Dear KMAG: 20230605 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.

(with her beautiful engagement ring!)


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With our dignity intact!

With our dancing shoes on!

And with some LAUGHTER!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

OK

Sorry people, but I heard this here country song today, booming out of a bar, after walking out of a diner, having just eaten the best breakfast in years, and you’re gonna hear this song until you’re sick of it!

DRINKABY

(this version’s for Kalbo!)

WHAT? This song has lyrics? Well, I’ll be! I never noticed! Let’s look at them lyrics!

So how about the official video? Heck – let’s listen to it again!

What the heck! Where’s the beef? DANG! That’s not a video. That a picture!

We’ll have to look at another line dance to make up for the disappointment!

Apparently Korean chicks LOVE this song. There are TONS of videos of Korean gals dancing to “Drinkaby”. So, given that I love ALL CHICKS, and KOREAN CHICKS are a valid subset of ALL CHICKS, we’re gonna watch another one, just to prove I wasn’t lyin’ about it!

Well, shucks. If we can’t find a REAL VIDEO for THAT song, we’ll just grab another Cole Swindell drinking song, and call it good!

Pour another round for the boys, and let’s have a toast to DOUBLE-X, my friends!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wool-Fee’s Weediest Words of the Weak:


malapropism, eggcorn, and mondegreen

nouns

These are very similar and overlapping, and closely related to puns, spoonerisms, Freudian slips, and other linguistic errors, sometimes the source of humor when the error makes sense or pokes fun at an embarrassing truth.

  • malapropism: the act of using an incorrect word in place of one that is similar in pronunciation.
  • eggcorn: a mis-heard word that is not nonsensical, but remains sensible and even same-meaning in context.
  • mondegreen: a mis-heard phrase, in song lyrics or poetry, which is typically nonsensical.

Examples of malapropism (courtesy of Archie Bunker)

  • “Last will and tentacle…”
  • “Patience is a virgin.” (virtue)
  • “A menstrual show.” (minstrel)
  • “Buy one of them battery operated transvestite radios.”
  • “A woman doctor is only good for women’s problems…like your groinocology.”
  • “I ain’t a man of carnival instinctuals like you.”
  • “Irene Lorenzo, Queen of the Women’s Lubrication Movement.”
  • “In her elastic stockings, next to her very close veins.”
  • “In closing, I’d like to say Molotov!” (Mazel Tov)

Examples of eggcorns

  • afeared (afraid)
  • agreeance (in agreement; accept the terms; could be a combination of agreement and acceptance)
  • centerpede (centipede)
  • conscious (conscience)
  • eardrop (eavesdrop)
  • eavesdripping (eavesdropping)
  • eggcorn (acorn)
  • expresso (espresso)
  • ex-patriot (expatriate)
  • gambit (gamut)
  • leper (leopard)
  • nougat (nugget)
  • overhauls (overalls)
  • parody (parity)
  • prospective (perspective)
  • pylon (pile on)
  • relative (relevant)
  • spur (spurt)
  • saleing (selling)
  • tellyphone (telephone)
  • tellyprompter (teleprompter)
  • tellyvision (television)
  • topsy (top seed)
  • upmost (utmost)
  • wonderlust (wanderlust)
  • ringer (wringer)
  • ad homonym (ad hominem)
  • bad wrap (bad rap)
  • ban together (band together)
  • bare witness (bear witness)
  • bean stock (beanstalk)
  • beckon call (beck and call)
  • Cadillac converter (catalytic converter)
  • chester drawers (chest of drawers)
  • collaborating evidence (corroborating evidence)
  • could of (could have)
  • dead wringer (dead ringer)
  • deep seeded (deep-seated)
  • doggy dog (dog eat dog)
  • feeble position (fetal position)
  • flesh out (flesh out)
  • free rain (free rein)
  • hysterical society (historical society)
  • ice team (iced tea)
  • jerry rig (jury rig)
  • junk start (jumpstart)
  • laughing stalk (laughingstock)
  • must of (must have)
  • mute point (moot point)
  • nerve wrecking (nerve-racking)
  • pass mustard (pass muster)
  • all for not (all for naught)
  • all intensive purposes (all intents and purposes)
  • can’t make heads or tales of it (can’t make heads or tails of it)
  • cease and decease (cease and desist)
  • chock it up (chalk it up)
  • coming down the pipe (coming down the pike)
  • curve my appetite (curb my appetite)
  • cut to the cheese (cut to the chase)
  • don’t get your dandruff up (don’t get your dander up)
  • fair to midland (fair to middling)
  • far be it to me (far be it from me)
  • flaw in the ointment (fly in the ointment)
  • from here on end (from here on in)
  • get it down packed (get it down pat)
  • give up the goat (give up the ghost)
  • Holland day sauce (hollandaise sauce)
  • in cohorts with (in cahoots with)
  • in one fowl swoop (in one fell swoop)
  • much to do about nothing (much ado about nothing)
  • old wise tale (old wives’ tale)
  • peaked my interest (piqued my interest)
  • put the pedal to the medal (put the pedal to the metal)
  • rot iron fence (wrought iron fence)
  • safety deposit box (safe deposit box)
  • straight and arrow (straight and narrow)

