653077343185825793

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230501 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

CLEVELAND, OH – JULY 18: Melania Trump kisses her husband and Presumptive Republican presidential nominee Donald Trump, after delivering a speech on the first day of the Republican National Convention on July 18, 2016 at the Quicken Loans Arena in Cleveland, Ohio. An estimated 50,000 people are expected in Cleveland, including hundreds of protesters and members of the media. The four-day Republican National Convention kicks off on July 18. (Photo by Chip Somodevilla/Getty Images)

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

Pardon any housekeeping that may be necessary….

We’re gonna have some fun!

HOLD ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Looks like y’all ‘r’ gittin’ s’more country. Even if it’s a re-peat.

Suck it up, tip your hats, and DANCE!

But YouTube thinks we need a “Wheatie song”, and I ain’t one to disagree!

And now – something actually good out of Portland, recently.

AW, heck – one more country song!

https://youtu.be/yLmHb3CAKZU

(Butcha cain’t watch it here!)


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://www.foxnews.com/opinion/hunter-bidens-twisted-attempts-keep-little-girl-using-name-new-realm
https://conservativebrief.com/they-fear-72919/

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


eponymous

trendy adjective

  • a person or thing after which something is named (such as an inventor, discoverer, creator, or founder) – OR IN REVERSE…..
  • the thing itself that has been named after someone or something
  • character in a play, book, etc. has the same name as the title
  • an adjective, place name, or other thing which comes from the name of a person
  • of, relating to, or constituting an eponym

Used in a Sentence:

  • Victorian, Wagnerian, and dickensian are all examples of eponymous adjectives.
  • An eponymous character in a play, book, etc. has the same name as the title.
  • Tucker Carlson’s eponymous nightly show debuted in November 2016.

Use for the eponymous “Holderama”:


ENJOY THE SHOW

Have another great week!

W

Dear MAGA: 20230430 Open Topic

This Rejoice & Praise God Sunday Open Thread, with full respect to those who worship God on the Sabbath, is a place to reaffirm our worship of our Creator, our Father, our King Eternal.

It’s also a place to read, post, and discuss news that is worth knowing and sharing. Please post links to any news stories that you use as sources or quote from.

In the QTree, we’re a friendly and civil lot. We encourage free speech and the open exchange and civil discussion of different ideas. Topics aren’t constrained, and sound logic is highly encouraged, all built on a solid foundation of truth and established facts.

We have a policy of mutual respect, shown by civility. Civility encourages discussions, promotes objectivity and rational thought in discourse, and camaraderie in the participants – characteristics we strive toward in our Q Tree community.

Please show respect and consideration for our fellow QTreepers. Before hitting the “post” button, please proofread your post and make sure your opinion addresses the issue only, and does not confront or denigrate the poster. Keep to the topic – avoid “you” and “your”. Here in The Q Tree, personal attacks, name-calling, ridicule, insults, baiting, and other conduct for which a penalty flag would be thrown are VERBOTEN.

In The Q Tree, we’re compatriots, sitting around the campfire, roasting hot dogs, making s’mores, and discussing, agreeing, and disagreeing about whatever interests us. This board will remain a home for those who seek respectful conversations.

Please also consider the Guidelines for posting and discussion printed here: 
https://www.theqtree.com/2019/01/01/dear-maga-open-topic-20190101/


Glory to God 1

CREATED FOR GOD’S GLORY (Isaiah 43:7)

Isaiah 43:7 “. . . everyone who is called by my name, whom I have created for my glory, whom I formed and made.”

Glory to God in the highest . . .

“Why has God created us? What is the purpose? What do the scriptures have to say in regard to this matter?” God’s Word points out that all things are created for God’s glory.

We can see by the word of God that even nature itself glorifies God. Psalm 19:1 says “The heavens declare the glory of God, and the sky above proclaims His handiwork”, Psalm 8:1 says “O LORD, our Lord, how majestic is Your name in all the earth! You have set Your glory above the heavens.” In fact, God’s Word tells us all things are to praise God, as it says in Psalm 150:6 “Let everything that has breath praise the LORD! Praise the LORD!”

So from this viewpoint, mankind is created to give “glory” to God. But what does the word “glory” mean in the first place? In order to apply this passage to our lives, we need to first understand the meaning of the word “glory”.

Depending on the context in which it is used, “glory” can be used in several different ways. Mostly it is associated with attributing splendor and majesty to God, but glory is also used as a verb, as in “to glory in something”.

