Health Friday 6.6.2025 Open Thread: TLR4, S1, and mRNA-1283 (mNEXSPIKE): A Scientific Gourmanderie

The above image of TLR Signalling Pathways is courtesy of BioFinder and Google Images.

Health Friday is a series devoted to information about Big Pharma, vaccines, general health, and associated topics. As today’s offering is related to the disaster of the COVID-19 virus itself, and of the COVID-19 “vaccines”, Yours Truly dedicates it to the memory of all persons, of whatever age or location, who have passed away from the negative effects of these lab-created Biological Toxin Weapons.

There are Important Notifications from our host, Wolf Moon; the Rules of our late, good Wheatie; and, certain caveats from Yours Truly, of which readers should be aware. They are linked here. Note: Yours Truly has checked today’s offering for any AI-generated content. To the best of her knowledge and belief, there is none. If readers wish to post any AI-generated content in today’s discussion thread, they must cite their source. Thank you.

And now, to the reader’s Edification Smorgasbord, a “feast of information” regarding just how dangerous and potentially deadly mRNA-1283 (mNEXSPIKE) is, Yours Truly offers the following Menu:

APPETIZER: WHAT IS TLR4?

TLR4 (aka Toll-like receptor 4) is a transmembrane protein that exists across a cell membrane. TLR4 functions as a kind of “sensing device” within the body. It detects foreign bacteria and viruses. When a foreign element is detected by TLR4, it begins to send messages to the natural immune system to activate the immune response. TLR4 is crucial to the correct functioning of the natural immune system. Please see the screenshots below for more information:

Citation: https://en.wikipedia.org/wiki/Toll-like_receptor_4

Citation: https://doi.org/10.1016/j.intimp.2007.05.016, “Toll-like receptors in inflammation, infection and cancer”, Keqiang Chen, et al., October 2007. Found via: https://www.sciencedirect.com/topics/immunology-and-microbiology/tlr4.

FIRST COURSE: THE FDA APPROVES “mNEXSPIKE” IN MAY 2025:

The “newest version” COVID-19 “vaccine”, mRNA-1283 (aka mNEXSPIKE), was “fully approved” by the FDA on 30 May 2025. Yours Truly wrote about this situation here: https://www.theqtree.com/2025/06/01/stop-press-edition-hhs-secretary-robert-f-kennedy-needs-to-resign-now/. This “vaccine” claims to be “more effective” in “preventing” an infection of COVID-19. The claim is based on the fact that mRNA-1283 (aka mNEXSPIKE) uses “only” the S1 protein and the N sector of said S1 protein of the COVID-19 virus spike protein, as opposed to using the entire spike protein (as in mRNA-1273, the original “flagship” modRNA COVID-19 “vaccine” by Moderna.) Please see: https://doi.org/10.1093/infdis/jiaf022, “Safety and Immunogenicity of SARS-CoV-2 Spike Receptor-Binding Domain and N-Terminal Domain mRNA Vaccine”, Spyros Chalkias, et al., 15 April 2025 (most of the authors of this “informational paper” are either affiliated with Moderna, or are employees of Moderna.) A screenshot of the Background section of the Abstract of this paper is below:

At first glance, this “new development” by Moderna may appear to be a “positive” achievement. However, there are other issues that arise:

First, there is the fact that the S1 protein of the SARS-CoV-2 virus contains both the RCB (Receptor-Binding Domain) AND the N-terminal domain of the virus. It is the RCB that allows the virus to “attach” itself , or to “dock” itself, to cells in the body — for example, to the ACE2 cell receptors; and, to TLR4 cells. The N-terminal domain is the “end part” of the S1 protein; it is a “free” group at the end of the protein, while, at the same time, it “initiates” a polypeptide chain.

Second, there is the fact that the S1 protein of the SARS-CoV-2 virus interacts with TLR4 cells. Yours Truly begins with this: https://news-medical.net/news/20210510/Research-suggests-Pfizer-BioNTech-COVID-19-vaccine-reprograms-innate-innate-immune-responses.aspx, Sally Robertson, B.Sc., 10 May 2021. Please see the following screenshots from this article:

While the above article refers to the Pfizer-BioNTech modRNA COVID-19 “vaccine” BNT162b2, the modRNA COVID-19 “vaccine” from Moderna, mRNA-1273, also targets the RBD, which interacts with TLR4 cells in the “vaccinated” person’s body. In addition, all of the modRNA “descendant clone” COVID-19 “vaccines” by both companies also use the RBD, there interacting with TLR4 cells in the “vaccinated / boosted” person’s body.

TLR4 cells are also present in multiple areas and organs of the body. The modRNA COVID-19 “vaccines” will interact with these cells. This is due to the fact that the S1 protein of the SARS-CoV-2 virus contains certain amino acids residues (numbers 1-1208) that interact with TLR4 cells. Please see: https://doi.org/10.1016/j.heliyon.2021.306187, “SARS-CoV-2 spike protein S1 subunit induces pro-inflammatory responses via toll-like receptor 4 signaling in murine and human macrophages”, Ken Shirato, Takako Kizaki, February 2021. A screenshot of the Abstract of this paper follows:

Regarding the S1 amino acids residues 1-1208 and TLR4, please see this paper, from 2020: https://europepmc.org/article/ppr/ppr170060, ” Structural characterization of a nanobody derived from a naive library that neutralizaes SARS-CoV-2″, M Dumoux, et al., 1 June 2020. Below are screenshots from the Methods section and from a portion of the Supplementary Table section of this paper (the Supplementary Table portion shows some of the gene code for the S1 1-1208 residues):

Further information regarding SARS-CoV-2 spike protein and its interaction with TLR4 is found here: https://doi.org/10.3389/fimmu.2024.1368946, “TLR2/4 are novel activating receptors for SARS-CoV-2 spike protein on NK cells”. Nadine Landolina, et al., 30 May 2024. “NK” stands for “Natural Killer” cells in the body. A screenshot from this paper is below:

Then, there is the issue of clinical trial used by the FDA to “justify” the “full approval” of mRNA-1283 (aka mNEXSPIKE), NCT05137236 (https://clinicaltrials.gov/study/NCT05137236.) There was NO Placebo Control Group in this study. The study participants (study subjects) were injected with the following Moderna modRNA COVID-19 “vaccines”: mRNA-1273; OR, mRNA-1283; OR, mRNA-1283.211; OR, mRNA-1283.529. Why was there no Placebo Control Group? Assuming that the study subjects knew, in advance, they would be injected with any one of FOUR different variations of a modRNA COVID-19 “vaccine”, were they fine with that?

And, there is the “opinion piece” by Dr. Martin Makary (FDA Commissioner) and Dr. Vinay Prasad (new head of the FDA’s CBER division), regarding the “new approach” that the FDA will use for COVID-19 “vaccines.” Please see:

SECOND COURSE: WHAT DOES THE modRNA COVID-19 “VACCINE”, mNEXSPIKE, CONTAIN?

Please see the FDA-issued Fact Sheet for Healthcare Providers (aka the Package Insert) for mRNA-1283, mNEXSPIKE: https://www.fda.gov/media/186738/download. Below is a screenshot of section 11 Description, section 12 Clinical Pharmacology, and section 13 Nonclinical Toxicology of this document:

Which plainly states that mNEXSPIKE contains the same types of dangerous, deadly lipid nanoparticle and excipient that all the other modRNA COVID-19 “vaccines” by Moderna contain: SM-102, and PEG2000-DMG. This means that mNEXSPIKE will be rapidly spread into every cell in the “vaccinated” person’s body. It is also clear that mNEXSPIKE has NOT been tested for mutation potential, cancer-inducement potential, or reproductive impairment potential.

Yours Truly then performed a search to ascertain whether or not mNEXSPIKE contains N1-methylpseudouridine. She has written extensively on this board about this lab-created “fake Uridine plus a form of methane”, which completely replaces the natural RNA in the Uridine in the body. Recall that natural Uridine is crucial to multiple body functions and mechanisms: regulation of mood, of learning and memory, and of “gut-brain connection” functions. Lo and behold, the US Patent for mRNA-1283 (aka mNEXSPIKE) does have language describing “various types” of pseudouridine, including N1-methylpseudouridine, are used in all of Moderna’s modRNA COVID-19 “vaccines” — which would also include mNEXSPIKE. The US Patent for mRNA-1283 is found here (US 20240382581A1): https://patents.google.com/patent/US20240382581A1/en?q=(mRNA-1283)&oq=mRNA-1283, “Pan-human coronavirus vaccines”, ModernaTX, published 21 November 2024. Please see sections 0120, 0121, 0122, and 0123 of this document for descriptions of the “various types” of pseudouridine.

Lastly, there is the question as to whether mNEXSPIKE contains any saRNA (self-amplifying RNA) component. Yours Truly searched for information regarding this, since the IM dose (intramuscular injection dose) of this COVID-19 “vaccine” is a very small amount — 0.2mL. She found this, which appears to be a “dancing all around the truth” description of this “vaccine.” Please see: https://synapse.patsnap.com/article/what-is-mrna-1283-used-for?, 28 June 2024. A screenshot from this article is below:

Read the last sentence in the second paragraph above, especially “…a robust and durable immune response, potentially requiring fewer doses and offering longer-lasting immunity compares to other vaccines.” Sounds like a description of the saRNA H5N1 “vaccine”, KOSTAIVE, currently approved for use in the EU / Scandinavia, and in Japan; and, a version of which “vaccine” is to begin clinical trials in the United States (NCT06602531), under the name ARCT-2304.

DESSERT AND BEVERAGES: REACTIONS AND QUESTIONS:

First, this: https://www.thefocalpoints.com/p/maha-movement-flabbergasted-covid, “MAHA Movement Flabbergasted COVID-19 Vaccines Remain on Market”, Peter A. McCullough, MD, MPH, 2 June 2025. There is an embedded interview with Dr. McCullough in this article, along with a linked copy of the “Kabuki Theater performance” regarding “stopping” the COVID-19 “vaccines” in the United States by Dr. Martin Makary (FDA), Dr. Jay Bhattacharya (NIH DIrector), and HHS Secretary Robert F. Kennedy, Jr., on 27 May 2025. A screenshot from the McCullough article is below, giving his views on the current situation:

Second, this tweet, from Dr. William Makis: https://x.com/MakisMD/status/1930296443434348771, 4 June 2024. Two screenshots from his tweet are below: first, a statement from HHS Secretary Kennedy, Jr.; and, second, from Dr. Makis:

Questions, posed by Yours Truly: Why did the FDA “fully approve” a “new”, modRNA COVID-19 “vaccine” that specifically targets person over age 65, and persons who “fit” a detailed list of “persons at risk of severe COVID-19 infection”, as complied by Dr. Martin Makary and Dr. Vinay Prasad? Why was there a “Kabuki Theater performance” on 27 May 2025 by Drs. Makary and Bhattacharya, along with HHS Secretary Kennedy, Jr., when it was obvious by that date that the FDA “full approval” of mNEXSPIKE was “a done deal”? Why did the FDA issue an Approval Letter to Moderna for mNEXSPIKE that has so many “caveats”, “requests for more information”, and an “order” for the company to perform a Phase 4 clinical study on the “vaccine” — a “vaccine” that the FDA had just “fully approved”? Please see: https://www.fda.gov/media/186740/download; and, the screenshot of Page 9 of this document, regarding the “order” for the Phase 4 study, below:

More questions, posed by Yours Truly: How many elderly persons are going to be pressured / cajoled / “mandated” (by the nursing home or care facility where they live), to take mNEXSPIKE? Will they be told that this injectable is “safer” than mRNA-1273, “because the dose is smaller”? What about persons who “fit” into the multiple categories of “persons at high risk for severe COVID-19 infection” according to Drs. Makary and Prasad? What pressure will these persons be subjected to in order to get them to agree to take mNEXSPIKE? Finally, will people be told the truth that mNEXSPIKE, just because it does not contain the S2 portion of the SARS-CoV-2 spike protein, is NOT “mRNA-1273 Lite” — but, rather, it is another version of a dangerous, potentially deadly modRNA COVID-19 ‘”vaccine”?

Peace, Good Energy, Respect: PAVACA

STOP PRESS EDITION: HHS Secretary Robert F. Kennedy, Jr., Needs to Get Control, or to Resign — Now.

The above image of a vintage vaccine vial and syringe is courtesy of Google Images.

This post is a STOP PRESS EDITION. It has to do with the FDA BLA (Biologics License Application) approval of the Moderna COVID-19 modRNA “vaccine” mRNA-1283. This “vaccine” was FDA-approved without any clinical trial in which there was a placebo control group. mRNA-1283 contains a “shorter portion” of the COVID-19 virus spike protein. This “vaccine” also contains elements of the H7N9 Avian Influenza strain that was used in Gain-of-Function experiments by Dr. Yoshihira Kawaoka, DVM, PhD, in 2013, along with other scientists, at the University of Wisconsin (Madison.)

There are Important Notifications from our host, Wolf Moon; the Rules of our late, good Wheatie; and, certain caveats from Yours Truly, of which readers should be aware. They are linked here. Note: Yours Truly has checked this post for any AI-generated content. To the best of her knowledge and belief, there is none. If readers wish to post any AI-generated content in the discussion thread of today’s offering, they must cite their source. Thank you.

Today’s offering is short and to the point. Special Thanks to our good duchess01, to https://www.thefocalpoints.com/, and to http://mole.substack.com/. Please refer to the following posts by Yours Truly for relevant background information regarding today’s offering: https://www.theqtree.com/2025/05/30/health-friday-5030-2025-open-thread-what-is-going-on-at-hhs-the-fda-and-the-cdc/; and, https://www.theqtree.com/2025/05/16/health-friday-open-thread-5-16-2025-about-that-universal-vaccine-theres-more-than-meets-the-eye-part-two/.

Please see the following breaking news outlets pieces regarding the FDA granting the BLA for the Moderna “newest COVID-19 “vaccine”, mRNA-1283: First, this one: https://www.thefocalpoints.com/cp/164898171, “BREAKING: FDA Goes Rogue — Approves Moderna’s Next-Gen COVID-19 mRNA Injection Without a Placebo-Controlled Trial”, Nicolas Hulscher, May 2025. Please see the screenshots from this article, below:

HOWEVER, there is another aspect to the mRNA-1283 modRNA COVID-19 “vaccine” — this injectable appears to be a combination of BOTH the SARS-CoV-2 virus AND elements of the deadly H7N9 Avian Influenza virus. Please see: https://jonfleetwood.substack.com/cp/164803097, “FDA Approves Moderna COVID Jab Containing GOF Bird Flu Gene Segment That PCR Could Mistake for Infection”, 31 May 2025. The “bird flu gene segment” is from the Gain-of-Function experiments with the H7N9 Avian Influenza virus conducted by Dr. Yoshihiro Kawaoka, Ron Fouchier, and other scientists, under the aegis of the University of Wisconsin (Madison), where Dr. Kawaoka has his lab. These Gain-of-Function experiments were “outed” when serious lab accidents occurred; it appears that the experiments were then stopped. But not before Dr. Fouchier wrote this article: https://www.science.org/doi/10.1126/science.1243325, “Gain-of-Function Experiments on H7N9”, 9 August 2013, in which Dr. Fouchier attempted to justify further Gain-of-Function experimentation.

Please see the following screenshot, below, from the Wikipedia entry on H7N9 (https://en.wikipedia.org/wiki/Influenza_A_virus_subtype_H7N9):

The archived article regarding the H7N9 experiments at the University of Wisconsin (Madison), is found here: https://archive.ph/LX7MP, “Study: Lab-derived H5N1 virus component binds to human receptors”, Robert Roos, 13 April 2013.

In Yours Truly’s opinion, Robert F. Kennedy, Jr., the Secretary of Health and Human Services, is not doing his job. BOTH the FDA and the CDC have now “gone rogue” — first, with the “sleight-of-hand” regarding the CDC’s “new recommendations” about the COVID-19 “vaccines” (per Dr. Susan Monarez, PhD, the current Acting Director of the CDC, as of 30 May 2025); and, second, with the FDA (Dr. Martin Makary, Commissioner) granting approval of the Moderna modRNA COVID-19 + H7N9 gene pieces combination “vaccine”, mRNA-1283 (as of 31 May 2025.) It is time, in Yours Truly’s opinion, for Secretary Kennedy, Jr., to either get control of the FDA and CDC — after all, these agencies are part of HHS — or, to resign, and allow President Trump47 to find someone who will.