Examples of mondegreen:

  • Africa – When Toto’s lead singer croons, “bless the rains down in Africa,” some listeners mistake the first few words for left my brains.
  • Away in a Manger – Even Christmas songs aren’t immune to mondegreen. Instead of hearing “the cattle are lowing,” some people incorrectly understand the lyric to say that they’re lonely.
  • Blowin’ in the Wind  Bob Dylan advises listeners, “the answer my friends, is blowin’ in the wind,” but not everyone hears it that way. Some perceive the first part of that line as saying the ants are my friends.
  • Bohemian Rhapsody – While this Queen song does have some nonsense words, the tune doesn’t actually reference saving someone from warm sausage tea. Instead, Freddie Mercury sings “… spare him his life from this monstrosity,” with a strong emphasis on each syllable.
  • Brass in Pocket – The Pretenders tell listeners, “I’m gonna use my sidestep,” but not everyone hears the last word correctly. Some think they’re saying sausage instead of sidestep.
  • Dancing Queen – Abba says to “feel the beat from the tambourine,” though some listeners insist the singer croons the word tangerine instead.
  • Every Time You Go Away – People who hear meat instead of me when Paul Young sings “you take away a piece of me with you” must think the singer’s freezer is being robbed.
  • Happy – When Pharell sings “happiness is the truth,” some people think he’s actually saying that “happiness is the zoo.”
  • High on You – The words of this Survivor song reference “piercin’ eyes like a raven,” though listeners often mishear the song as saying glistening eyes.
  • I‘m a Believer – After the Monkees croon, “then I saw her face, now” some think they follow up with “I’m gonna leave her.” What they really say, though, is “I’m a believer.”
  • Livin on a Prayer – Contrary to popular belief, Bon Jovi doesn’t suggest nudity in this song. Some mishear the last part of “it doesn’t really matter if we make it or not” as saying naked or not.
  • Losing My Religion – R.E.M. croons, “That’s me in the corner. That’s me in the spotlight.” Many listeners mistake the word “me” for pee in both of these sentences.
  • Money for Nothing – Listeners often think this Dire Straits song references free chips, when the lyrics actually reference “money for nothing and your chicks for free.”
  • Our Lips are Sealed – The Go-Gos sing about “the jealous games people play,” but some people hear Dallas instead of jealous.
  • Smells Like Teen Spirit – In this Nirvana song, Kurt Cobain sings, “here we are now, entertain us,” though some people interpret the last two words as in containers.
  • Suspicious Minds – Elvis Presly croons, “we’re caught in a trap,” but some listeners seem to think the last word is actually trout.
  • Drift Away – When Uncle Kracker sings, “Give me the beat boys and free my soul,” it sounds a bit like he’s saying Beach Boys.
  • Waterfalls – In this song, TLC advises readers, “don’t go chasing waterfalls.” though some readers think they’re trying to keep someone named Jason Waterfalls from leaving.
  • We Found Love – When Rhianna sings “what it takes to come alive,” some listeners mishear the end of the line as form a line instead of “come alive.”
  • Rocket Man – The Elton John line “burning out his fuse up here alone” has been misheard many ways, including running out of fuel and heading home and burning up the trees on every lawn. Volkswagen even used this mondegreen in a commercial.