When used as a verb, “glory” means to put confidence in and boast about or praise something. This may be used in the sense of glorifying in God or Jesus Christ, which God’s Word portrays as something that is good, and in the another sense of the word it can mean to glorify in ourselves or our own nature, which God’s Word portrays as sinful.

The original Hebrew word (Kabod) means “weight” or “heaviness”. This word is also used to express importance, honor and majesty. The word glory as related to God in the Old Testament bears with it the idea of greatness of splendor. In the New Testament, the word translated “glory” means dignity, honor, praise and worship.

With this understanding, let’s look at Isaiah 43:7 again, which says “everyone who is called by My name, whom I have created for My glory, whom I formed and made.” Now we that we have a clearer understanding of the word glory, let’s see how we can fulfill the purpose of giving all glory to God, which is the very reason we are made.

We are image-bearers of the Almighty God. We are created to bring glory to Him, to honor Him, to praise His glorious name, to thank Him for His abundance in our life and to praise Him for His abundant grace, the riches of His love, His splendor and majesty and a God who is righteous and just and having power in His name that we may come to Him in reverence and awe. This is the very purpose of man – to glorify God in every way.

Glorifying God means to acknowledge His greatness and give Him honor by praising and worshiping Him, primarily because He, and He alone deserves to be praised, honored and worshiped. 1 Chronicles 16:28-29 says “Ascribe to the LORD, O families of the peoples, ascribe to the LORD glory and strength! Ascribe to the LORD the glory due His Name; bring an offering and come before Him! Worship the LORD in the splendor of holiness;”

He is also due all glory because He gives us our very being itself. Psalm 100:3 says “Know that the LORD, He is God! It is He who made us, and we are His;” In a worldly sense we are quick to give gratitude and praise to someone we know, that has saved our very life from danger or even from death itself.

Sometimes we don’t even know how to thank that person for what he/she has done for us. We tend to hold that person in high regard and praise their actions. Sometimes we even use the phrase “I am forever  indebted to you”. This shows a kind of gratitude towards that person because of the enormity of their actions toward us and we feel we owe them something in return but don’t know how. We sometimes even use the phrase, “I don’t know how I’m ever going to repay you!”.

In the same way, what we need to realize is that not only has God saved our very lives from the wages of sin and death, and given us eternal life, but that He is the very author of life; it is the kindness of God to gift us our very life. When we look at this, isn’t it only reasonable that we should glorify Him? Shouldn’t we live to Him, seeing that we also “live by Him”. Romans 11:36 says: “For from Him and through Him and to Him are all things. To Him be glory forever. Amen.”

Another reason we should glorify God is because all our hopes hang on Him. Psalm 39:7 says “And now, O LORD, for what do I wait? My hope is in you.” Not only is our very hope and expectation in Him but He is the source of all things in our lives. Psalm 87:7 says “All my springs are in you.” The springs of grace, mercy, love, faith, provision, healing and everything that will lead us to give glory to His Holy Name.

Not only that but He gave His one and only Son, Jesus Christ to come and die for our sins in our place and to take the sin of the world on His shoulders that we should be cleansed of all sin and made right before God. All of this was given as a free gift that cost us nothing, but cost Him everything. We would be totally and utterly ungrateful, unappreciative and thankless if we then questioned, why should I give God Glory, or isn’t is selfish for God to demand glory from His own creation. He is completely and totally worthy of all glory that is due to His Name, and His Name only. Praise God!

Holy, holy, holy is the Lord of hosts; the whole earth is full of his glory!

*endofthematter.com


On this day and every day –

God is in Control
. . . and His Grace is Sufficient, so . . .
Keep Looking Up!

2023·04·29 Joe Biden Didn’t Win Daily Thread

A Caution

Just remember…we might replace the RINO candidates. (Or we might not. The record is mixed even though there is more MAGA than there used to be.) But that will make no difference in the long run if the party officials, basically the Rhonna McDaniels (or however that’s spelled–I suspect it’s RINO), don’t get replaced.

State party chairs, vice chairs, secretaries and so on, and the same at county levels, have huge influence on who ultimately gets nominated, and if these party wheelhorses are RINOs, they will work tirelessly to put their own pukey people on the ballot. In fact I’d not be surprised if some of our “MAGA” candidates are in fact, RINO plants, encouraged to run by the RINO party leadership when they realized that Lyn Cheney (and her ilk) were hopelessly compromised as effective candidates. The best way for them to deal with the opposition, of course, is to run it themselves.