FLASH UPDATES! MORE ON THE “DIRTY BACKSTORY” RELATED TO THE FDA’s APPROVAL OF mRNA-1283 ON 30 MAY 2025:

ONE: The FDA’s Approval Letter to Moderna on 30 May 2025, regarding mRNA-1283: https://www.fda.gov/media/186740/download. Please see the screenshot of page nine of this document, below:

This is the PHASE 4 clinical study that Moderna is requested to perform for mRNA-1283, but which has NOT begun yet, nor has it ENROLLED any subjects yet.

TWO. This is the slide presentation for the CDC’s ACIP committee meeting for April 2025 related to the “2025-2026 COVID-19 Vaccines Formula” selections. Notice that there is NO vote that ACIP planned to take regarding mRNA-1283. Please see: https://www.cdc.gov/acip/downloads/slides-2025-04-15-16/05-Panagiotakopoulos-COVID-508.pdf. Below is a screenshot of the pertinent image from the slide presentation:

WHAT IS GOING ON HERE?

Peace, Good Energy, Respect: PAVACA

The 2024-2025 Formula COVID-19 “Vaccines”: Injection Dose #10

The above is a vintage image of mass vaccination. (Courtesy Google Images.)

This series on the disaster of the COVID-19 virus itself, and of the COVID-19 “vaccines”, is dedicated to the memory of Yours Truly’s cousin Bill, who “died suddenly and unexpectedly” in September 2023.

The origination of today’s post begins here: www.dossier.today/p/double-digits-biden-admin-tells-americans, “Double Digits: Biden Admin tells Americans that it’s soon time for their 10th Covid shot“, by Jordan Schachtel, 13 June 2024. (Mr. Schachtel wrote about the ninth COVID-19 “vaccine” injection here: www.dossier.today/p/dose-number-nine-cdc-panel-green, “Dose number NINE: CDC panel green lights yet another Covid mRNA shot“, 29 February 2024. The CDC recommended that persons over age 65 take another “booster shot” of either the Pfizer-BioNTech or of the Moderna “2023-2024 Formula COVID-19 Vaccine” of these manufacturers.) A person age 65 or older, if that person adhered to every CDC recommendation regarding taking a COVID-19 “vaccine” injection since December 2020 (when the FDA granted first Emergency Use Authorization (EUA) to Pfizer-BioNTech and to Moderna for these companies’ “flagship” modRNA COVID-19 “vaccines” (BNT162b2 by Pfizer-BioNTech; and, mRNA-1273 by Moderna), would have taken injection number nine starting on 28 February 2024.

Today’s post is long. There is a large amount of information to “unpack.” Stay with me here.

Below is an image from the FDA’s 13 June “updated” authorization announcement for the “2024-2025 Formula COVID-19 Vaccine”, the TENTH injection dose of the modRNA “vaccine” formula: www.fda.gov/vaccines-blood-biologics/updated-covid-19-vaccines-use-united-states-beginning-fall-2024.

Note the language regarding the “selection of a specific JN.1 lineage SARS-CoV-2 strain…” More about that later.

The trail behind the 5 June 2024 FDA announcement begins with the VRBPAC Briefing Document for the meeting held on 28 June 2022: www.fda.gov/media/159452/download, “FDA Briefing Document Vaccines and Related Biological Products Advisory Committee Meeting June 28, 2022.” It was at this meeting that the FDA “codified” the types of “strain composition recommendations” that the agency would use regarding “new versions” of COVID-19 “vaccines.” Yours Truly presents page 17, page 18, and page 19 of this document:

It appears that the FDA simply decided that it would be permissible for the agency to authorize a new COVID-19 “vaccine” strain composition along what, in Yours Truly’s opinion, may be called “very flexible” options. For example, the Pfizer-BioNTech XBB.1.5 COVID-19 “vaccine”, which was FDA authorized in the fall of 2023, had test results only from mouse testing prior to FDA authorization. Following are: The link to the Pfizer-BioNTech slide presentation about this “vaccine” to the CDC’s ACIP committee (Advisory Committee on Immunization Practices) meeting of 12 September 2023; and, an image of slide CC4 from this presentation. First, the presentation: www.cdc.gov/vaccines/acip/meetings/downloads/slides-2023-09-12/10-COVID-Modjarrad-508.pdf.

Second, slide CC-4 from the above presentation:

The XBB.1.5. Pfizer-BioNTech COVID-19 “vaccine” had only been given as a single injection to humans in the company’s clinical trial; a clinical trial which had only just begun prior to the ACIP meeting. Slide CC-5 of the presentation, the start of the company’s human trial of this “vaccine”, is below:

Slide CC-6 of the presentation has to do with the mouse studies of this “vaccine”, which were of longer duration.

Notwithstanding the above, the FDA authorized the use of the company’s XBB.1.5 COVID-19 “vaccine” on 11 September 2023 (in Yours Truly’s opinion, it appears that the ACIP meeting of 12 September 2023 was a “catch-up” formality.) It also appears (again, in Yours Truly’s opinion), that the FDA used a very loose interpretation of “Option 4” on page 18 of the FDA Briefing Document above in granting the EUA for this “vaccine”.

** Now, on to the latest “new version” of the COVID-19 “vaccines”, the “2024-2025 Formula COVID-19 Vaccines”, that the FDA authorized in June 2024.

The following linked items are important regarding background information related to this situation and to the FDA: First, the FDA document, stating that the agency would “align” its COVID-19 “vaccine” antigen composition to the recommendations of the World Health Organization’s TAG-CO-VAC recommendations: www.fda.gov/media/179139/download (the TAG-CO-VAC recommendation for the “2024-2025 Formula COVID-19 Vaccines” was to use the JN.1 strain); second, the FDA document regarding “considerations and recommendations” for the “2024-2025 Formula COVID-19 Vaccine” composition: www.fda.gov/media/179145/download; third, the FDA announcement of the 5 June meeting of its VRBPAC committee (Vaccines and Related Biological Products Advisory Committee.): www.fda.gov/advisory-committees/advisory-committee-calendar/vaccines-and-related-biological-products-advisory-committee-june-5-2024-meeting-announcement. From this last link, chick on “Event Materials” to see the slide presentations and other items that were discussed at this meeting.

Two important items from the “Event Materials” list: the FDA Briefing Document; and the VRBPAC roster for this meeting. First, the FDA Briefing Document: www.fda.gov/media/179003/download; and, second, the VRBPAC roster for this meeting: www.fda.gov/media/179225/download. The roster for the 5 June 2024 meeting has some “familiar” members and speakers: Paul Offit, MD; and Peter Marks, MD (director of CBER [Center for Biologics Evaluation the Research of the FDA]); and, among the “Temporary Voting Members”, are: Bruce Gellin, M.D., M. PH., the Chief of Global Public Health Strategy for the Rockefeller Foundation; and, Melinda Wharton, M.D., M. PH., Associate Director of Vaccine Policy of the CDC. (Italics mine)

The VRBPAC members voted unanimously to endorse the Pfizer-BioNTech, the Moderna, and the Novavax “2024-2025 Formula COVID-19 Vaccine” by these companies, based on the presentations of these companies’ representatives at the meeting. Yours Truly can find no registered human clinical trials performed in advance of the 5 June VRBPAC meeting by Pfizer-BioNTech, or by Moderna, or by Novavax, for any “2024-2025 Formula COVID-19 Vaccine”; that would indicate that any “clinical trials” were performed in these companies’ facilities on mice; and that any “human trials” were also performed in these companies’ facilities, prior to the meeting. The FDA then issued the agency’s original announcement of 7 June 2024: www.fda.gov/news-events/press-announcements/fda-roundup-june-7-2024; and, a screenshot from this announcement:

Note in particular “…the selection of a specific JN.1 lineage SARS-CoV-2 strain (e.g., JN.1. or KP.2) and expressed a strong preference for JN.1.” Here’s where it starts to “get interesting.”

First, on 12 April 2024 (well ahead of the 5 June VRBPAC meeting), Pfizer-BioNTech issues a statement regarding the company’s “taking reservations” for the coming “2024-2025 Formula COVID-19 Vaccine” (also, see the Pfizer-BioNTech presentation at the 5 June meeting, linked above): www.cvdvaccine-us.com/reservation. This is followed, after the meeting, by Moderna filing an application with the FDA for a “vaccine” to target the JN.1. COVID-19 strain (also, see the Moderna presentation at the 5 June meeting, linked above): https://investors.modernatx.com/news/news-details/2024/Moderna-Files-FDA-Application-for-the-JN.1-Targeting-COVID-19-Vaccine/default.aspx; then, Novavax files with the FDA for that company’s version (also, see the Novavax presentation at the 5 June meeting, linked above): https://ir.novavax.com/press-releases/2024-06-14-Novavax-Submits-Application-to-U-S-FDA-for-Updated-Protein-based-2024-2025-Formula-COVID-19-Vaccine.

But then, “something happens”, and the FDA suddenly makes a large “about-face” and switches its “2024-2025 Formula COVID-19 Vaccine” choice to the KP.2 strain on 13 June 2024: www.fda.gov/vaccines-blood-biologics/updated-covid-19-vaccines-use-united-states-beginning-fall-2024. This is the “second” announcement, which was cited at the beginning of today’s post.

What was it that happened? Part of the answer lies in the fact that the NIH and Moderna co-own the patents (and, therefore, share the royalties) for the Moderna “flagship” modRNA COVID-19 “vaccine”, mRNA-1273. This agreement would extend to “descendant clone COVID-19 vaccines” by Moderna. www.citizen.org/article/modernas-mrna-1273-vaccine-patent-landscape/. The NIH’s Dale and Betty Bumpers Vaccine Research Center (part of NIAID — which Dr. Anthony Fauci led from November 1984 until his retirement in December 2022) and Moderna co-developed mRNA-1273. https://covid19.nih.gov/news-and-stories/nih-vaccine-research-center; a screenshot from the article is below:

The other part of the answer is that Moderna was already developing a KP.2 strain COVID-19 “vaccinefor 2024-2025. This, and the FDA’s decision to shift away from the JN.1 strain to the KP.2 strain, are described in this post at Sasha Latypova’s blog: https://sashalatypova.substack.com/p/all-roads-lead-to-resilience, “All Roads lead to Resilience. FDA is removing competitors for the Pentagon & CIA’s baby…Moderna”, 23 June 2024.

The FDA’s “about-face” announcement regarding the switch from the JN.1 strain to the KP.2 strain was also covered here: www.contagionlive.com/view/fda-advises-manufacturers-to-consider-kp-2-strain-for-covid-19-vaccines, 14 June 2024, by Sophia Abene. Below is a screenshot from this article:

However, there’s yet another detail in play here, regarding the FDA’s switch, “based on evaluation of the most recent circulating strains of COVID-19”, from JN.1 to KP.2 — the CIA and the Pentagon. Here is a screenshot from Sasha Latypova’s Substack article:

Here is the report, linked from the Latypova blog article cited above, that describes the CIA-linked company, “National Resilience”, or “Resilience”, that manufactures the RNA for the Moderna modRNA line of COVID-19 Omicron “vaccines”: https://unlimitedhangout.com/2022/08/investigative-reports/rna-for-modernas-omicron-booster-manufactured-by-cia-linked-company/, by Whitney Webb, 17 August 2022. Below is a screenshot image from this blog article:

And here is story on this “interesting development”, from Resilience: www.businesswire.com/news/home/20210908005443/en/Resilience-to-Manufacture-mRNA-for-Moderna’s-COVID-19-Vaccine, 8 September 2021. Note that per this “multi-year contract”, Resilience manufactures the mRNA for the Moderna COVID-19 “vaccines” at this Canadian facility. Resilience was founded in 2020.

But wait, there’s more! Resilience lists multiple “partners”, such as the Mayo Clinic. The company also, apparently, has a “partnership” with the United States Army’s Joint Program Executive Office for Chemical, Biological, Radiological and Nuclear Defense https://resilience.com/learn/partnerships. Below is a screenshot from this website:

The website link in the screenshot above is broken. Here is the Army’s website on this: wwwt2.army.mil/T2-Laboratories/Designated-Laboratories/Joint-Program-Executive-Office-for-Chemical-Biological-Radiological-and-Nuclear-Defense/. Note: this link may or may not work. One will need to do a search for “Joint Program Executive Office for Chemical, Biological, Radiological and Nuclear Defense” to see links to this department of the United States Army. One such link: https://globalbiodefense.com/directory/name/joint-program-executive-office-for-chemical-biological-defense-jpeo-cbd/.

It appears, then, in Yours Truly’s opinion, that the FDA was perhaps “reminded” of the”details” regarding the NIH-Moderna co-ownership (and royalties – sharing) agreement related to Moderna’s modRNA COVID-19 “vaccines”; and, the role of the CIA-Pentagon-National Resilience (aka Resilience) in manufacturing the mRNA used in the Moderna COVID-19 Omicron “booster vaccines” — and the KP.2. strain is indeed a “descendant strain” in the Omicron lineage (as is the JN.1 strain.) Hence, the FDA’s 2024-2025 COVID-19 “vaccine” strain “sudden switch” announcement of 13 June 2024, only one week after the agency gave the nod to the JN.1 strain.

In Yours Truly’s opinion, it is statistically, medically, and ethically impossible for a new vaccine (let alone any COVID-19 “vaccine”) to be developed; tested (on lab animals, then on human subjects); the test data thoroughly collated and analyzed for “safety and efficacy” on both lab animals and on human subjects; then, which data is presented to the CDC / FDA for consideration; then, these agencies doing their own “due diligence” research; then, and only then, being granted an EUA by the FDA; then, and only then, manufactured for use in humans — in a time span of fewer than three to five years, let alone within a time span of only a few months. It appears, again in Yours Truly’s opinion, that the CDC and the FDA are playing “fast and loose” with the health and safety of the people who choose (or will be “mandated”) to take the “2024-2025 Formula COVID-19 Vaccine.” And, also, that “other entities” are in play here to perhaps “influence” decision making by these agencies.

All of above is in addition to the fact that the COVID-19 “vaccines” (actually, gene therapy injections) have caused, are causing, and will cause, multiple health issues, serious adverse reactions, and deaths, in those who are “vaccinated.” Just two of the most recent discoveries: One, the COVID-19 “vaccines” can cause brain damage, an article by Dr. William Makis: www.globalresearch.ca/brain-damage-covid-19-mrna-vaccines/5861012, “Brain Damage Caused by COVID-19 mRNA Vaccines”, 26 June 2024. Below is a screenshot from Dr. Makis’ article:

The second most recent discovery, that the COVID-19 “vaccines” reduce life expectancy (even in “all-cause” analysis) among COVID-19 “vaccinated” persons, by Dr. Peter A. McCullough: https://petermcculloughmd.substack.com/p/breaking-publication-a-critical-analysis, “BREAKING Publication — A Critical Analysis of All-Cause Deaths during COVID-19 Vaccination in an Italian Province”, 1 July 2024. The peer-reviewed paper is here: https://doi.org/10.3390/microorganisms12071343, “A Critical Analysis of All-Cause Deaths during COVID-19 Vaccination in an Italian Province”, Marco Alessandria, et al., published 30 June 2024. Below is a screenshot from the Conclusions section of this paper:

In Yours Truly’ opinion, it is apparent at “half a glance” that the COVID-19 “vaccines” (actually, gene therapy injections) must be completely withdrawn for human use until these products have been fully investigated, and then re-designed, before being re-introduced for human use; and, that there is no “co-ownership” or sharing of royalties between a government agency and a COVID-19 “vaccine” manufacturer; and, that there is no involvement of the United States military in the development or manufacture of such products.

Peace, Good Energy, Respect: PAVACA


An Open Letter to Medical Professionals Who Took the COVID-19 “Vaccines”

The above image is a photo from the article, “The new COVID boosters: What doctors and patients need to know”, published online by the Association of American Medical Colleges on 14 September 2023 (www.aamc.org/news/new-covid-boosters-what-doctors-and-patients-need-to-know).

This series of posts regarding the ongoing issues of COVID-19 and the COVID-19 “vaccines” is dedicated to the memory of Yours Truly’s cousin Bill, who passed away “suddenly and unexpectedly” in September 2023. Today’s post is addressed to medical professionals who had any COVID-19 “vaccines” (in reality, gene therapy injections) injected into their bodies since 11 December 2020. This post is not “accusatory” in nature: Yours Truly is curious. One will make it clear at the outset that there are vaccines and other injectables that are useful: For examples, the Rabies vaccine and the injectable form of Heparin. One will also make it clear that the following questions regarding the modRNA COVID-19 “vaccines” are not “tin-foil hat” or “conspiracy theory” in nature — all of them are based on the writings and researching of medical doctors and scientists who want to find out the truth about these particular “vaccines.” There are many other questions that must be asked; Yours Truly is presenting a few of the most important ones from a personal point of view in today’s post.