Mondegreen in a video

Malapropism via Text-to-Speech or Auto-Correct Eggcorn

“I had no idea what the butchers do to the trance people.”


ENJOY THE SHOW

Have a great week!

W

Dear KMAG: 20230529 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With or without zombies!

Get your dancing shoes on!

And hang on for some TRUMP GRAVITY!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – a quick, 3-minute version of the end theme from Gladiator, including dialog. I posted this earlier in a reply to Tradebait on his latest BMID. I consider Gladiator a very symbolic movie, which has a lot to say about Christianity, but very subtly, and mixed well into everything else.

If you liked that, an extended version, starting earlier, with the movie showing in the background!

How about something YouTube suggested? From the EP “Luna”, by Tony Anderson, a title called “Eternal Spring”. The visuals are really something!

And now – some fine country music just for today!

Finally, some music to go with our featured image “fantasy tree”!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

WARNING – many of you need to skip this.

But no child should be condemned to this.

TWEET: https://twitter.com/MalesInDisguise/status/1662935393338118150

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


equity

noun

  • the state or quality of being just and fair.
  • something that is just and fair.
  • sustice achieved not simply according to the strict letter of the law but in accordance with principles of substantial justice and the unique facts of the case.
  • the amount of money that would be returned to a company’s shareholders if all of the assets were liquidated and all of the company’s debt was paid off in the case of liquidation.
  • the value of company sales minus any liabilities owed by the company not transferred with the sale.
  • the book value of a company.
  • payment-in-kind.
  • the pro-rata ownership of a company’s shares.

Wolf’s additional definitions:

  • how tyrants and criminals violate both the letter and spirit of the law, in the name of “fairness” and “justice”, while tipping the scales to favor themselves, their friends, and their fellow criminals.
  • injustice under the color of justice, ironically often done for the sake of “color”.
  • a redundancy, in that “equitable justice” really means “just justice”, meaning je ne sais quoi justice, or seat-of-the-robe justice.
  • justice by feeling and not by law.
  • an admission that the law is not working, so “fuck the law – we’ll just do what we like.”
  • a legal kludge, which is easily abused, where judicial algorithms break down, and people resort to flimsy neural net solutions, typically with strongly biased inputs.

Wikipedia definition (financial):

In finance, equity is an ownership interest in property that may be offset by debts or other liabilities. Equity is measured for accounting purposes by subtracting liabilities from the value of the assets owned. For example, if someone owns a car worth $24,000 and owes $10,000 on the loan used to buy the car, the difference of $14,000 is equity. Equity can apply to a single asset, such as a car or house, or to an entire business. A business that needs to start up or expand its operations can sell its equity in order to raise cash that does not have to be repaid on a set schedule.

When liabilities attached to an asset exceed its value, the difference is called a deficit and the asset is informally said to be “underwater” or “upside-down”. In government finance or other non-profit settings, equity is known as “net position” or “net assets”.

Investopedia definition:

Wikipedia definition (legal):

Equity is a particular body of law that was developed in the English Court of Chancery.[1] Its general purpose is to provide a remedy for situations where the law is not flexible enough for the usual court system to deliver a fair resolution to a case.[2] The concept of equity is deeply intertwined with its historical origins in the common law system used in England.[2] However, equity is in some ways a separate system from common law: it has its own established rules and principles, and was historically administered by separate courts, called “courts of equity” or “courts of chancery”.[2]

Equity exists in domestic law, both in civil law and in common law systems, and in international law.[1] The tradition of equity begins in antiquity with the writings of Aristotle (epieikeia) and with Roman law (aequitas).[1][3] Later, in civil law systems, equity was integrated in the legal rules, while in common law systems it became an independent body of law.[1]

Used in a Sentence:

“Climate equity is the goal of recognizing and addressing the unequal burdens made worse by climate change, while ensuring that all people share the benefits of climate protection efforts. Achieving equity means that all people—regardless of their race, color, gender, age, sexuality, national origin, ability, or income—live in safe, healthy, fair communities.” -US EPA


ENJOY THE SHOW

Have a great week!