Running good candidates is only HALF of the battle!

SPECIAL SECTION: Message For Our “Friends” In The Middle Kingdom

I normally save this for near the end, but…basically…up your shit-kicking barbarian asses. Yes, barbarian! It took a bunch of sailors in Western Asia to invent a real alphabet instead of badly drawn cartoons to write with. So much for your “civilization.”

Yeah, the WORLD noticed you had to borrow the Latin alphabet to make Pinyin. Like with every other idea you had to steal from us “Foreign Devils” since you rammed your heads up your asses five centuries ago, you sure managed to bastardize it badly in the process.

Have you stopped eating bats yet? Are you shit-kickers still sleeping with farm animals?

Or maybe even just had the slightest inkling of treating lives as something you don’t just casually dispose of?

中国是个混蛋 !!!
Zhōngguò shì gè hùndàn !!!
China is asshoe !!!

And here’s my response to barbarian “asshoes” like you:

OK, with that rant out of my system…

Biden Gives Us Too Much Credit

…we can move on to the next one.

Apparently Biden (or his puppeteer) has decided we’re to blame for all of the fail in the United States today.

Sorry to disappoint you Joe (or whoever), but you managed to do that all on your own; not only that, you wouldn’t let us NOT give you the chance because you insisted on cheating your way into power.

Yep, you-all are incompetent, and so proud of it you expect our applause for your sincerity. Fuck that!!

It wouldn’t be so bad, but you insist that everyone else have to share in your misery. Nope, can’t have anyone get out from under it. Somehow your grand vision only works if every single other person on earth is forced to go along. So much as ONE PERSON not going along is enough to make it all fail, apparently.

In engineering school we’re taught that a design that has seven to eight billion single points of failure…sucks.

Actually, we weren’t taught that. Because it would never have occurred to the professors to use such a ridiculous example.

Justice Must Be Done.

The prior election must be acknowledged as fraudulent, and steps must be taken to prosecute the fraudsters and restore integrity to the system.

Nothing else matters at this point. Talking about trying again in 2022 or 2024 is hopeless otherwise. Which is not to say one must never talk about this, but rather that one must account for this in ones planning; if fixing the fraud is not part of the plan, you have no plan.

Kamala Harris has a new nickname since she finally went west from DC to El Paso Texas: Westward Hoe.

Lawyer Appeasement Section

OK now for the fine print.

This is the WQTH Daily Thread. You know the drill. There’s no Poltical correctness, but civility is a requirement. There are Important Guidelines,  here, with an addendum on 20191110.

We have a new board – called The U Tree – where people can take each other to the woodshed without fear of censorship or moderation.

And remember Wheatie’s Rules:

1. No food fights
2. No running with scissors.
3. If you bring snacks, bring enough for everyone.
4. Zeroth rule of gun safety: Don’t let the government get your guns.
5. Rule one of gun safety: The gun is always loaded.
5a. If you actually want the gun to be loaded, like because you’re checking out a bump in the night, then it’s empty.
6. Rule two of gun safety: Never point the gun at anything you’re not willing to destroy.
7. Rule three: Keep your finger off the trigger until ready to fire.
8. Rule the fourth: Be sure of your target and what is behind it.

(Hmm a few extras seem to have crept in.)

Spot Prices

All prices are Kitco Ask, 3PM MT Friday (at that time the markets close for the weekend).

Last Week:

Gold $1,984.90
Silver $25.17
Platinum $1,134.00
Palladium $1,682.00
Rhodium $9,000.00

So here it is, Friday, 3PM MT after markets closed and we see:

Gold $1,991.60
Silver $25.15
Platinum $1,084.00
Palladium $1,588.00
Rhodium $9,300.00

Things aren’t moving around all that much lately.

Globular Clusters

Time for a wrenching change of subject…because JWST took a picture of a globular cluster.

I was pretty much done with orbits anyhow.

A globular cluster is a grouping of stars, tens of thousands or even millions of them, forming an approximate sphere. The stars are very closely packed in the center and as you move away from the center the density decreases markedly.

This is Messier 2, a globular cluster that (as seen from Earth) is in the constellation Aquarius. (Note this is not the JWST’s image–it’s from Hubble.)