Dear COVID-19 “Vaccinated” Medical Professional:

With all due respect for your education and expertise, there now must be serious questions raised concerning the COVID-19 “vaccines” that were rushed into use in the United States and all over the world. These questions are especially important given the increasing numbers of reports of COVID-19 “vaccine”-induced injuries, illnesses, disabilities, and deaths, among those who have taken, and/or continue to take, these “vaccines.”

The first question that must be raised is: Are you aware that the FDA knew, back on 30 April 2021, that the modRNA COVID-19 “vaccine” by Pfizer-BioNTech, BNT162b2, is involved in the inducement of over 1,200 types of medical diseases and conditions? Here is the document that Pfizer-BioNTech gave to the FDA on that date: https://phmpt.org/document/5-3-6-postmarketing-experience.pdf, 5.3.6 CUMULATIVE ANALYSIS OF POST-AUTHORIZATION ADVERSE EVENT REPORTS OF PF-07302048 (BNT162B2) RECEIVED THROUGH 28-FEB-2021. Please see page 30 of this report, APPENDIX 1. LIST OF ADVERSE EVENTS OF SPECIAL INTEREST. The report is also found here: https://phmpt.org/document/5-3-6-postmarketing-experience.pdf. The document is FDA time-stamped 30 April 2021. Yours Truly will point out that this report covers only between 11 December 2020 (the date of the initial EUA granted by the FDA for BNT162b2 to be used in the United States) and 28 February 2021. The list of Adverse Events of Special Interest begins with 1p36 deletion syndrome; other diseases, disorders, and events mentioned include: Cardiac arrest; Cerebral thrombosis; Demyelination; Guillain-Barre syndrome; hepatic disorders; immune system disorders; pulmonary disorders; Myocarditis; neurological disorders; and, Pericarditis; among many others.

The second question that must be raised is: Are you aware that the modRNA COVID-19 “vaccines” made by Pfizer-BioNTech (these include BNT162b2; this company’s previous “booster” COVID-19 “vaccines”; and this company’s current “2023-2024 Formula COVID-19 Vaccine”) contain two dangerous lipid nanoparticles, ALC-0159 and ALC-0315, both of which are for research use only? Here are the Safety Data Sheets for these lipid nanoparticles: For ALC-0159: https://cdn.caymanchem.com/cdn/msds/34336m.pdf; and, for ALC-0315: https://cdn.caymanchem.com/cdn/msds/34337m.pdf. On page one of each of these Safety Data Sheets, there is the following language: “Application of the substance / the mixture This product is for research use – Not for human or veterinary diagnostic or therapeutic use.” In addition, are you aware that the modRNA COVID-19 “vaccines” made by Moderna (these include mRNA-1273; this company’s previous COVID-19 “booster vaccines”; and this company’s current “2023-2024 Formula COVID-19 Vaccine”) contain the dangerous lipid nanoparticle, SM-102, which is for research purposes only? Here is the Safety Data Sheet for this lipid nanoparticle: https://cdn.caymanchem.com/cdn/msds/33474m.pdf. On page one of this Safety Data Sheet, there is the exact same language in the section “Application of the substance / the mixture” as is listed for ALC-0159 and for ALC-0315 in their respective Safety Data Sheets: “This product is for research use – Not for human or veterinary diagnostic or therapeutic use.” (As an aside, ALC-0149 and ALC-0315 are described only by their chemical component names in the FDA-issued Fact Sheet for the Pfizer-BioNTech “2023-2024 Formula COVID-19 Vaccine”: www.fda.gov/media/167211/download; please see under section 11 DESCRIPTION. However, ALC-0159 and ALC-0315 are called by their proper names in the FDA document, www.fda.gov/media/172019/download, Emergency use Authorization (EUA) for an Unapproved Product Review Memorandum, dated 23 June 2023, section 7.1 Chemistry Manufacturing and Control (CMC) Information.)

The third question that must be raised is: Are you aware that the COVID-19 “vaccines” can, and do, “shed” components of these products from “vaccinated” persons to un-“vaccinated” persons? Dr. Pierre Kory has an extensive series of articles on his blog relating to this phenomenon: https://pierrekorymedicalmusings.com/; please see Part One of this series: https://medicalmusings.com/p/shedding-of-covid-mrna-vaccine-components, published 1 November 2023.

The fourth question that must be asked is: Are you aware that the COVID-19 “vaccines” can, and do, damage the blood vessels, heart tissue, and lung tissue, of persons who have these “vaccines” in their bodies? Please refer to: https://doctors4covidethics.org/wp-content/uploads/2022/08/causality-article.pdf, “Vascular and organ damage induced by mRNA vaccines: irrefutable proof of causality”, Michael Palmer, MD, and Sucharit Bhakdi, MD. Yours Truly presents page nine of this paper, which is self-explanatory:

The fifth question that must be asked is: Are you aware that the modRNA Pfizer-BioNTech COVID-19 “vaccine”, BNT162b2, changes the DNA of the LINE-1 Human Liver7 cell line? Please refer to: https://doi.org/10.3390/cimb44030073, “Intracellular Reverse Transcription of Pfizer BioNTech COVID-19 mRNA Vaccine BNT162b2 In Vitro in Human Liver Cell Line”, Yang De Marinis, et al. Yours Truly presents two images from this paper: The first, of DNA expression induced in BNT162b2-treated Human Liver7 cells in LINE-1; the second, of DNA amplicons induced by BNT162b2-treated Human Liver7 cells in LINE-1.

Also, please refer to this document, given by Pfizer-BioNTech to the FDA on 21 January 2021 and FDA time-stamped on that date, which can be found here: https://icandecide.org/wp-content/uploads/2022/03/125742_S1_M2_26_pharmkin-tabulated-summary.pdf, BNT162b2 2.6.5 Pharmacokinetics Tabulated Summary, regarding BNT162b2. Yours Truly present page seven of this report:

Notice the heavy accumulation of BNT162b2 in the livers of the Wistar lab rats that were used in this experiment conducted by Pfizer-BioNTech. This was the same BNT162b2 Pfizer-BioNTech modRNA COVID-19 “vaccine” that was later injected into human patients (with ingredients amounts calibrated for human use.)

Yours Truly will note that the CDC changed the definitions of “vaccine” and “vaccination” in 2021, after the rollout of the COVID-19 “vaccines” (gene therapy injections.) One suspects that this was done to “shoe-horn in” these products under the aegis of “vaccines.” Please refer to: www.johnlocke.org/the-cdc-changed-its-definitions-of-vaccine-and-vaccination-and-keeps-changing-its-definition-of-fully-vaccinated/. However, the FDA states clearly, on page four of the Fact Sheet for Healthcare Providers for the administration of the “2023-2024 Formula COVID-19 Vaccine” by Pfizer-BioNTech, that this product is to prevent coronavirus disease (COVID-19), not to “protect against serious illness from COVID-19”, as the CDC states. Please refer to: www.fda.gov/media/167211/download, page four, under section 1 EMERGENCY USE AUTHORIZATION; and to www.cdc.gov/coronavirus/2019-ncov/vaccines/stay-up-to-date.html under What You Need to Know.

Finally, there is this paper, published on 24 January 2024: https://doi.org/10.7759/cureus.52876, “COVID-19 mRNA Vaccines: Lessons Learned from the Registrational Trials and Global Vaccination Campaign”, M. Nathaniel Mead, Peter A. McCullough, et al. Yours Truly presents part of the Abstract of this paper:

Yours Truly sincerely asks that COVID-19 “vaccinated” medical professionals make every effort to investigate these “vaccines”, and to understand the very real risks and dangers of putting them into the human body. For further information, please see: www.theqtree.com/2024/01/04/the-deagel-report-u-s-population-reduction-of-68-5-by-2025/.

Sincerely, with Good Energy, Peace, and Respect, PAVACA

PAVACA: BFA (2), Carnegie-Mellon University; MA, Duquesne University. Reading and writing about COVID-19 and the COVID-19 “vaccines” since March 2020. Also interested in Pharmacy and in the impacts of Big Pharma. General Editor of Imagination-Building: The Memoirs of John Douglas Forbes (1910 – 2018), First Professor of the Darden School of the University of Virginia, available at www.amazon.com/, www.barnesandnoble.com/, and www.authorhouse.com/.

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

DIED SUDDENLY & WAKING THE SHEEPLE

Some people wouldn’t know Tyranny

if it covered their faces,

Locked them in their homes,

Enacted the biggest wealth transfer in History

Censored them

made them show papers

and forcibly injected them

with a slow ‘poison’….

RDS in the following comment points out one of the problems we have in waking up the Sheeple. There are highly ‘respected’ doctors and PhDs, who write papers in prestigious journals backing the mRNA vaccines even though they KNOW they are unsafe.

RDS:

Wolf Moon
OMG, this article below is a must-read. Linked from an AMA EdHub email one received today. It’s a JAMA piece written by Dr. Peter Marks — he’s the head of the CBER department of the FDA (Center for Biologics Evaluation and Research). Dr. Marks was in on the ground floor of Operation Warp Speed. Dr. Marks KNOWS EVERY DATA PIECE SUBMITTED TO THE FDA FROM PFIZER-BIONTECH ABOUT THE CLINICAL TRIALS FOR BNT162b2 BACK IN 2020 — AND EVERY DATA PIECE SINCE THEN ALSO.
Dr. Marks was in on recommending that the FDA authorize the UNPROVEN, ONLY TESTED ON 8 MICE new “COVID-19 + Omicron BA.4 + Omicron BA.5 booster shot.”
His linked article below is a screed for the development of “new” and “different types” of COVID-19 “vaccines” — including ones that specifically target the T-cell response in the body.
Dr. Marks KNEW that the “vaccines” developed during Operation Warp Speed and given quick EUAs by the FDA WOULDN’T DO THE JOB:
From his article:
“One potential model for approaching such development [of a COVID-19 vaccine] was used successfully at the beginning of the pandemic when Operation Warp Speed evaluated numerous global vaccine types and focused on advancing several promising candidates, knowing full well that most would ultimately not be found to meet the criteria set forth for a safe vaccine with adequate efficacy. (bolding and Italics mine)
Dr. Marks represents the “medical establishment” and DeepState.
IMO, the “medical establishment” and the DeepState have it as their business to continue to put these dangerous COVID-19 “vaccines” into people — and develop new “vaccines” to keep damaging / destroying the immune systems of those who take them.
His article:
https://jamanetwork.com/journals/jama/fullarticle/2799600
December 9, 2022
“Urgent Need for Next-Generation COVID-19 Vaccines”
Peter Marks, MD, PhD
https://www.youtube.com/watch?v=Nat1za4sKjA
As an additional note. For those who might wish to watch the documentary it is available to watch free until the end of January. All that is required is your email I think. The link follows.
https://therealanthonyfaucimovie.com/trailer/

In addition to censorship and smearing of dissenting voices, hospitals and doctors were getting the carrot and stick treatment – Lose your license OR get big bucks for pushing bogus PCR tests, ventilators, Remdesivir and killing patients. – For example “A COVID-19 diagnosis provides extra payments to coroners!”

To make sure the Sheeple could not make a solid connection between the Covid Vaccine and death, the shot is a slow ‘poison’ with a variety of adverse reactions.

Steve Kirsch: Vaccines are taking an average of 5 months to kill people

The CDC has been hiding the Social Security Administration death master file. I got it from a whistleblower. This shows deaths are taking 5 months from the jab to happen. This is why it’s hard to see.

Remember this time factor as we look at the data I found.

Finally we have the DELIBERATELY compromised VAERS system that is SUPPOSED to alert the CDC and FDA to harmful drugs.

Why Did the CDC Silence the Million Dollar Harvard Project Charged With Upgrading Our Vaccine Safety Surveillance System?  BY TRUTH SNITCH

NOTE THE DATE! → OCTOBER 24 2017

There are major problems with the vaccine adverse event reporting system (known as VAERS) which the CDC considers the “front line” of vaccine safety. VAERS was created in 1990 by the CDC and FDA as a means to collect and analyze adverse effects that are associated with vaccines. Unfortunately, the failings of VAERS are “kept from the consciousness” not only of the public, but also from the doctors, pediatricians, and nurses that the public rely on to provide reliable information as to the safety of vaccines. I say “kept from the consciousness” rather than “kept secret” because while these failings are publicly disclosed for all the world to see, they are for all intents and purposes BURIED in documents seldom searched out by the average member of the medical community, much less by the average individual. You could say that the information has been very effectively hidden in plain sight…

In 2000, the 6th Report by the Committee on Government Reform addressed the failings of VAERS in its address of the Vaccine Injury Compensation Program…. [The] Congressional report notes (on page 15), “Former FDA commissioner David A. Kessler has estimated that VAERS reports currently represent only a fraction of the serious adverse events.” (emphasis by author)… That leads us to the interesting case of the CDC and Harvard Pilgrim Healthcare Inc.

The Department of Health and Human Services (HHS) gave Harvard Medical School a $1 million dollar grant to track VAERS reporting at Harvard Pilgrim Healthcare for 3 years and to create an automated reporting system which would revolutionize the VAERS reporting system- transforming it from “passive” to “active.”…

I’ll quote the findings directly from the report,

“Adverse events from drugs and vaccines are common, but underreported. […] Likewise, fewer than 1% of vaccine adverse events are reported. Low reporting rates preclude or slow the identification of ‘problem’ drugs and vaccines that endanger public health. New surveillance methods for drug and vaccine adverse effects are needed.”

Again, let’s stop and think about this revelation for a moment: fewer than 1% of vaccine adverse events are reported. The CDC’s entire vaccination propaganda campaign rests on their claim that side effects from vaccination are exceedingly rare (and predominantly minor). According to the CDC, in 2016 alone, VAERS received 59,117 vaccine adverse event reports. Among those reports were 432 deaths, 1,091 permanent disabilities, 4,132 hospitalizations, and 10,274 emergency room visits. What if these numbers actually represent less than 1% of the total as this report asserts? Simple multiplication would yield vaccine adverse events reports numbering 5,911,700!…

the United States of America Centers for Disease Control ghosted Harvard Pilgrim Healthcare, Inc.

For those who are unaware, Google dictionary defines ghosting as,

“the practice of ending a personal relationship by suddenly and without explanation withdrawing from all communication.”

Personally, I would hope that I could hold an organization like the CDC to a higher standard, but… After a one million dollar grant was paid and three years of research conducted on what appeared to be a very successful upgrade to the passive VAERS system, the team’s CDC contacts went MIA

. The ESP:VAERS final report states, “Unfortunately, there was never an opportunity to perform system performance assessments because the necessary CDC contacts were no longer available and the CDC consultants responsible for receiving data were no longer responsive to our multiple requests to proceed with testing and evaluation.”

So in 2017, the CDC DELIBERATELY left a useless reporting system in place when they had the opportunity to upgrade it.

Since the VAERS data set is compromised as well as next to useless, I decided to see if we could find another way to connect the mRNA vaccines to deaths. There is a nifty site called Dead or Kicking.

If you go to https://deadorkicking.com/death-statistics/us/2020/ (Towards the bottom)

there is the graphUnited States death comparison by age in 2020

By changing the date in the URL you get the different years AND if you place your mouse over the graph, it will give you Deaths, Death Rate and Population for each age group.

You can save the graphs for any year – or all of them – as examples, as Wolf did below. Right-clicking on a graph lets you “save image as” or “copy image”.


2019

2020

2021

2022

Note Added By Wolf – CHECK THIS ONE OUT!!!


I originally thought I would see a major drop in the population over 75 but that did not happen since the Baby Boomer cohort is filling the 65+ age groups faster than the orchestrated depopulation can kill them. Notice there are less people in the 45 to 54 age group than in the 55-64 age group. That is a REAL PROBLEM for the Cabal.

Social Security Scam: Where Did the $2.5 Trillion Surplus Go?

July 19 2011

The Social Security Trust Fund should currently have $2.5 trillion in surplus. So how is it that these checks could stop being issued if the debt ceiling isn’t raised? Economics professor Dr. Allen Smith, author of The Looting of Social Security: How The Government is Draining America’s Retirement Account, has been reporting on the theft of Social Security funds for years….

Age / Date2019202020212022
85+6,604,9586,628,0136,673,1756,715,875
75-8415,969,87216,022,41016,139,65116,250,631
65-7431,483,43331,571,20731,773,61031,970,852
55-6442,448,53742,643,57942,929,85043,208,648
45-5440,874,90241,050,40441,371,45241,683,591

So I created another table this time of USA Death Rates by age group by year. I included 6 years before covid as a baseline. Then the two years, 2019 & 2020, when Covid hit the USA plus the two years, 2021 and 2022 when the mRNA vaccine was progressively rolled out, starting with adults, then school age children and finally babies.