W

Dear KMAG: 20230522 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

NO problem! Errrr. Problems. Whatevah!

We’re gonna have a GOOD time!

But ya bettah HOLD ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – some epic piano….. dubstep?

OK – I’m feeling something, and I need some Tom Petty. This one!

Now, in honor of the BRANCH COVIDIANS just waiting to come back with their mandates…..

And finally – what the heck – ONE MORE TIME! (*wink*)


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Community Notes FOR THE WIN!!!

https://twitter.com/StilettoDave/status/1659722374105927680

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


supermajority

noun

  • a majority (such as two-thirds or three-fifths) greater than a simple majority.
  • a majority that must represent some percentage more than a simple majority.
  • a requirement for a proposal to gain a specified level or type of support which exceeds a simple majority in order to have effect.
  • a vote that must exceed the number of votes comprising a simple majority.
  • also called a qualified majority

Wikipedia definition:

A supermajority, is a requirement for a proposal to gain a specified level of support which is greater than the threshold of more than one-half used for a simple majority. Supermajority rules in a democracy can help to prevent a majority from eroding fundamental rights of a minority, but they can also hamper efforts to respond to problems and encourage corrupt compromises at times when action is taken.

Used in a Sentence:

  • Representative Tricia Cotham switched parties, giving NC Republicans the supermajority they need to override any veto by Gov. Roy Cooper.
  • Tennessee is one of an increasing number of states (19 Republican, nine Democratic) where one party has a “supermajority,” such a lopsided advantage that it can override a governor’s veto without relying on votes from the other party.
  • For the first time in nearly a half century, there is a six-justice conservative supermajority on the U.S. Supreme Court — six justices with clearly expressed views against abortion rights.

An Upcoming Vote for Supermajority Protection of the Ohio Constitution From George Soros and his Minions:


ENJOY THE SHOW

Have another great week!

W

Dear KMAG: 20230515 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

So shine your light for all to see (or feel, as appropriate)…..

Put on your dancing shoes…..

And prepare for the ride of your life!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – in “epic music”……

Now – remember my favorite country mash-up?

Well, the author did his own composition from the mashup. Enjoy!

And what the heck – YouTube suggested my last song again!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://twitter.com/Lupublicoutcry/status/1657891066161537025

We can give in to despair…or we can be defiant and fight back in any way that we can.

https://twitter.com/KarliBonnita/status/1657795648924647425

And this is the best bust of the phony phed Patriot Front yet, as an Alinsky operation which even has globalist and Demmunist backing.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


thine

pronoun or adjective

  • yours (old fashioned and literary)
  • used to indicate the one or ones belonging to thee.
  • singular second person possessive pronoun.
  • the possessive case of thou1 used as a predicate adjective, after a noun or without a noun.
  • the possessive case of thou1 used as an attributive adjective before a noun beginning with a vowel or vowel sound: thine eyes; thine honor. Compare thy.
  • that which belongs to thee.

Used in a Sentence:

  • Thine is the power and the glory.
  • May God’s blessings be thine.
  • “Give every man thine ear, but few thy voice…” [Shakespeare, Hamlet (1600)]

Used in a Star Trek NG Episode Title:


ENJOY THE SHOW

Have another great week!

W

Dear KMAG: 20230508 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

Dealing with any obstacles in an appropriate manner…..

Enjoying the benefits of the occasional Trump rally…..

And experiencing some amazing “Trump Gravity”!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

First, an old Wheatie favorite as you’ve never seen it before!

Aw, heck – let’s have some more of that stuff!

OK, but now you’re getting more country. Specifically, stuff I never heard before.

The WHY on that comes later.

And now I get you in the mood for our next section.


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


rhochrematics

extremely obscure noun

  • science of inventory management and the movement of products
  • science of how materials and information flow from the raw state though manufacturing, inventory management, marketing, and distribution

Used in a Sentence:

  • It’s hard to believe that genocide through rhochrematics is possible, but yet here we are.
  • Satan weaponizes everything – even rhochrematics.