Charles Messier in the 1700s was interested in comets. In telescopes, before they get close to the sun and (possibly) become bright enough for people to see with the naked eye, they simply look like fuzzy blobs. Also, since they orbit the Sun, they move against the background stars (which are at least ten thousand times further away). So Messier would record a fuzzy blob in a certain location then check that location again a few days later. If the blob had moved, he likely had a comet. Otherwise, it was a permanent feature of the nighttime sky.

There were enough permanent blobs that Messier made a list of them, so when he stumbled across that blob again, he’d know he could ignore it. This is now the Messier catalog of about 110 objects. Many of the most famous nebulae in the night sky are Messier objects; many nearby galaxies are too. (Andromeda, for instance, is M-31, and the 800 bazillion ton gorilla of the Virgo cluster, M87 (the one with the really, really big black hole in its center), well, is a Messier object.

Many of Messier’s blobs were fuzzy spheres in his telescope (which was fairly primitive); as optics got better it became apparent they were clusters of tens of thousands or even millions of stars.

It also became apparent that there were quite a number of these in our galaxy…but they do not lie in the plane of the galaxy like the spiral arms do; they are in a swarm in what’s called the galactic halo, a spherical region centered on the bulge at the center of our galaxy. So if you imagine the Milky Way galaxy as, say a CD, some of the clusters are above it, and some below, most are just a few inches from the center of the cd. Other galaxies have them too, and they’re readily visible in powerful telescopes.

Another quirky feature about globular clusters is that the stars in them tend to be very old, over ten billion years old. For a while, astronomers would measure the age of a globular cluster, and come up with a number greater than the cosmologists’ number for the age of the universe. Of course this was absurd…how can an object in the universe be older than the universe. Over a number of decades as measurements were refined the discrepancy went away, but nevertheless, globular clusters are old.

Probably the most famous globular cluster (often just called “globulars”) is Omega Centauri. It’s so bright it was mistaken for a star by the ancients. It does not have a Messier number as it’s not readily visible from northern Europe where Messier worked–but folks living in Australia get to enjoy it. Another famous one is the Hercules cluster, M 13. It’s an easy one to find even with binoculars since it lies on a line between two stars in the Hercules “keystone” pattern (four stars that look like they outline a keystone).

JWST took the following picture of M 92, which is also in Hercules. It’s one of the brighter and more spectacular ones but is overshadowed by M 13. It’s particularly interesting because it’s one of the oldest globular clusters, somewhere between twelve and 13 billion years old. (The universe itself is presently believed to be 13.787 billion years old, give or take 0.02 billion years.) Scientists hope to learn something new about the universe as it was back then.

(We already know from spectrographic analysis the stars shown have almost no “metals” (astrophysicist terminology for elements other than hydrogen and helium) in them…they formed before the elements themselves were formed in more massive stars.)

The first thing you’ll notice is that the center of the cluster is missing. This was deliberate. The astronomers using JWST were interested in the outlying stars and the millions of stars clumped together in the center would have washed them out. They were able to use a gap that exists between two of the NIRCam long wavelength detectors. Talk about making lemonade from lemons!

M92 is about 27,600 light years away. It’s 16,000 light years outside of the plane of the Milky Way and 33,000 light years away from the galactic center. (We are about 27,000 light years from the center.)

This is of course a false-color image, because it’s JWST. None of what you see in this picture is actually visible to the human eye. Rather, this image was taken at four infrared wavelengths we can’t see, then the four each given their own color of visible light and the group combined together into one image. From the NASA website: “This image is composite of four exposures using four different filters: F090W (0.9 microns) is shown in blue; F150W (1.5 microns) in cyan; F277W (2.77 microns) in yellow; and F444W (4.44 microns) in red.” For reference, red light is about 0.7 microns and blue light is 0.4 microns. All of the things seen in the picture are therefore “redder than red.”

Obligatory PSAs and Reminders

China is Lower than Whale Shit

Remember Hong Kong!!!

中国是个混蛋 !!!
Zhōngguò shì gè hùndàn !!!
China is asshoe !!!

China is in the White House

Since Wednesday, January 20 at Noon EST, the bought-and-paid for His Fraudulency Joseph Biden has been in the White House. It’s as good as having China in the Oval Office.

Joe Biden is Asshoe

China is in the White House, because Joe Biden is in the White House, and Joe Biden is identically equal to China. China is Asshoe. Therefore, Joe Biden is Asshoe.

But of course the much more important thing to realize:

Joe Biden Didn’t Win

乔*拜登没赢 !!!
Qiáo Bài dēng méi yíng !!!
Joe Biden didn’t win !!!