Age/Date2013201420152016201720182019202020212022
85+136.60134.08136.74133.92135.74134.51132.29162.24138.49120.22
75-8446.4845.6445.7944.7544.7343.8643.0852.1650.3349.00
65-7418.0217.8617.9717.8917.9117.8317.6520.9222.2523.96
55-648.608.708.758.848.868.878.839.8610.8512.05
45-544.064.054.044.064.023.963.924.235.086.12
35-441.721.751.801.921.951.951.992.122.883.92
25-341.061.081.171.291.331.291.291.371.762.24
15-240.650.650.700.750.740.700.700.720.861.05
5-140.130.130.130.130.140.130.130.130.140.14
1-40.260.240.250.250.240.230.230.230.220.25
<15.955.885.905.835.675.585.535.564.884.39

The following groupings are interesting…..


RETIREES 75+

We know 5 democrat governors forced people with ACTIVE COVID INFECTIONS into nursing homes, killing a lot of the elderly and they were not the only ones. 45% of all US coronavirus deaths occurred in nursing homes.

Also there was the DELIBERATE mis-diagnosis of flu and pneumonia followed by refusal to treat until the person was so sick they needed to be put on a ventilator & remdesivir thus killing up to 88% of those patients.

There was also deferred health care. Study: 4 in 10 U.S. adults deferred medical care due to COVID-19

The result of all of this, is the most vulnerable elderly had already been killed off in 2020 as the much higher death rates for 2020 shows, but by 2021 and 2022 the death rates decrease from that high. Although the elderly were vaccinated, unlike athletes and younger, physically active people, the elderly are going to be a lot more sensitive to what their bodies are telling them and NOT pushing it. They are also more likely to have doctors checking their heart health and be on heart and circulatory medications.

March 2020 Myocarditis in athletes: A clinical perspective

Abstract

Myocarditis is an important cause of arrhythmias and sudden cardiac death (SCD) in both physically active individuals and athletes.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

RETIREES 65 to 74

The 65 to 74 group is going to be a mixed bag. Compared to the 75+ group they are less likely to be in a nursing home or to have gotten deathly ill in 2020, although a certain percentage will have died. However they are likely to get the vaccine. Thanks to Medicare, they are more likely to be in contact with medical professionals who would try to talk them into the jab. They are also going to be a lot more physically active than older retirees and therefore stressing their hearts more after getting the mRNA vaccine.

You can see the combination of poor health care in 2020 followed by the vaccines and then boosters as the death rate increases year by year from 2019 through 2022.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

FORCED RETIREMENT/SMALL BUSINESS WORKERS 45 to 64

The 45 to 64 are an interesting group. Corporations force retirements and actively discriminate against those 45 years and up because age discrimination laws have no real teeth. Therefore the people 45 and up are most likely NOT working for ‘Corporate America’ and are either small business people or hired by small business people. (BTDT) This group is the most likely to have had a ‘rude awaking’ about the world we live in and are NOT going to be as trusting. Older people are also more likely to tell their boss to go F..K themselves with the darn needle. Like the 65 to 75 group you can see the increase in death rate year to year but it is not as sharp an increase. They are also more likely to be in better health than retirees.
If You’re Over 50, Chances Are the Decision to Leave a Job Won’t be Yours
Age discrimination in the workplace happening to people as young as 45: study

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

WORKING AGE CORPORATE AMERICA 15 TO 44

The age group 15 to 44 is the group most likely to show PURE UNADULTRATED DATA about Mortality & the mRNA vaccine although there may be some confounding from drug use increasing over the years. Covid-19 virus has little effect on the death rate in 2020. However as the boosters and the 5 month time delay kicks in you can see the death rate almost doubled in 2022 compared to 2019 and earlier.

THIS IS THE GROUP TO WATCH.

JANUARY 3, 2022 Insurance executive says death rates among working-age people up 40 percent

….Scott Davison, the CEO of OneAmerica, a $100 billion life insurance and retirement company headquartered in Indianapolis.

“The data is consistent across every player in the business.”

Davison said death rates among working age people –

those 18 to 64-years-old – are up 40 percent in the third and fourth quarter of 2021 over pre-pandemic levels.

“Just to give you an idea of how bad that is, a three sigma or 200-year catastrophe would be a 10 percent increase over pre-pandemic levels,” Davison said. “So, 40 percent is just unheard of.”

He blames it on Covid instead of the mRNA vaccine of course. “…the third and fourth quarter of 2021…” would be after Steve Kirsch’s 5 month window. So far I can not find any 2022 insurance data. HMMMmmmm

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

CONTROL GROUP 1 TO 14

The 1 year to 14 can be considered the ‘Control Group’ Covid has little if any effect on the death rate in 2020. They were not vaxed until quite recently (November 2021) and boosters were not approved until May 19, 2022. The death rate so far has been flat but I would expect an uptick after the first of this year as the effects of the boosters kick in.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

BABIES UNDER 1 YEAR

The Under one year of age is interesting since there is actually a slight dip in mortality. Are weaker babies more subject to spontaneous aborting after Mom is vaxed?

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

TIMELINE of Emergency Use Authorization of mRNA VACCINES

The FDA makes it VERY HARD to figure out just when they authorized the use of the mRNA vaccine in youngsters. I gleaned out the following dates. Starting from the FDA Covid Vaccine site.

Turns out it is the CDC who has the final say on vaccination of children so I have also included the CDC news releases.

12/18/2020 EUA issued for the Moderna COVID-19 Vaccine, December 18, 2020.
Emergency Use Authorization (EUA) of the Moderna Inc. COVID-19 Vaccine for the prevention of COVID-19 in individuals 18 years and older.

YEAR 2021

06/10/2021 — Vaccines and Related Biological Products Advisory Committee will meet in open session to discuss, in general, data needed to support authorization and/or licensure of COVID-19 vaccines for use in pediatric populations.

FDA DEFINES:
Pediatric use. (A) Pediatric population(s)/pediatric patient(s): For the purposes of paragraphs (c)(9)(iv)(B) through (c)(9)(iv)(H) of this section, the terms pediatric population(s) and pediatric patient(s) are defined as the pediatric age group, from birth to 16 years, including age groups often called neonates, infants, children, and adolescents.

.
09/17/2021 — Application for administration of a third (“booster”) dose of Comirnaty (COVID-19 Vaccine, mRNA) in individuals 16 years of age and older.

10/26/2021 — Vaccines and Related Biological Products Advisory Committee Meeting
The committee will discuss a request to amend Pfizer-BioNTech’s Emergency Use Authorization (EUA) for administration of their COVID-19 mRNA vaccine to children 5 through 11 years of age.

10/14/2021 – Vaccines and Related Biological Products Advisory Committee Meeting
The committee will discuss the Emergency Use Authorization (EUA) of the ModernaTX Inc. COVID-19 vaccine and the Janssen Biotech Inc. COVID-19 vaccine for the administration of an additional dose, or “booster” dose, following completion of the primary series, to individuals 18 years of age and older.

 November 2, 2021 – CDC Recommends Pediatric COVID-19 Vaccine for Children 5 to 11 Years


Today, CDC Director Rochelle P. Walensky, M.D., M.P.H., endorsed the CDC Advisory Committee on Immunization Practices’ (ACIP) recommendation that children 5 to 11 years old be vaccinated against COVID-19 with the Pfizer-BioNTech pediatric vaccine. CDC now expands vaccine recommendations to about 28 million children in the United States in this age group and allows providers to begin vaccinating them as soon as possible. 

YEAR 2022

Jun 17, 2022 FDA authorizes COVID-19 vaccines for children age 6 months and older

The Food and Drug Administration today authorized Moderna’s COVID-19 vaccine for children aged 6 months through 17 years old and Pfizer’s COVID-19 vaccine for children aged 6 months through 4 years old, as recommended this week by its vaccine advisory committee. The vaccines previously were authorized for older children.

Before vaccinations can begin, the Centers for Disease Control and Prevention must recommend the vaccines for these age groups. CDC’s Advisory Committee on Immunization Practices is scheduled to vote tomorrow on whether to authorize the vaccines for children age 5 and under.

December 08, 2022 Today, the U.S. Food and Drug Administration amended the emergency use authorizations (EUAs) of the updated (bivalent) Moderna and Pfizer-BioNTech COVID-19 vaccines to include use in children down to 6 months of age.

Children 6 months through 5 years of age who received the original (monovalent) Moderna COVID-19 Vaccine are now eligible to receive a single booster of the updated (bivalent) Moderna COVID-19 Vaccine two months after completing a primary series with the monovalent Moderna COVID-19 Vaccine.

Dec 9, 2022 CDC Expands Updated COVID-19 Vaccines to Include Children Ages 6 Months

Following FDA action, today CDC expanded the use of updated (bivalent) COVID-19 vaccines for children ages 6 months through 5 years.

May 19, 2022 – CDC Strengthens Recommendations and Expands Eligibility for COVID-19 Booster Shots

Following today’s meeting of the Advisory Committee on Immunization Practices’ (ACIP), CDC is expanding eligibility of COVID-19 vaccine booster doses to everyone 5 years of age and older. CDC now recommends that children ages 5 through 11 years should receive a booster shot 5 months after their initial Pfizer-BioNTech vaccination series.

GC/wm

The Population Control Shot – CDC Backs Out of the Shot-Up Saloon Like Nothing Happened

Listen to Naomi Wolf’s take on things, to prepare you for THE WOLF’S take on things.


What Do You Mean, “The Guidance Changed?”

This is actually a great question, to which I thought I knew the answer, but in fact did not.

The “guidance” is actual documentation of what CDC thinks the “sheeples in charge” should force the rest of the sheeple to do about COVID-19.

CDC guidance is why everything went crazy in the United States.

And now, all of a sudden, that “guidance” is far less crazy and forceful than it was recently. What’s up with that?

I first found a Fox News version of the change.

LINK: https://www.foxnews.com/us/cdc-eases-covid-guidance-shift-approach

This had no links to the actual changed guidance, so I went looking.

I found a place called “guidance” on the CDC website, but it’s dated from March of 2021.

LINK: https://www.cdc.gov/coronavirus/2019-ncov/communication/guidance.html

Looking around the CDC website, I eventually found what I was looking for. It was off the beaten path, but in a place where journalists were apparently used to looking for goodies on a weekly basis.

LINK: https://www.cdc.gov/mmwr/volumes/71/wr/mm7133e1.htm?s_cid=mm7133e1_w

This is much like an academic paper. Here is the title information:

Let’s put that into text.

Summary of Guidance for Minimizing the Impact of COVID-19 on Individual Persons, Communities, and Health Care Systems — United States, August 2022

Early Release / August 11, 2022 / 71

Greta M. Massetti, PhD1; Brendan R. Jackson, MD1; John T. Brooks, MD1; Cria G. Perrine, PhD1; Erica Reott, MPH1; Aron J. Hall, DVM1; Debra Lubar, PhD1; Ian T. Williams, PhD1; Matthew D. Ritchey, DPT1; Pragna Patel, MD1; Leandris C. Liburd, PhD1; Barbara E. Mahon, MD1 (View author affiliations)View suggested citation

Summary

What is already known about this topic?

High levels of immunity and availability of effective COVID-19 prevention and management tools have reduced the risk for medically significant illness and death.

What is added by this report?

To prevent medically significant COVID-19 illness and death, persons must understand their risk, take steps to protect themselves and others with vaccines, therapeutics, and nonpharmaceutical interventions when needed, receive testing and wear masks when exposed, receive testing if symptomatic, and isolate for ≥5 days if infected.

What are the implications for public health practice?

Medically significant illness, death, and health care system strain can be reduced through vaccination and therapeutics to prevent severe illness, complemented by use of multiple prevention methods to reduce exposure risk and an emphasis on protecting persons at high risk for severe illness.

MORE: https://www.cdc.gov/mmwr/volumes/71/wr/mm7133e1.htm?s_cid=mm7133e1_x

You can also download a PDF of the full guidance HERE.

LINK: https://www.cdc.gov/mmwr/volumes/71/wr/pdfs/mm7133e1-H.pdf

CNET has a nice summary HERE.

LINK: https://www.cnet.com/health/medical/cdc-nixes-quarantine-tweaks-other-covid-guidance/

Even NPR has tried to summarize things – and did rather nicely.

https://twitter.com/backtolife_2023/status/1557821330308960271

Given that NPR is an official party organ, that’s pretty serious. I repeat:

So assuming you’ve read one of the summaries (Fox or CNET) or at least the NPR checklist, what do more critical voices think?

Many people consider it a REVERSAL OF POLICIES in several important ways. Naomi Wolf, who has championed medical freedom from a classical liberal standpoint, is one of them.


Naomi and Steve Take a Tour of WTF Falls

CDC’s sudden reversal on COVID guidance – from obsessively meddling and frequently “backwards” to “almost sane” – is almost certainly political in many ways, including a reaction of the DNC to their dismal prospects in the upcoming election. And yet the new guidance does do some scientific “hand-waving” to justify itself.

Without making enough of a point about natural immunity to admit its superiority to the immunity offered by the “vaccines”, CDC has admitted the fact that natural immunity, along with clot shot immunity, has effectively ended the crisis of the virus.

The crisis of the vaccinated, however, is just beginning.

Listen to Naomi Wolf’s take on CDC’s reversal.

LINK: https://rumble.com/v1g4yvt-naomi-wolf-joins-warroom-to-discuss-the-cdcs-full-180-turn-on-vaccine-discr.html

Summary:

  • people don’t want COVID vaccines – Moderna is throwing out 30 million unwanted doses
  • people don’t want the vaccines for their kids
  • vaccines don’t affect transmission, and CDC no longer says so
  • there’s no reason to have mandates, firings, dismissals
  • now after all the destruction, not even an apology, just ignore vaccination status
  • “the edifice is crumbling, because so many people have exposed their lies”
  • the legacy media is not questioning the reversal – just putting it out there
  • CDC is making up a fantasy about the science having evolved
  • no evidence is presented, just as no evidence was presented before
  • no mention is made of the devastation from the policies that went before

So what does the Wolf think of all this?


Light in August

The novel is an exploration of what we think we know vs what we actually know.

Pamela Jean, Goodreads

To dig out the truth, as scientists instead of artists, we have to “think we know” things, and on average, more often than not, what we think we know has to turn into what we actually know.

In addition to simply denying us “things we think we know” by gaslighting and censorship, one of the ways that criminals get away with things, is by throwing enough phony “think we know” at us, to prevent us from ever getting to the point of actually knowing things.

Chaff and countermeasures“, as Sundance likes to call them.

To me, the very first CHAFF is right in the “title” of the “new guidance”. The PROPAGANDA is LEADING with the “new goal”.

Summary of Guidance for Minimizing the Impact of COVID-19 on Individual Persons, Communities, and Health Care Systems — United States, August 2022

These creeps didn’t just say something short and open-ended like “Summary of Guidance for Management of COVID-19, August 2022” – they added their alleged goal right there.

Minimizing the Impact of COVID-19 on Individual Persons, Communities, and Health Care Systems

WAIT A MINUTE.

SO – suddenly THAT MATTERS?

It didn’t matter EARLIER.

These two things are things we actually know.

That title of the new guidance could have been written by Scott Atlas. You know – the SWORN ENEMY OF SCARF WENCH. And yet – we are now in the BIDEN administration – which pushed the FATAL SHOTS.

LINK: https://thefederalist.com/2021/10/27/scott-atlas-fires-back-at-deborah-birxs-attempt-to-smear-him-for-her-lockdown-failures/

It has been my contention that Scott Atlas was ABSOLUTELY NOT on #TeamDepopulation, and that Birx refusal to even go to meetings where he was present, was not only a smart tactic of policy engagement, but a tactic of “big plot defense”.

If there was ever anybody who would have seen through to the “virtuous depopulation plan to save the planet from climate change” in real time, it would have been Scott Atlas. Here is a guy who understood motivation in health care, from the inside – but obviously from the “old days” of FIRST, DO NO HARM. He’s old school – just look at his age – obvious in the picture. If Birx would have slipped up somehow in gunning for more control, less treatment, and ultimate reliance on the statistically fatal shots, it would have been clear as day to Atlas. HIS suspicions could have been raised to the proper levels.

This is something we THINK WE KNOW – not something we ACTUALLY KNOW.

At least, NOT YET.

Ideas that can become things we ACTUALLY KNOW have to become CONCEIVABLE first, and to become conceivable TO THE PUBLIC, they have to become public.