Featured in a picture:


ENJOY THE SHOW

Have another great week!

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230501 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

CLEVELAND, OH – JULY 18: Melania Trump kisses her husband and Presumptive Republican presidential nominee Donald Trump, after delivering a speech on the first day of the Republican National Convention on July 18, 2016 at the Quicken Loans Arena in Cleveland, Ohio. An estimated 50,000 people are expected in Cleveland, including hundreds of protesters and members of the media. The four-day Republican National Convention kicks off on July 18. (Photo by Chip Somodevilla/Getty Images)

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

Pardon any housekeeping that may be necessary….

We’re gonna have some fun!

HOLD ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Looks like y’all ‘r’ gittin’ s’more country. Even if it’s a re-peat.

Suck it up, tip your hats, and DANCE!

But YouTube thinks we need a “Wheatie song”, and I ain’t one to disagree!

And now – something actually good out of Portland, recently.

AW, heck – one more country song!

https://youtu.be/yLmHb3CAKZU

(Butcha cain’t watch it here!)


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://www.foxnews.com/opinion/hunter-bidens-twisted-attempts-keep-little-girl-using-name-new-realm
https://conservativebrief.com/they-fear-72919/

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


eponymous

trendy adjective

  • a person or thing after which something is named (such as an inventor, discoverer, creator, or founder) – OR IN REVERSE…..
  • the thing itself that has been named after someone or something
  • character in a play, book, etc. has the same name as the title
  • an adjective, place name, or other thing which comes from the name of a person
  • of, relating to, or constituting an eponym

Used in a Sentence:

  • Victorian, Wagnerian, and dickensian are all examples of eponymous adjectives.
  • An eponymous character in a play, book, etc. has the same name as the title.
  • Tucker Carlson’s eponymous nightly show debuted in November 2016.

Use for the eponymous “Holderama”:


ENJOY THE SHOW

Have another great week!

W

Dear KMAG: 20230424 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

In WHEATIE style!

With our dancing shoes on!

And possibly with a little excitement!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Here is the Country Music top 40, selected by the Fibonacci sequence.

Let’s see what this gives us.

0, 1, 1, 2, 3, 5, 8, 13, 21, 34

So what in the heck is “zero” on the country music top 40?

I’m going with an old favorite of mine from almost 30 years ago, which now gets approximately ZERO plays on the radio. Last I heard this one was probably 10 or 15 years ago.

0.

1.

1.

2.

3.

5.

8.

13.

21.

34.

LINK: https://mytuner-radio.com/top-charts/united-states/country-music

ARCHIVE: https://archive.fo/fE1Kj


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://twitter.com/ClownWorld_/status/1650309304833163265

We can give in to despair…or we can be defiant and fight back in any way that we can.

(WAIT FOR IT…..)

NOTE – this “fake news” is from a satire site, and the replies to Larry Elder are filled with correcting leftists trying to comfort themselves by the parody having fooled the stupid, gullible right.

However, Bud Light’s fall on this drama has been so epic that the story is damn near “Not The Bee”, if not half-way true. Industry embarrassment is quite real, and satire is a fig leaf on this LOSER of a cause. The sheer truth of industry embarrassment makes this parody a glorious backfire, IMO, and evidence of the left’s nakedness on the issue.

Sometimes the left simply shouldn’t go there. But they do, and we’re there to greet them.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


disabuse

transitive verb

  • To free from a falsehood or misconception.
  • To set free from mistakes; to undeceive; to disengage from fallacy or deception; to set right; — often used with “of”.
  • To cause someone no longer to have a wrong idea.
  • To set free from a mistake; to disentangle from a fallacy; to set right; to undeceive.

Used in a Sentence:

If you think that Eric Holder has given up on Obama’s dream of turning this country into a communist hell-hole, please let me disabuse you of that notion.

Visualized as People Seeing the Truth:


ENJOY THE SHOW

Have another great week!

W

More Shady Globalist Games Against Honest “HCQ” Scientist Didier Raoult

I just wanted to document two things for the record, while I had the evidence in hand, before the “usual suspects” (Twitter, Google, etc.) cover it all up.

First – the “scientific misconduct” attack.