This is why ALL THE CENSORSHIP. The “virtuous depopulation plan” was not allowed to become conceivable in the minds of men and women, by not allowing the smaller components of the idea to take shape – to fit together like a jigsaw puzzle, leading to NEW EVIDENCE.

Sure – they love to let people make the BIG assertions, because who would believe them? It’s the smaller things that add up, that allow us to see that 1+2+3+4=10.

Now – Birx is a tricky one. Not only does she admit to sabotaging Trump in terms of her reporting practices and bureaucratic policy documentation, which can be made to look virtuous to the left – she even tried to feed Trump rope to hang himself, which is at best unseemly, and at worst treasonous.

An example of that level of personal duplicity is how Birx gave Trump a “tour of the incredible” in terms of COVID cures, leading Trump to then give the waiting Fake News media exactly what it wanted – “injection of bleach”, “crazy ultraviolet treatments”, and all that noise.

Let’s be very blunt. Birx SET TRUMP UP. KNOWINGLY.

At the time of “infamous injection of bleach”, I was struck by Trump’s demeanor when stating the things he did. It was clear to me that he KNEW this would feed the media with red meat for controversy, but even more, I detected DISDAIN FOR BIRX, as he mentioned VERY BRIEFLY having gotten the tour, and then proceeded to “step into the trap” by stating some of the things they looked at, stripped of anything he MUST have heard, supporting their scientific credibility.

Typical Trump – allowing the Fake News to backhandedly validate him, while not “appearing weak” by making the arguments himself.

He let Scarf Wench crow for the moment, only to “wear the L” later.

Trump-L-sign.jpg

Getting back to the point, there has to be a set of reasons WHY CDC is suddenly “normalizing normal again”.

Democrats are no longer pretending. They’re doing the right thing. WHY?

The election is surely one of them. Democrat voters need to come back for their hug after being bitch-beaten to the graveyard.

But there is MORE. This policy is IN MOTION. It has already been allowed to pass the phalanx of school administrators, who had earlier enjoyed their lockdown and mandate powers well beyond the expiration date.

Holly brought us EVIDENCE in that regard. I invite you to enjoy this conversation as much as we did!


holly08

holly08

Offline

Wolverine

 August 16, 2022 04:56

Good sign! Utica University’s fall 2022 covid policy no longer requires the vaxx or exemptions for ANYONE. Private and in New York. This is a big deal. 💥👍

https://www.utica.edu/fully-forward

14

 Reply

Wolf Moon

Wolf Moon

Online

Admin

Wolf

 Reply to  holly08

 August 16, 2022 04:59

OMG – Team Depopulation is in FULL FLIGHT. They’re opening every jail cell to cover their escape!!!

13

 Reply

kalbokalbs

kalbokalbs

Online

Coyote

 Reply to  Wolf Moon

 August 16, 2022 07:43

“Just following the science. following the data”.

/s

Bastards

9

 Reply

Wolf Moon

Wolf Moon

Online

Admin

Wolf

 Reply to  kalbokalbs

 August 16, 2022 12:06

Suddenly “the science” – THE REAL SCIENCE – looks good to them.

WICKED.

3

 Reply

Aubergine

Aubergine

Offline

Coyote

 Reply to  Wolf Moon

 August 16, 2022 09:31

Let the lawsuits begin…

8


This is now something we ACTUALLY KNOW. Democrats (teachers unions and university administrators) are doing a 180 in terms of feeding the “protesting parents of Democrat-abused children” with any MEDICAL reasons to protest. Even at the CDC level, they are relenting.

WHY? Just for the election?

Democrats are STILL pushing both TRANS and CRT in schools. Indeed, the early assertion that the notorious Tavistock Institute was being shut down not as victory over TRANS, but as a form of TARGET DENIAL, so that TRANS could be disseminated to hospitals and schools, seems to be borne out, as the center of the fight has indeed shifted to a multitude of “woke” hospitals with insane new TRANS policies.

No. There is more. And I may not ACTUALLY KNOW that the depoppers in American medical bureaucracy are strategically retreating, but I certainly THINK I KNOW THIS.

Fauci’s announced retirement at the end of the Biden administration notwithstanding, I suspect that he will exit SOONER – particularly in the event of Republican control of the House. This will have the effect of thwarting public revelation of facts which would lead irrevocably to the realization of what I am certain actually happened – that a shot which damages the hearts of ALMOST ALL RECIPIENTS AFTER REPEATED INJECTION was advanced KNOWINGLY.

I find it interesting that science is now catching up to the plot, and results which should have been obvious earlier, if things were actually innocent, are NOW becoming obvious to scientists who are innocent enough to publish.

Consider the NUMBERS in this very recent Thai study. My comments on Gab, wrapped around comments by Steve Kirsch, who sees the same evidence, but seems to be keeping any recognition of the plot quiet for now. AND YET HE TAUNTS THEM.


Wolf Moon@WOLFM00N

·

Repeating for the bigger link.

Nobody did this accidentally. Team Depopulation is busted.

#TeamDepop #mRNA

https://stevekirsch.substack.com/p/thailand-study-of-young-adults-post?utm_source=substack&utm_medium=email

Thailand study of young adults post jab showed nearly 30% with cardiovascular injuries

It is amazing what you find when the people doing the study are honest.

stevekirsch.substack.com

View Link Feed

8 likes

6 reposts

1 quote


What was that they were saying, that had no effect on Republican scientists, but might actually troll up some Democrat scientists to “action”?

“There’s no time.”

Likewise – at the top – people who are intellectually unable to question science from a standpoint of common sense and moral solidity, can easily get out over their skis, when urged by others who they trust. I think I know that Andrew Cuomo is one of them.

I don’t ACTUALLY know who had prior knowledge of the “left-virtuous plan”, but I am gaining pieces of the puzzle every day. Millions of actions which appear to be mistakes, take shape when we consider that thousands of those actions, committed by a small but core cadre of “knowing” participants, created virtue signals that drove the vast remainder of DUPES to participate in a massive folly.

And what is that folly?

Deploying the MOST ADVERSE VACCINE IN HUMAN HISTORY – while simultaneously REFUSING TO EXAMINE OR ADMIT the evidence of its adversity. The actions of the whole PROTECTED THE ADVERSITY.

And remember – that ratio – scientifically studied by the CIA – makes all sorts of things possible.

Motivations in real conspiracies are always complex, interlocking, apparently contradictory, and tend to “shift and flip” in going down from the most knowing top to the less knowing bottom – yet each layer knows the guilt of their own interests and participation. This form of guilty self-motivation locks people – including mostly innocent people – into defending the whole construct.


I do not actually know who the core cadre is, but I’m working on it.

Your suspicions as to WHO THEY ARE – are welcome.

We are an investigatory collective. We are free to postulate – to hypothesize – to be both scientists and detectives.

I know what I think. I ACTUALLY KNOW what I think I know.


What do YOU think you know?

W

“I think I know, thereby I can know.”

The Population Control Shot – New Sodompox Limited Edition

Are you ready for ROUND TWO? Here comes a gaypox (monkeypox) vaccine that causes cardiac damage in 1% of smallpox-unvaccinated normies, and in 2% of oldsters and military who were vaccinated for smallpox.


Moonshine Spots The Scam

We continue our series on The Population Control Shot with a discussion of the next installment in this saga – “monkeypox” vaccines.

As soon as the Biden regime declared monkeypox (sorry, that’s rayciss) sodompox to be a national health emergency, I knew that Political Moonshine had been proven correct. As he had predicted, lightintheloaferspox was the next SCAM that the Democrats were going to pull on America and the world.

We await homopox’s unavoidable new christening, just like when Wuhan coronavirus was renamed COVID-19.

Here is a great review of the Political Moonshine catalog of work on poofterpox.

If you have not caught up with Moonshine on either swishpox or the medical enterprise fraud model, then I highly recommend reading the above article.

The bottom line is that the medical system is now a fraud machine – the “scam disease du jour” doesn’t matter – they just buttplug one in and make coin on it.

I completely trust Moonshine on this stuff now. His work on COVID-19 scamming was brilliant. He called bladepox as their next scam, and based on the “declared emergency”, he got it right.

GET READY.


Karl Spots The Angle

Big hat tip to Tradebait for tipping me off to the following piece by Karl Denninger.

I will let Karl speak for himself.


Don’t Be Effing STUPID

So you think you might want the Jynneos jab to prevent monkeypox, right?

It’s “safe and effective”, so they say.

Let’s look at it.

This vaccine is used to help prevent smallpox and monkeypox diseases in adults.

Like any vaccine, the smallpox and monkeypox vaccine may not provide protection from disease in every person.

Yeah, we know that.  But it appears to work “most of the time”, and its licensed (fully) and thus “safe”, right?

Well, maybe.  The listed side effects that you should have to worry about, so they say, is the usual with any injected drug.  It doesn’t sound all that bad; pain where you got the shot, headache, nausea, chills, etc.  Ok.

Now let’s look at this:

Cardiac AESIs were reported to occur in 1.3% (95/7,093) of Jynneos recipients and 0.2% (3/1,206) of placebo recipients who were smallpox vaccine-naïve. Cardiac AESIs were reported to occur in 2.1% (16/766) of Jynneos recipients who were smallpox vaccine-experienced. The higher proportion of Jynneos recipients who experienced cardiac AESIs was driven by 28 cases of asymptomatic post-vaccination elevation of troponin-I in two studies: Study 5, which enrolled 482 HIV-infected subjects and 97 healthy subjects, and Study 6, which enrolled 350 subjects with atopic dermatitis and 282 healthy subjects. 

In other words in apples-to-apples it was six times more likely, for one percent total risk, that you’d have a cardiac reaction.  Troponin elevation of more than 2x the upper normal limit indicates heart muscle damage.

There is no such thing as “benign” heart muscle damage.  The heart does not regenerate and as such damage to the heart muscle is always considered permanent.

Now how severe the damage is may be another matter, but again — there appears to be a 1% absolute risk with this injection that you will suffer heart damage of some material and OBJECTIVE degree.

One in a hundred people who take this injection, statistically-speaking, will have this happen.  That is not a small risk!

MORE: https://market-ticker.org/akcs-www?post=246529


Here is the critical information about the Jynneos vaccine.

LINK: https://www.drugs.com/pro/jynneos.html

ARCHIVE: https://web.archive.org/web/20220802080936/https://www.drugs.com/pro/jynneos.html

So where does that leave me?


Wolf Spots The Usual Suspects

In my new world, having not only heard Moonshine and Karl, but having “seen what cannot be unseen” regarding population control scamming, it was impossible for me to not see WHY monkeypox sodompox is “the next thing” that these assholes are going to use.

So I said to myself……

OK, I get it. I’m starting to see how this is working. The “depopulation” stuff is THREE tracks – CARDIOVASCULAR for direct killing, IMMUNODISRUPTIVE for long-term killing by other causes, and ABORTIFACIENT + MENSTRUAL DYSREGULATING for fertility control. Look for these jokers to try to “pile on” to any of those three effects with their various drugs and other “fixes” for COVID. And now including the monkeypox vaccine.

You see – I’m a bit prejudiced here.

Having had “wolficarditis” – most likely due to one of my two cases of COVID – I’m not in the mood for some vaccine to start sending any NEW bad vibes into my cardiac test values, which thank goodness have returned to normal.

So NO WAY.

Well, you say – what about the OTHER smallpox vaccine that they’re talking about using for sodompox.

SORRY. EVEN WORSE HEART PROBLEMS.

LINK: https://www.salon.com/2022/08/06/a-virologist-explains-how-and-how-well–the-monkeypox-vaccine-works_partner/

ARE Y’ALL STARTING TO SEE A PATTERN HERE???

Oh, it gets worse.


Hidden Agenda

Remember how the FDA advisory committee did NOT recommend boosters for the COVID shots, but was OVERRIDDEN by that minion of Fauci, the lovely Rochelle Walensky Alinsky?

There was another, later vaccine push where Walensky didn’t even convene the advisory group, to make sure the vaccines would slide by.

Well, guess what. This tactic of ignoring advisory committees for “politicized medicine” works perfectly well for sodompox, too!

From THIS ARTICLE:

LINK: https://www.theepochtimes.com/biden-administration-declares-monkeypox-a-public-health-emergency-across-us_4643735.html?utm_source=partner&utm_campaign=TheLibertyDaily

It comes after officials in New York, Illinois, California, some cities, and the World Health Organization declared respective emergencies for monkeypox. The head of WHO, Tedros Adhanom Ghebreyesus, reportedly overruled an expert advisory committee to make the declaration on July 24, while the U.N. agency confirmed the virus is in about 70 countries outside of Africa.

Yeah, that China-boy Tedros is good for whatever keep Democrats in power.

It’s worth reading that link – you will see that Ron DeSantis refused to make a similar declaration.

But Florida Gov. Ron DeSantis said he will resist declaring an emergency for monkeypox, asserting that such policies—like the mandates and lockdowns around COVID-19—are designed to create a climate of fear. It’s not clear if any other Republican governors will follow his lead.

“I’m so sick of politicians—and we saw this with COVID—trying to sow fear into the population,” DeSantis said during a news conference Wednesday. “We are not doing fear,” he added.

“You see some of these states declaring states of emergency, they’re gonna abuse those powers to restrict your freedom,” DeSantis said about new rules around monkeypox. “I guarantee to you that’s what will happen.”


The Bottom Line

I’m sorry – I refuse to show some gay butt for my joke, so you have to see some chick ass with a fake syringe (it’s OK, Coothie – no real butts were pierced in the making of this silly photo!)

Sodompox is gonna be the big deal – or maybe it’s the fake big deal until some kind of BIG LIE gets layered on top of it.

But no matter what – think LONG AND HARD about taking any new vaccines. Including any possible new Moderna mRNA vaccine (hat tip RDS), since that company is considering the possibility of making one. If anybody can improve on 1-2% cardiac damage, it’s those folks!

I urge you to click that link (ABC News Go), because it will give you a brief exposure to the MSM, which is CLEARLY trying to gin up EXCITEMENT about the monkeypox vaccine, of which there is “not enough to meet demand!!!”, etc., etc., etc.

Yeah.

We are here and it is now. Further than that, all American science is now moonshine out of Washington.

W

“OK, explain once more how a disease which almost exclusively affects buffarino-lovin’ gay boys, who already have AIDS, has become a national emergency. I mean, is Fauci simply turning an AIDS treatment crisis into an ‘opportunity’ to inject everybody again?”

Saved From The Frankenvax

How a Psycho Vaccine Marrying the Infamous COVID Spike Protein to HIV’s Neurotoxic gp41 Was [Allegedly] Canned by a Mere Testing SNAFU


How Australia Dodged The First Mad Vax Bullet of the WEF Scamdemic / Plannedemic

How Science Monetization and Corruption Has Broken All Vaccine Safety Mechanisms and Made Sneaky Liars Out of Scientists


Mood Music


Intro – Prepare To Be Shocked

This is one of the craziest stories your either never heard, or barely heard. I am certain of the following. Nobody ever spelled out to you how NUTS this failed vaccine really was. This absolutely bonkers vaccine, that was almost used on all Australians.

AND MAY STILL BE.

The fact that nobody even followed this story, shows that the captured corporate media is absolutely not doing its job. Either THAT, or their job is to help deceive us.

And you know where my money is on that.

Surely, in the past, both journalists and scientists might have said something to the effect of “Hey – marrying a cardiovascular pathogenic bat virus spike protein and a neurotoxic AIDS protein in a vaccine to prevent a cold seems a little weird.”

BUT NO. NOT NOW.

And yet, some of us, few as we might be, might still have some questions.

We assume – ASSUME – as in ASS / U / ME – that all people in all of science are acting in all of our best interests all the time.

I have been completely broken of this spell, and I can tell you – what I can see now is not pretty.

I need to prepare you for what I’m about to tell you.


State of Corruption of Vaccine Science

First, a fantastic interview of Dr. Robert Malone by Tucker Carlson. It’s very folksy and long – a bit over an hour – but it will absolutely cure you of any idea that science in 2022 has not been almost totally corrupted by money, power, and SECRET AGENDAS.

This guy Malone is as close to a Moderna insider / honest outsider as you’re gonna get, and he clearly sees the dirty play from the Moderna point of view.

Hat tips to FG&C and GA/FL for keeping this video in play. Gail has been pumping this video, too. EVERYBODY need to watch this.

LINK: https://rumble.com/vuo2uu-dr.-robert-malone-on-tucker-carlson-today-feb-10-2022.html

In fact, I suspect that there is some relationship between this interview dropping that the following “factoid”.

Indeed, let’s just save that tweet as an image, in case Twitter decides Jack is becoming too much of a liability.

One of the biggest BOOMS dropped in the video, IMO, is the fact that Robert Malone WARNED the FDA about the toxicity of the spike protein, and they SHRUGGED IT OFF.

Yes. Malone gave them documentation, as asked, and they came back to him and said everything was OK. And THAT is when he started to think something was very wrong.

We’re about to do it AGAIN – only I’m not the first – I’m just rediscovering an obvious “why the heck are they doing THAT” point.

But we’ll get to that in a minute. We need to broaden our list of corrupt suspects.

You see, corporate “science” isn’t the only bad actor here. What about governments that conspire with the corporations to “mandate” their products for a mutual PAYOFF?

It turns out that both Justin Trudeau and the Canadian government have a very large incentive in mandating the broken, dubious, and just plain BAD Moderna and Pfizer “vaccines”.

LINK: https://rumble.com/vupkuv-breaking-criminal-canadian-monopoly-dr.-david-martin-exposes-why-trudeau-wo.html

When you realize that Justin Trudeau is not only following his mandate madness for WEFfian ideological reasons, and for Papa Fidel power, but also for CASTRO CASH, you understand what’s REALLY going on.

SO – now that you realize THESE PEOPLE care more about other things, than they care about us, the following will make more sense.


The Frankenvax That Almost Was

So just today, FG&C posted THIS TWEET which made me go WTF…..

Basically, an Australian COVID vaccine that falsely triggers AIDS / HIV tests was recalled. The vaccine was NOT sent out for use by the public, because it gave people positive AIDS tests.

GREAT, but…..

  • WHY did the vaccine do this? And by the way….
  • Didn’t this happen BEFORE – like over a year ago?
  • I could have SWORN this happened before.
  • Is this OLD NEWS or a DIFFERENT VACCINE?
  • Or did they bring the SAME vaccine BACK?
  • Or even worse….. AND logic…..

You see, I remember something just like this bit of news, over a year ago. It was some vaccine from an Australian university that accidentally triggered AIDS tests.

Well, when I looked closer at this, it turned out to be THE SAME NEWS. Meaning that this recent tweet was just OLD NEWS.

HOWEVER – I happen to know a lot more now, a year later, so I dug DEEPER and FOUND MORE.

And now I want to explain to you, exactly what is going on.

Because this monster AIN’T DEAD.


VolksWackcine 451

Let’s begin by looking at the actual announcement that all this news came from. The paragraph in BOLD is the critical one. If you’re going to TL;DR past all the rest, read THAT paragraph.


Update on The University of Queensland COVID-19 vaccine

11 Dec 2020

Friday, 11th December, 2020: The University of Queensland (UQ) and CSL today announce that the Phase 1 trial of the UQ-CSL v451 COVID-19 vaccine has shown that it elicits a robust response towards the virus and has a strong safety profile. There were no serious adverse events or safety concerns reported in the 216 trial participants. However, following consultation with the Australian Government, CSL will not progress the vaccine candidate to Phase 2/3 clinical trials.

The University of Queensland commenced a Phase 1 trial of their COVID-19 vaccine candidate – v451 – in July 2020, to assess safety and immunogenicity in healthy volunteers. CSL was working towards taking responsibility for the Phase 2/3 clinical trial and large-scale manufacture of the vaccine, upon completion of successful trials.

The Phase 1 data also showed the generation of antibodies directed towards fragments of a protein (gp41), which is a component used to stabilise the vaccine. Trial participants were fully informed of the possibility of a partial immune response to this component, but it was unexpected that the levels induced would interfere with certain HIV tests.

There is no possibility the vaccine causes infection, and routine follow up tests confirmed there is no HIV virus present.

With advice from experts, CSL and UQ have worked through the implications that this issue presents to rolling out the vaccine into broad populations. It is generally agreed that significant changes would need to be made to well-established HIV testing procedures in the healthcare setting to accommodate rollout of this vaccine. Therefore, CSL and the Australian Government have agreed vaccine development will not proceed to Phase 2/3 trials.

The Phase 1 trial will continue, where further analysis of the data will show how long the antibodies persist, with studies so far showing that levels are already falling. The University of Queensland plans to submit the full data for peer review publication.

UQ Vice-Chancellor, Professor Deborah Terry, said while the outcome was disappointing, she was immensely proud of the UQ team who had shouldered a heavy burden of responsibility while the world watched on. “I also want to thank our many partners, our donors – including the Federal and Queensland Government – and of course the 216 Queenslanders who so willingly volunteered for the Phase 1 trials.”

UQ vaccine co-lead, Professor Paul Young, said that although it was possible to re-engineer the vaccine, the team did not have the luxury of time needed. “Doing so would set back development by another 12 or so months, and while this is a tough decision to take, the urgent need for a vaccine has to be everyone’s priority.”

“I said at the start of vaccine development that there were no guarantees, but what is really encouraging is that the core technology approach we used has passed the major clinical test. It is a safe and well-tolerated vaccine, producing the strong virus-neutralising effect that we were hoping to see.

So we will continue to push forward and we are confident that with further work the Molecular Clamp technology will be a robust platform for future vaccine development here in Australia and to meet future biosecurity needs.

Dr Andrew Nash, Chief Scientific Officer for CSL said “This outcome highlights the risk of failure associated with early vaccine development, and the rigorous assessment involved in making decisions as to what discoveries advance.”

“This project has only been made possible by the innovative science developed by world-class scientists at The University of Queensland and the strong collaboration between our organisations, and many others, over the last 10 months. CSL and Seqirus are committed to continuing our work to protect the Australian population against COVID-19. Manufacture of approximately 30 million doses of the Oxford/AstraZeneca vaccine candidate is underway, with first doses planned for release to Australia early next year. In addition, CSL has agreed at the request of the Australian Government to manufacture an additional 20 million doses.”

UQ and CSL acknowledge the support of the Coalition for Epidemic Preparedness Innovations (CEPI) in partnering to enable the rapid development of the vaccine candidate through clinical trials.

– ENDS –

LINK: https://www.csl.com/news/2020/20201211-update-on-the-university-of-queensland-covid-19-vaccine


WOLF AGAIN.

So what they’re saying is that this vaccine – which uses the HIV protein gp41 – sets off HIV tests. And THAT made the test unacceptable to move forward. The remaining phase II and phase III trials were cancelled, while the phase I trials continued to finish collecting data.

And WHILE they say that the phase I testing showed that the vaccine was safe and effective, if you look more closely, they only tested it on 216 people.

We KNOW from the Moderna and Pfizer tests, that even after HUGE phase II and phase III trials, using thousands or tens of thousands of participants, there are serious side effects that are STILL not discovered until actual roll-out to the public, when millions receive the shot.

And that does NOT include long-term effects. We know NOW that this determination can be critical in many cases.

And one more point for the record. As you can see by the statement at the end of the press release, this vaccine was supported by the Bill Gates organization CEPI.

Yeah, that CEPI, and THAT Bill Gates.

Like I say, CEPI is how Gates gets TWO VOTES, and GAVI is how he gets THREE.

So the bottom line – this vaccine was killed because it set off AIDS tests.

But let’s dig a little deeper into that.


So What’s With HIV and the COVID Vaccines?

When I first heard about this particular Australian vaccine (UQ-CSL v451, or v451 hereafter) triggering HIV tests, my immediate thought was that this might be proof that the Indian researchers were CORRECT – that the spike protein really contained those four inserts from HIV, and that THIS was setting off tests for HIV.

Later, I heard that – no – there was actually some segment of HIV protein being used in the v451 vaccine INTENTIONALLY. Thus, the whole problem seemed stupid, the use of the HIV protein seemed short-sighted, and I promptly forgot about it. No smoking gun – just a stink bomb.

However, a year’s time changed all that.

Think how different the perspective is now.

  • virus almost certainly came out of a biowarfare lab in China with PLA/NIH ties
  • Fauci, Dazsak and minions now known to have LIED about origins
  • Fauci gang also lied when pooh-poohing the Indian HIV insert hypothesis
  • mRNA vaccines seem to be producing immune deficiency, a.k.a. “VAIDS”
  • there are working hypotheses now which explain immune deficiency
  • Fauci’s history with HIV mirrors current history with COVID – lies and hidden agenda
  • Fauci seems to be obsessed with immunodeficiency and vaccines
  • Fauci promoted bad killer drugs as treatments in both cases (AZT, remdesivir)
  • Fauci seems to have an agenda clearly counter to truth as we know it, and is likely serving something beyond the increasing “fake” science which the public believes is operant in the world, but which is very likely a “reduced set” intended to deceive us

Thus, with all that WEIRD background, it NOW seems a bit “par for the course” that somebody in that world would want to bring HIV into the COVID equation.

But is that a good idea?

Now – before I go talking about why this might be a BAD idea, I want to give you plenty of references as to why they SAY it was a good idea.

Let’s start with a good explanation of why the false positives occurred. This article includes a lot of information on the v451 vaccine itself.

LINK: https://theconversation.com/how-did-the-university-of-queensland-csl-vaccine-fail-due-to-false-positive-hiv-tests-a-vaccine-expert-explains-151911

ARCHIVE: https://archive.fo/duxjK

The article mentions, without too much detail, that the HIV protein is part of a “molecular clamp” – a trimeric molecular “holder” of spike protein molecules. This holder allows three molecules of any attached spike-type protein to stay locked into a rigid, parallel conformation, which will remain in the desirable pre-fusion (with a cell) configuration, and not change into the useless post-fusion configuration.

The article also links to a scientific paper on the technology:

LINK: https://www.ncbi.nlm.nih.gov/labs/pmc/articles/PMC7672035/


Front Immunol. 2020; 11: 592370. Published online 2020 Nov 4. doi: 10.3389/fimmu.2020.592370 PMCID: PMC7672035 PMID: 33250897

Rapid Response Subunit Vaccine Design in the Absence of Structural Information

Danushka K. Wijesundara, 1 , 2 Michael S. Avumegah, 1 , 2 Julia Lackenby, 1 , 2 Naphak Modhiran, 1 , 3 Ariel Isaacs, 1 Paul R. Young, 1 , 2 , 3 Daniel Watterson, 1 , 2 , 3 , * and Keith J. Chappell 1 , 2 , 3 , *

ABSTRACT

Prior to 2020, the threat of a novel viral pandemic was omnipresent but largely ignored. Just 12 months prior to the Coronavirus disease 2019 (COVID-19) pandemic our team received funding from the Coalition for Epidemic Preparedness Innovations (CEPI) to establish and validate a rapid response pipeline for subunit vaccine development based on our proprietary Molecular Clamp platform. Throughout the course of 2019 we conducted two mock tests of our system for rapid antigen production against two potential, emerging viral pathogens, Achimota paramyxovirus and Wenzhou mammarenavirus. For each virus we expressed a small panel of recombinant variants of the membrane fusion protein and screened for expression level, product homogeneity, and the presence of the expected trimeric pre-fusion conformation. Lessons learned from this exercise paved the way for our response to COVID-19, for which our candidate antigen is currently in phase I clinical trial.


Here is part of a really good graphic from the paper.

You can see how it’s possible to produce a spike protein with the “molecular clamp” attached, and then simply let this recombinant construction TRIMERIZE (form a triple, side to side) around the three molecular clamps, and thereby stabilize the three spike protein molecules next to each other.

This is a bit like a “motif” within an actual virus, where spike proteins, sticking out next to each other, protect each other’s sides. THAT is the basic idea of this thing.

Remember how Novavax assembles a bunch of spikes via modified ass ends into a kind of antigenic cloved apple, to create a kind of fake virus? Same very basic principle.

Indeed, the molecular clamp is even a bit like TWO motifs, since gp41 serves a somewhat similar purpose in the HIV virus, being the root of a stalk to an attack mechanism.

HIV-1 fusion process. It involves both subunits of the envelope spike complex. Notably, gp41 is shown in green with its transmembrane region buried in the virion membrane, both segments of heptad repeats (CHR closer to the virus and NHR closer to the host cell) before and after conformational changes, and the N-terminal end of the ectodomain in gray. In the last two panels pointed out by the red arrows, gp41 is observed following penetration of the host cell and following a conformational change resulting in the six-helix bundle which brings the viral and cell membranes into close proximity.

So – in a very real sense – this whole “vaccine” thingie is a literal marriage of HIV and coronavirus – the simplest possible one.

And they didn’t tell you ANY of this shit – did they?

So all of that WORKS, but the problem is that antibodies don’t just form to the attached spike protein – they ALSO form to the “molecular clamp”, meaning to the gp41 protein.

And what does that mean?


An AIDS Vaccine in Disguise?

The people who made the v451 vaccine say they didn’t expect there to be so much antibody response to the gp41 parts of the vaccine, thus triggering HIV tests.

You know what?

I don’t believe them.

I think they were gaslighting us all along.

Part of this is due to the fact that I’ve seen gp41 named numerous times as a potential basis for subunit vaccines against HIV. In fact, in one reference, I saw it named as THE BEST HOPE for an AIDS vaccine.

They didn’t mention that? LOL. OH, REALLY.

So WHY would anybody be using gp41 as part of an antigen, and not expect it to generate antibodies?

In fact, one might almost look at this v451 vaccine and regard it as an HIV vaccine, with spike proteins tacked onto gp41 as a kind of “nasty adjuvant” to initiate the immune response to the HIV protein.

Seriously – which is the real target here – COVID or HIV? Or BOTH?

This looks to me like a perfect example of…..

WAIT FOR IT….

“REVERSO”.

But let’s just set that aside for now, and pretend that the thing which COULD be a vaccine for EITHER ONE of the two things they stuck in it, is REALLY a vaccine for the fakey-fake cold that we don’t need a vaccine for, and NOT a vaccine for the sexual disease that stands in the way of Luciferian scum creating their polyamorous sexual paradise of literal epic random phuckery.

OMG, these people have just lied, and lied, and lied again. And they will KEEP lying.

But we’ll pretend they’re not lying, for just a little while longer.

So if we have an actual COVID vaccine here…..

…..is it a good idea to include the HIV gp41 protein subunit?

Well, after what we’ve seen with the spike protein, I was thinking maybe it wouldn’t be.

And it turns out, I wasn’t the first person who thought of this.


Doorless Carp’s Suspicious Cat In A Box

When I went looking for the toxicity of the gp41 protein, one of the first things that came up was some guy or gal who appears to have been actively suppressed on Twitter, eventually banned to Gab, and whose substack article on the topic has only two likes – ONE OF THEM MINE.

Doesn’t mean the article’s not important. And I think it’s about to get a few more hits.


LINK: https://doorlesscarp953.substack.com/p/update-on-the-university-of-queensland

Update on The University of Queensland COVID-19 vaccine. “..trial did not give trial participants HIV”, just a neurotoxic glycoprotein

11 Dec 2020

DoorlessCarp Feb 11

This is a wonderful article that is simply SKEPTICAL of the entire “it was pulled because of triggering AIDS tests” reasoning.

DoorlessCarp read the same press release I cited above, and pokes and prods it from the point of view of somebody who knows a heck of a lot about HIV and AIDS, and doesn’t buy what (s)he’s reading in that press release. Something doesn’t sniff right to “them”, and “they” spell out the issues.

I will attempt to summarize DoorlessCarp’s concerns (noted as “DLC” hereafter).

First, DLC admits to actually being led to the problem by one of those Fake News “straw man fact checks”, which attempt to either “debunk” facts or mislead scandals by setting up an adjacent strawman and knocking it down. OBSERVE.

“Fact check: An Australian vaccine trial did not give trial participants HIV”

https://www.reuters.com/article/uk-factcheck-hiv-idUSKBN28R2WT

LOL. No. The truth they’re protecting is that the “COVID vaccine” gave them HIV antibodies, and it was very likely the whole point.

To quote DLC about the Aussie vaccine researchers: “I wouldn’t let these clowns dispense aspirin, let alone design fast tracked vaccines.

DLC then makes this statement, noting that there is a curious skew between the reality of HIV testing and the idea that there is some kind of a problem here.

Interesting rapid response to the effect that antibody only HIV tests have long since been debunked as a diagnostic tool on their own due to cross reactivity from other antibodies. They don’t tell you anything useful.

DLC then quotes extensively from this letter which explains why HIV testing via antibodies is actually a rather horrible mishmash of false positives and negatives, ultimately requiring a clinical diagnosis and “validation by lifestyle facts”.

Which leads to the next section, which I quote:

So what was the real reason for pulling the Australian trial, was it the gp41 toxicity?

The antibody problem raises more questions than it answers as spike S2 has homology to P24, GP41 and GP120.

This is dark stuff, P24 has been ported straight across from HIVs capsid to the spike protein. Here’s the proof, at least as far as what specific antibodies are telling us, which don’t lie:

What is p24 antigen?

“One distinctive HIV antigen is a viral protein called p24, a structural protein that makes up most of the HIV viral core, or ‘capsid’. High levels of p24 are present in the blood serum of newly infected individuals during the short period between infection and seroconversion, making p24 antigen assays useful in diagnosing primary HIV infection.”

https://www.aidsmap.com/about-hiv/faq/what-p24-antigen

This section makes the following points:

  • suspects the real reason for pulling the vaccine was the toxicity of gp41
  • notes that the spike protein already has potentially dangerous homologies to three HIV proteins, p24, gp41 and gp120
  • p24 is basically the nucleocapsid protein of HIV
  • p24 tends to be detected early in the AIDS process, before antibodies to it form

DLC then cites several papers demonstrating that there is already a lot of understanding of antibody cross-talk between the SARS-CoV-2 spike protein and either (1) original SARS-CoV proteins, and (2) HIV-1 proteins.

In the latter case, there is specific interaction with gp41.

References given:

The SARS CoV-2 spike directed non-neutralizing polyclonal antibodies cross-react with Human immunodeficiency virus (HIV-1) gp41 (Dec. 2021)

https://www.sciencedirect.com/science/article/pii/S1567576921008237?via%3Dihub

Cros-reactivity of SARS-CoV-2 with HIV chemiluminescent assay leading to false-positive results (2020)

https://jcp.bmj.com/content/74/9/614#request-permissions

DLC then lays the hammer down on the fact that gp41 is responsible for the dementia of AIDS.

I’m including the whole thing here.

Pathology:

Accumulation of β-Amyloid Precursor Protein in Axons Correlates with CNS Expression of SIV gp41 (2002)

“In this study, a strong association (p = 0.005) was identified between elevated axonal β-APP levels and the amount of SIV gp41 present in white matter, implicating HIV/SIV gp41 as a mediator of axonal damage.

https://academic.oup.com/jnen/article/61/1/85/2916415

For those who don’t know, beta amyloid is associated with several degenerative neurological disorders:

Amyloid-β and Parkinson’s disease (2018)

https://pubmed.ncbi.nlm.nih.gov/30377818/

Beta-amyloid 42 accumulation in the lumbar spinal cord motor neurons of amyotrophic lateral sclerosis patients (2004)

https://www.sciencedirect.com/science/article/abs/pii/S0969996105000276?via%3Dihub

Alzheimer’s Disease and the β-Amyloid Peptide (2010)

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2813509/

They knew this way back in 1999:

Mechanisms and Structural Determinants of HIV-1 Coat Protein, gp41-Induced Neurotoxicity (1999)

Abstract

Of the individuals with human immunodeficiency virus type 1 (HIV-1) infection, 20–30% will develop the neurological complication of HIV-associated dementia (HAD). The mechanisms underlying HAD are unknown; however, indirect immunologically mediated mechanisms are theorized to play a role. Recently, the HIV-1 coat protein gp41 has been implicated as a major mediator of HAD through induction of neurocytokines and subsequent neuronal cell death. Using primary mixed cortical cultures from neuronal nitric oxide synthase (NOS) null (nNOS−/−) mice and immunological NOS null (iNOS−/−) mice, we establish iNOS-derived NO as a major mediator of gp41 neurotoxicity. Neurotoxicity elicited by gp41 is markedly attenuated in iNOS−/− cultures compared with wild-type and nNOS−/− cultures. The NOS inhibitor l-nitroarginine methyl ester is neuroprotective in wild-type and nNOS−/− cultures, confirming the role of iNOS-derived NO in gp41 neurotoxicity. Confirming that iNOS−/− cultures lack iNOS, gp41 did not induce iNOS in iNOS−/− cultures, but it markedly induced iNOS in wild-type and nNOS−/− cultures. We elucidate the region of gp41 that is critical for iNOS induction and neuronal cell death by monitoring iNOS induction with overlapping peptides spanning gp41. We show that the N-terminal region of gp41, which we designate as the neurotoxic domain, induces iNOS protein activity and iNOS-dependent neurotoxicity at picomolar concentrations in a manner similar to recombinant gp41 protein. Our experiments suggest that gp41 is eliciting the induction of iNOS through potential cell surface receptors or binding sites because the induction of iNOS is dose dependent and saturable and occurs at physiologically relevant concentrations. These data confirm that the induction of iNOS by gp41 and the production of NO are primary mediators of neuronal damage and identify a neurotoxic domain of gp41 that may play an important role in HAD.

Keywords: HIV-1, HIV-associated dementia, neurotoxicity, gp41, immunological nitric oxide synthase, nitric oxide

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6782354/

DLC’s concluding remark:

“Off to Moderna we go”

Insist that love drive the clown car – Pam Grout

Yeah, I kinda get this sentiment.

And I quote again:

I wouldn’t let these clowns dispense aspirin, let alone design fast tracked vaccines.

Is gp41 a danger? It may well be. And nobody is asking the question, because (IMO) the neural pathogenic initiator that gp41 is, was passed off as a “molecular clamp” instead of the REAL ANTIGEN.

If they’re going to resurrect this weirdo COVID-HIV vaccine – and YES, they’re thinking about it – then there needs to be some examination FIRST of what the HELL is going on.


So What The Heck Is Going On Here?

When I was a young lad in the old days of science, there was lying, misrepresentation, and thievery, but it was on a much smaller scale.

We used to joke very cynically, back in the ’70’s, that every natural product being synthesized in a laboratory cured cancer, because we all knew that was not true.

We knew that these substances were really being synthesized merely because the molecules were a synthetic challenge, and a way for professors to make a name for themselves in synthetic chemistry. Almost NONE of these substances would EVER be used to treat cancer, and most would wash out very soon upon investigation. Almost none of them would ever even LEAD to a useful cancer drug. But LYING about their importance was how people got money for their labs. Every structurally interesting new molecule was always the next savior – until it wasn’t.

I used to think that the people giving out the money were fools about this, but not any more. I am beginning to think that the “givers” have always been just as corrupt as the “takers” – they’re just the “insiders” who turn on the spigots for their fellow “outsiders”.

I have no reason to think that vaccines are any different.

I think that a false crisis was used as a massive MONEY-BOMB – a global pile-on of the giddiest and most corrupt kind.

Probably the biggest one in 20 years.

I think that an AIDS vaccine was passed off as a COVID vaccine, by plausibly passing off the natural function of the HIV subunit as a new tool for other things, because – well – it IS such a new tool – just like every new interesting molecule MIGHT actually be some amazing new drug that cures cancer.

They lie skillfully, and they lie with truth, and it’s almost impossible to PROVE that the secondary “oh by the way” was actually the primary motivation.

We have changed from white lies that everybody understood WERE lies, to much more devious lies where scientists engage in fooling not just the public, but even other scientists.

I do think we have to wake up now. We can no longer afford the luxury of pretending not to know.

If I have to thank Joe Biden and his puppetmasters, including his “handler” Obama, for anything, it is for WAKING ME UP with these stupid mandates.

Nothing worked so well, to show us that the NEW WORLD ORDER is a direct threat to humanity, and needs to be stopped.

Science can be good again. But it must never, ever, abandon TRUTH.

And here we are.

W

DEAR KAG: 20220121 – The Pub is OPEN / The Anti-Saline Theory and The Toxic Batch Problem

The Pub is OPEN!

Tonight is a special night. We invite ALL SCIENTISTS to come down to the bar for TWO HOURS, and listen to one scientist appeal to our LOGIC and our COMMON SENSE on the TOXIC BATCH PROBLEM.

ALL WHO WISH are invited to sit down, drink in hand, and watch – but it is especially important that ALL SCIENTISTS see this.

It is my contention that if ALL scientists in the world – on this planet – watch this video that I will show you, then the entire WORLD will be QUICKLY AWAKENED to the reality of some kind of systematic problem with the current COVID vaccines – some kind of problem which is evidenced by toxicity showing up with certain batches.

But more about that later.

Right now, come into the bar and find a comfy spot.

While our beloved REAL bartender takes a needed break of unknown duration, we continue to ENDEAVOR TO PERSEVERE.

Though we are not especially good at mixing tasty drinks, we can stir some occasional thoughts into a compelling report, argument, recollection, or proposition.

And with that barest promise, we begin.


On the Jukebox

The rare live version of a song rarely found on any bar jukebox – enjoy!

Psalm 118:19-24

19Open to me the gates of righteousness, that I may enter and give thanks to the LORD.

20This is the gate of the LORD; the righteous shall enter through it.

21I will give You thanks, for You have answered me, and You have become my salvation.

22The stone the builders rejected has become the cornerstone.

23This is from the LORD, and it is marvelous in our eyes.

24This is the day that the LORD has made; we will rejoice and be glad in it.


Christmas Spirit

We are going to stretch out Christmas longer than your neighbor who never takes down their Christmas lights.

Enjoy this reminder of how special it was to have the Trumps in the White House.

Will they be back?

STAY TUNED!!!

And now, the rules of the pub.


HOUSE RULES

God bless us, every one! Tiny Tim had such a beautiful soul. He hadn’t a mean bone in his body…unlike most of us. But in keeping with Christmas, we promise to honor Wolf’s rules and keep Scrooge at bay. The Utree is where the Ghost of Christmas Present will conduct you should you need to rattle some chains. Another option, should all hell break loose is here.

Now, back to business.


AMEN!

(#FJB = Free the January Brothers)


Current Art On The Wall

We opened this week’s shipment, and there was a note on top of the contents that said:

“DANGER: STEAMPUNK”

Looks like a real Pandora’s box to me!

Sure enough, the very next thing we found was MONDAY’S LEFTOVERS.

Mmmmmmmmm. Remember – if the can isn’t actually bulging, you can ignore the date!

Click it! The music seems useful for viewing the remainder of the art!

MOAR COWBELL GEARS!!!

Yeah, I’m enjoying this timeframe-loosening absinthe of sorts.

Indeed, absinthe per se seems to be a meme in steampunk.

Look for GREENPUNK as a subgenre of STEAMPUNK.

OK – one more image and then back to reality.

LOL. Nope. That’s not it.

Let’s try another.

AYE-YI-YI. That’s not it, either. I get the sentiment, but I tend to think the devil’s in certain details of the genre, and – as always in the art world – one must proceed with caution.

Although I do have a story about a fantastic dream you may have heard. In some ways, it was the opposite of steampunk, but it had a certain similar quality of alternate reality about it.

Let’s try one more.

Hey – that’s not steampunk! That’s REALPUNK.

I’ll let Steve tell us all about it.

In the meanwhile, we take leave of the infinitude of artistic imagination, and find ourselves back at the concrete.

Or so one might think!


And now our feature presentation

The Anti-Saline Theory and The Toxic Batch Problem – Did Somebody Actually Contaminate Lots of the Vaccines?


I never really thought that I might be defending Big Pharma – in whole or in part – at this point in the multiple scandals of the COVID-19 Plannedemic.

Maybe “defending” isn’t the right word. Maybe “presenting a potentially somewhat exonerating theory” IS the right phrase.

In fact, I don’t even know WHO I’m exonerating, or or that matter, WHO I’m accusing. Likewise, I’m not even sure who the TARGETS of the perpetrators in this “theory” actually are.

However, this is not a “conspiracy theory” – something which is generally certain of perpetrators, victims, and motives.

This is a CRIMINAL THEORY. This is a theory which allows us to begin to examine an apparent crime, in order to determine perpetrators, victims, and motives. It’s a theory which may even be wrong.

I ask all of you to briefly set aside prejudices, which is often necessary to do when evidence needs to be viewed as potential exoneration. Feel free to bring your prejudices and prior theories back AFTER you have looked at these possibilities, because you will need to compare theories, and your current favorites need to CONTEND with what I’m proposing here.

Thus, we begin.


The Saline Theory

The SALINE THEORY – which many regard as a criminal theory, and which others regard as a “conspiracy theory”, contends that the reason some people have either NO REACTION or ALMOST NO REACTION to the “clot shot” – meaning all the standard Western COVID-19 vaccines – is that those people are being given medical saline solution instead of actual coronavirus vaccines.

The proposed motives for this, generally speaking, are either to spare particular individuals from the problems of the vaccines, OR to statistically reduce the numbers of people being KILLED or INJURED by the vaccines to acceptable levels.

Now, in full disclosure, I have been generally, if quietly, rather critical of the saline theory, despite the fact that I am very skeptical of Big Pharma in general, and even more skeptical of Pfizer and Moderna.

Why am I skeptical of the theory? Basically, because it doesn’t really change most vaccines. In a sentence, vaccines are DESIGNED to approximate saline.

In the history of vaccines, the GOAL has always been to literally approach the state of “injecting people with saline” – meaning not much of anything is given, and nothing bad happens.

Thus, an ideal vaccine – and in practice most good vaccines – basically do nothing except grant immunity, which until recently was always expected to be inferior to “natural” disease-conferred immunity.

Let me point out AS AN ASIDE right here that the industry lost megatons of credibility by letting the media trot out nonsense about vaccine immunity being better than disease-conferred immunity, allegedly negating centuries of medical knowledge. Foolish to abandon the truth on that one. Clearly the result of Big Pharma now having the upper hand against Big Med, thanks to Big Finance, and the willingness of Big Media to tell any lie. But I digress.

The point is simple. We EXPECT normal, good vaccines to have very few adverse events – so rare that we rarely hear about them – and that people basically ARE getting saline.

In other words, people generally can’t tell the difference between a good vaccine, a “bad because too weak” vaccine, and saline.

THAT’S THE POINT – that the REALITY of rare adverse events is expected to MATCH our experience of almost never hearing about or experiencing first, second, or third-hand, that somebody had a problem with a vaccine.

I myself went through life NEVER connecting a vaccine to any personal injury – that is, until I got over 30 years of flu shots, religiously, but then switched to my dominant shoulder for no particular reason, and experienced subsequent NOTICEABLE inflammatory issues which were very likely connected to the vaccine. All that being said, I was much older at that point, and older people ARE more likely to experience inflammation of joints as part of getting old. Indeed, this didn’t stop me from getting the flu shot for a number of more years – KNOWING that the vaccine might be responsible.

SO – bottom line – I’m not at all skeptical of vaccine injury, from sore arms up to death.

But I remain skeptical of the saline theory – for the stated reasons.

I never throw anything OUT completely – but I have been quite skeptical that there might be ANY kind of conspiracy – even a very realistic one – to replace weak “do-nothing” vaccines that the industry has spent DECADES making, and is quite good at making, with saline that does almost the same thing.

And INDEED – bear the opposite in mind. Bad things happen to people who get placebos, “because math”. And more than that, bad things happen to people who get saline, “because injection”. It’s extremely rare, but it DOES happen. This is an acknowledged truth of Anthony Fauci’s Holy of Holies, the placebo-controlled double-blind study. That’s why researchers factor out the difference which comes simply from “doing the test”.

But the fact is simple. Saline is generally pretty damn safe to inject, because it does nothing. A good vaccine, likewise, does nothing but provide some degree of immunity – hopefully lifelong, but with a number of years generally being acceptable, depending on the vaccine.

SO – if you tell me somebody got saline – I will tell you that they got a “good vaccine”, and we’re left with only some very difficult science to tell which of us is right.

However, all of that has a problem.

A HUGE problem.

The problem is summed up by the fact that almost everybody in the English-speaking world recognizes the term “clot shot” as a grim, joking nickname for the COVID-19 vaccines.

That didn’t happen by accident. Admittedly, it’s an injection for preventing or pre-treating a clotting disease by generating immunity TO a clotting protein WITH that same clotting protein, or something very similar to it. BUT STILL…..

In practice, this is NOT a harmless vaccine. No amount of propaganda changes that.


The Anti-Saline Theory

So what is the ANTI-SALINE THEORY?

The anti-saline theory, based on something called the toxic batch problem, is roughly a mirror image of the saline theory. It thus contends that some of the coronavirus vaccines were the opposite of non-toxic saline which could NOT harm people, and were, in fact, loaded with something nasty which caused illness and death.

Possible motives are likewise mirror images of the saline theory – to either harm certain people, or to INCREASE the number of injuries and deaths from the vaccines.

NOW – let me be clear. In the absence of the “potential evidence” of the toxic batch problem, I would be every bit as skeptical of the anti-saline theory as I am of the saline theory.

Even for a bad, risky, side-effect-prone vaccine, blaming the still-generally-infrequent side-effects on anything BUT the vaccine itself would seem foolhardy. We have MANY “more risky” vaccines for nasty tropical diseases, from yellow fever up to Ebola, which we generally ONLY give to people at high risk of actually getting the disease, because the vaccines may be a LESSER RISK than the disease, but they are an INCREASED RISK over most vaccines.

We normally don’t need to postulate that the cause of that higher risk is adulteration due to a new cause or perpetrator, when we have the vaccine itself and the vaccine makers, presumably fighting the risk but possibly not succeeding as well as we would like, as our primary suspects.

So how does the toxic batch problem change all that?


The Toxic Batch Problem

First, a reflection. A bit of a warning. Something to prepare you.


At the various stages where one understands pieces of this problem, the revelations really cannot be “unseen”. And yet, the fact that this problem WAS unseen by SO many for SO long, raises questions about whether or not we are just now seeing the edges of something which has been with us for far longer than we realized.

I know that sounds a bit fantastic, as well as euphemistic and even a bit “code”, but now you understand why so many people who have gained deep knowledge of problems with the COVID vaccines, have gone through various emotionally jarring moments of realization.

Something is NOT RIGHT, and yet there seems to be INTENTION behind the condition.

SO – if you get HIT by this sort of realization as we are going along, just know that you are not alone.

OK, back to work. Ah, yes. The toxic batch problem.


I can sum it up as this.

Normally, one expects that a consistently produced pharmaceutical has a VERY wide range of reactions in those to whom it is given, BUT that this statistical range of responses (you can imagine a bar graph, a pie chart, a curve, or a whole bunch of all of them) will stay roughly the same from BATCH TO BATCH.

Stated simply, we expect the variation BETWEEN sets of variations to be SMALL, CLOSE, PREDICTABLE, and REPRODUCIBLE.

This is simply the “law of large numbers”. You flip a thousand pennies. I flip a thousand pennies. It’s very unlikely that we’ll get exactly the same numbers, but BOTH OF US will be close to 500 heads and 500 tails. Any deviation from this will be a nice bell curve, perfectly explainable by statistics.

Try any “batch” of pennies – it will be close to 50:50 heads-to-tails because of the consistency of pennies.

The toxic batch problem is that adverse events for the COVID-19 vaccine batches violate this – and in a HUGE WAY.

A small fraction of the batches (about 5%) are STRIKINGLY TOXIC relative to all the other batches.

The differences are too big, the harmless group is too large, the nasty group is too small, and there are additional patterns that are not random and should not be there.

Yes, there will be variation in the exact numbers of deaths and injuries from batch to batch, “because statistics“, but that variation should be small, natural, centered, and understandable mostly in terms of mathematics. If there IS a big difference in the numbers between the batches, then there has to be some kind of systematic difference – most likely either in the contents of the batches, or in the administration of the batches.

Let’s look at the latter first.

As an example of an administration difference, if you give one batch to kids, and another to seniors, you expect differences. However, if the batches are BIG, and they’re used in a lot of different places, and the groups of people those places serve are large and diverse, then the differences from administration will vanish.

And even if those differences DON’T vanish – in FACT, even if you INTENTIONALLY give one batch to kids and another to seniors, those differences cannot be as big as what was observed.

Another administration difference would be to use some batches ONLY for first injections, and others ONLY for second injections.

Again, we do expect differences there, but not nearly as big as what is observed.

IN FACT, the difference between the “good, nearly harmless batches” (doesn’t that sound like saline?) and the BAD batches is SO big, that it is NOT EXPLAINED by ANYTHING seen in the Moderna and Pfizer trials.

THIS is one of our first clues that something is actually wrong with the contents of those toxic batches.

Now – let’s look at the possibility of a difference in contents.

Could it be that the vaccines are “going bad” and turning into something more poisonous?

Yes, this is possible – BUT the fact of the matter is that when drugs degrade, they almost invariably become “less active”, not MORE active – and certainly never MORE active by orders of magnitude.

Rocks just don’t “roll uphill” by themselves.

In fact, there is a great argument you will see later, made about the COVID-19 vaccine data, as compared to the flu vaccine data, which points out that if you remove all the “bad batches” from the COVID-19 vaccine data, it looks almost exactly like the flu shot.

BASICALLY, SALINE.

Like a normal vaccine is supposed to look.

Now, hopefully, you not only understand why I called this the “anti-saline theory”, but you are also “seeing certain things that you cannot unsee”.

Because YES – something is definitely wrong with those batches.

Even if you don’t accept that the majority of batches are “harmless”, something is terribly wrong with the rest.


But before I get into talking about possible reasons as to WHY these “bad batches” are different, I want to thoroughly convince you that they ARE different and that it’s NOT NORMAL.

I want to give you a brief introduction to the toxic batch problem as seen by the people who found it, examined it, and first told the world.


A Pharma Exec & Researcher Examines the Data

We begin with a video of a man who appears to me to be very typical of the scientists that I knew during my career. He does not appear crazy, loony, mentally ill, psychopathic, or even irrational.

He seems, if anything, like somebody who has witnessed institutional madness descending upon their professional world. You know – like what happened to scientists in Russia in the early 1900s, and in Germany and Italy in the 1930s.

As I listened to this guy, he made scientific sense, just like any seminar speaker, invited lecturer, or even an interviewer for student job prospects from a drug company.

In fact, I believe that if most scientists listened to him, they would BELIEVE HIM.

There is something *apparently* wrong with certain specific batches of the COVID vaccines from three companies that were used globally AND specifically in America. And according to the speaker, a retired drug industry executive and research scientist, this difference cannot be random – it must be adulteration of some kind.

Just watch and see what you think.


LINK: https://odysee.com/@Corona-Investigative-Committee:5/Mike-Session-86-en:0


Now – let me summarize.

The most key and salient point is that vaccine side effects vary strongly by batch number – and in a way that the drug companies MUST understand to be REAL and PROBLEMATIC. The variation is NOT merely statistical from a quality-controlled product. It is systematic – meaning it has a CAUSE other than randomness. It is not necessarily intentional (IMO), but it is an OBVIOUS problem.

There is also some argument over how batch toxicity varies across time and batch number – I will leave THAT for the next videos.

The point which the speaker, Dr. Yeadon, made which struck me hardest, was the simple but powerful idea that the individual responses of recipients to a vaccine batch can vary wildly, BUT that the statistical array of responses will NOT vary significantly between batches – that it CANNOT vary – UNLESS there is some REAL, SIGNIFICANT, CONTENT DIFFERENCE between the batches.

The alternative, in my opinion, would be that the batch differences are administration-based – e.g., that batches primarily used for SECOND administrations would have much higher adverse events.

I’m not wed to that thought – but it is an alternative that is every bit as troubling as content differences, and negates the entire strategy of “boosterism”. I also tend to doubt it, both because it does not explain the magnitude of the difference, and is also statistically very unlikely. Content differences just seem more likely to me.


The People Who Found The Toxic Batch Problem

NEXT, I want to deepen the explanation of what Dr. Yeadon was describing. Yeadon provides drug industry credibility to the idea that batch differences are real and almost certainly content-based. They don’t look right to somebody with industry experience.

But NOW we need to explore possible explanations for those differences, based on a closer look at the differences themselves.

SO – next, I want to show you some additional videos and web pages that drill down into the “toxic batch problem”.

We’ll start with the “secondary reporting” and then get to the data itself.

In this video, Stu Peters and Dr. Jane Ruby, who I criticize routinely when they edge toward clickbait, are doing an AMAZING job of reporting on a group of investigators who studied the batch differences. This is excellent journalism. These two can only be as good as their material, but WOW – they have quality material here.


LINK: https://www.brighteon.com/9a45a7a0-e260-4a6c-a251-2b4c139dd211


Now, follow that up with an even deeper examination of the toxic batches.

Jump to 12:50 to continue the discussion. Jane Ruby ends at about 19:00. At 20:00 (to 32:12) it picks back up again with a member of the investigatory group, Team Enigma, who is a pharmaceutical industry bio-statistician. She adds a different perspective on how SMALL any group poisoning the vaccines might be.

This doesn’t require a grand conspiracy of many people. It might involve only a few dedicated and highly skilled saboteurs.


LINK: https://rumble.com/vs59wj-live-hackers-reveal-deadly-jab-lot-numbers-horrific-pfizer-teen-trial-data-.html

Now, let’s look at one of the original presentations of data by Team Enigma.


LINK: https://www.bitchute.com/video/4HlIyBmOEJeY/

Points made in this video:

  • dosages of pharmaceuticals are normally highly controlled
  • consistency and purity are also normally highly controlled
  • COVID vaccines can be readily and correctly compared to flu vaccines
  • flu vaccines are consistent and low in adverse events
  • COVID vaccines are NOT consistent, and vary widely between harmless and highly toxic
  • toxic batches are too wide-spread – problems like refrigeration loss cannot be responsible

Now – here is an EXTREMELY compelling video, which shows in great detail the DIFFERENCE between the “harmless batches” and the “toxic batches”.

LINK: https://www.bitchute.com/video/6xIYPZBkydsu/

Pay special attention to the following ideas:

  • most batches (roughly 80%) are almost completely harmless
  • the bad batches produce up to (and in MANY cases) a thousand times more adverse reactions
  • when viewed geographically in the United States, the bad batches affect every state in America

The latter point proves the generality of the effect – that local differences can’t account for the toxicity of the particular lots. If anything, the high distribution of the batches seems to be used to hide the toxicity.

Next, I want to return you to the PERSONAL REALITY of the toxic batch problem.


A Personal Case of a Bad Batch

It turns out that Dr. Robert Malone got one of the “bad batches” for his second vaccine, and almost died.

Just read here.

LINK: https://rwmalonemd.substack.com/p/how-bad-is-my-batch

ARCHIVE: https://archive.fo/5Q9dx


A Good Review of the Toxic Batch Problem

Lastly, here is a very nice review of work on the toxic batch problem. Very nicely put together, with lots of graphs and key points as quotes. This is a real CONVINCER.

LINK: https://hillmd.substack.com/p/vaccine-batches-vary-in-toxicity

ARCHIVE: https://archive.fo/h0R8Y

Some of the videos in the review have been removed for some reason, but not this one.

This video is truly stunning. This video shows apparent patterns in the deployment of batches. While I am not fully in agreement that this is proven to be the work of the companies themselves, I think that there is overwhelming evidence of “bad batches” and some kind of pattern which looks like the results are being studied.


By the time you’ve gotten here, you very likely think that something is definitely wrong with certain batches.

Next, I want to begin thinking about HOW and WHY somebody might want to do such a thing. In the process, I’m going to “lean into” some current events and statements made by varous people.

This is where things get political, geopolitical, military, and more.


How and Why Would Anybody Poison the West’s Major COVID Vaccines?

This is where we begin to say to ourselves:

Did somebody actually poison various lots of these vaccines? WHO would do it? Who COULD do it? WHY? Why would ANYBODY do this? HOW did they pull it off? WHAT possible benefit could they get from it? WHERE did they do it?

I’m going to leave most of these questions TO YOU ALL.

I want YOU to tell ME.

Now, we have a list of “usual suspects”, but things get interesting when you consider additional motives, additional suspects, and additional opportunities.

MEANS, MOTIVE, and OPPORTUNITY are what turn “conspiracy theories” into CRIMINAL THEORIES.

So I’m going to give you some “kick-starters” to get you seeing some possibilities.

The first thing that got me thinking “HMMMMM……” about things, was when Team Enigma began seeing evidence of coordination between the drug companies, in the chronology of the toxic batches.

As somebody who has been involved with real conspiracies, the idea that drug companies coordinated their plotting to poison the vaccines does NOT sound realistic.

Real conspiracies need compartmentalization. They need as few as possible seeing the big picture.

Thus, it is MUCH more likely, IMO, that there is a SINGLE player who is involved with ALL of the vaccines – a SINGLE player – who would be able to pull off a systematic study of poisoning them.

One such player is the CCP.

BOTH the Pfizer vaccine AND the Moderna vaccine are utterly dependent upon components manufactured in CHINA. Indeed, the “lipid nanoparticle technology” of the mRNA vaccines is pretty much delivered by Chinese companies.

That is how Karen Kingston discovered that components of the “clot shot” vaccines were manufactured by a Chinese company called SINOPEG, which ALSO specializes in something called “PEGylated graphene oxide”, which is further known to temperature-stabilize mRNA vaccines.

I’m not necessarily saying that graphene oxide was used here, although it’s worth considering.


SIDEBAR: For background on graphene oxide (sometimes called graphene hydroxide – it’s the same thing, really), go HERE.

SIDEBAR: For background on the work by Karen Kingston, former Pfizer employee, who figured out the Chinese connection on the lipid nanoparticle components, go HERE.


Moderna executives are also deeply associated with these Chinese companies and their controlling organizations – see photo below. Note what this page (discovered by Karen Kingston) means – you have COVID-19 vaccines, graphene lipid nanotech IN those same vaccines, and pictures of Moderna executives mentioned on the same page.

If this is not a smoking gun, it’s a pretty damn good imitation, suitable for blackmail.

Thus, it sure seemed possible to ME, that if the CCP or PLA wanted to “intervene” in the vaccines, they have MEANS and OPPORTUNITY.

What about MOTIVE?

Well, Deplorable Patriot found something that got me thinking.

So – according to this theory, the US is being blackmailed by the Chinese government.

As soon as I saw this, I realized exactly HOW the ChiComs could have war-gamed this whole thing for some grand-master play.

  • CCP/PLA + Cabal makes Western pharma weak and dependent upon ChiCom manufacturing
  • CCP/PLA has total control of Chinese companies and products they ship
  • CCP/PLA has total control of information within Chinese borders (remember their “rules” which made many SMART companies LEAVE CHINA)
  • CCP/PLA begins manipulating people to make them RUN FROM TRUTH and into CHINESE CONTROL

To me, this makes CHINA a no-brainer suspect. It doesn’t matter WHO is POTUS – Biden or Trump – if the vaccines have problems in the West, CHINA wins.

  • China gets power over the American POTUS
  • China gets power over the American Deep State
  • China gets power over the global pharmaceutical industry

Basically, it’s a form of entrapment.

And remember – if China gets caught and wants to blamecast, they can say “it wasn’t us – it was this rogue company cheating” – and nobody can prove otherwise on anything within Chinese borders.


NOW – there could be other players. China is not the only player who would benefit by making the West stumble here.

WEF, for instance, strikes me as “guilty as sin”. If the vaccines were really safe, they could not stir up as much division as we’re seeing. To me, KlauSS SSchwab and the WEFFEN SS have to be a suspect.

Depopulationists are also an easy target.

Satanists as well. This is their thing.

“FOREIGN” could also be doing things independently of their pet globalists and depopulationists.

Russia, unfortunately, is also an easy suspect, thanks to their stupid antics with Skripal and other spies. If the Russians wanted to keep America WEAK, causing a mess with the vaccines to keep Americans divided would be one way to do it. However, I tend to think that they don’t have as much MEANS and OPPORTUNITY as China. But to be fair, we have to keep Russia on the list.

Similarly Ukraine – to which Democrat operative Alexandra Chalupa seems to have some kind of weird supreme loyalty – because it doesn’t have a perfectly clean history on poisonings, either.

Ukrainian opposition presidential candidate Viktor Yushchenko, with his face disfigured by illness, during an interview with the Associated Press in Kiev, Ukraine, Thursday, Dec. 16, 2004. Yushchenko said Thursday that he is sure he was poisoned by the Ukrainian government, and for the first time pinpointed the time and place of his dioxin poisoning: a Sept. 5 lunch with the head of the Ukrainian security service and his deputy. (AP Photo/Efrem Lukatsky)

And, of course, there is our own DEEP STATE, still led in truth by Barack Obama.

Obama seems really committed to a kind of Stalinist, utilitarian, “death panel” health agenda, where health-care shuffles off people to their graves to save money.

Obama’s famous academic and New York Times-featured “moral advisors” on healthcare have always been, and remain in my opinion, a litany of granny-snuffers. SO – if Obama’s “worst of the worst of the KGB faction in CIA” wanted to begin testing depopper stuff on us – well – they could be up to tricks.

But none of them has as much MMO as China.

All in all, CHINA looks like my main suspect.

They poisoned our dog treats forever, making it look like greedy little companies was the extent of the problem.

We just put up with it.

Maybe they got ideas from that.

WHAT DO YOU THINK, SUSPICIOUS CAT?


So who is your main suspect?

Or do you have a different explanation of the toxicity of the shots – and especially something that explains the weirdly binary toxicity / non-toxicity of the batches?

I’m interested in your thoughts!


Have a Great Weekend

And don’t forget to…..

ENJOY THE SHOW.

W