Second – the “big tech malign error” attack.


Assault With a Bik’s Pen

This is an interesting story about my encounter with some kind of “Act Blue” but “Fake Red” pharma-defending propagandist who alerted me to something I had not been aware of – that the scientific establishment has tried to attack HCQ researcher Didier Raoult by abusing a kind of scientific fraud-hunter named Elisabeth Bik.

Follow this conversation and you will learn the details.

It started with somebody publishing details about the attack on a dissident “Ivermectin doc” who I follow on Twitter.


As I was reading the thread, I noticed the following reply by what appeared to be a critic.

This tweet cites a study by the University of Kansas Medical Center, claiming that ivermectin has no effect. THAT is a whole ‘nuther topic, which is very interesting, and which implicated KUMC (not to be confused with UMKC) as engaging in woke politicized science, but set that aside for now.

Here was one nice response to the attack.

There ARE indeed some big criticisms of that study – I believe that Pierre Kory had some of them – but set that issue aside. Watch a PHARMA RAT rush in, as soon as I say something which besmirches their money-maker remdesivir.

My comment:

Watch how the pharma rat starts off, trying to retain credibility, before he reveals his true nature.

I mean, what the hell! The problems of remdesivir are very well documented, and I read about the organ failure MYSELF – not only the original failures in the Ebola trials, but massive kidney failure problems during COVID treatment. I read the (per Fauci) key paper myself, including the data section, and was shocked at how blithely Fauci had written off multiple kidney failures in the TREATED group, well above any occurring in the placebo group. NASTY!!!

This PhillyPharmaBoy either doesn’t know what he’s talking about, or he’s lying. But I remained nice.

Here was my response.

This is where the guy was fully baited out.

What the FUCK! “That comparison cannot be made”? A drug with a kidney failure problem in one disease can’t be compared to the same drug having a kidney failure problem with a similar disease of the same basic type? LOL!

But WHAT THE HELL!

“Oh, and Raoult is under criminal investigation for massive long-term fraud, including his hydroxychloroquine studies.”

That was the first I had heard about any “investigation” of Raoult.

My “foxhole buddy” on Twitter responded immediately.

I then did some quick research, and realized that these science progs were pulling a “Peekaboo James” attack investigation on Raoult! NASTY!!! Communist, fascist, progressive SWINE!

My buddy of the moment called her a straight-up fraud, but IMO this Bik lady is a victim, too – basically an autistic, woke “error-hunter”, much like the “plagiarism-hunters” who look for places where people have gotten lazy on citations, and are vulnerable like ALL academics are, with enough spotlight and draconian-enough standards.

Bik was used to go after Raoult, and she will pay the price of the Trump Curse.

Escape Key’s response was even more enlightening.

Pretty quickly, PhillyPharmaBoy learned not to mess with Escape Key!

Meanwhile, PhillyPharmaBoy kept up the attack on Raoult, but I wasn’t buying it.

I checked this out. It was a horrible pile-on of woke bullshitters, exactly like what all those lying NAT-SEC fascists did to Trump, for which 50-60 LIARS need to not only lose their security clearances, but in my opinion, go to prison as well, for abusing their credentials.

I do hope that also happens to these attackers of Raoult, with their precious “Expressions of Concern”!

That was it. PhillyPharmaBoy was done with us. NO SALE.


SO – this was where I first learned about the “Bik” attack on Raoult.

My question now – what is the status of the situation?

I can find NOTHING in the English-speaking world about this. No further information, other than moans of sympathy for Bik, that mean old Raoult SUED her for attacking him.

It LOOKS like there is no news that serves the narrative, so nobody is talking about the confrontation. It LOOKS like Didier Raoult must be winning.

I needed to get into the French side of the web, if I was going to find anything.

And THAT is when I went looking for any word on the situation in Raoult’s Twitter account.

The guy writes almost entirely in French, and nobody comments on his timeline in anything but French, but we have Google Translate – R-I-I-I-I-I-G-H-T???


Google Mistranslate

This was cute, and is very typical of the kinds of “knives in the back” which can be done with “bad I.T.” while being passed off as an error, accident, or other plausibly deniable non-human problem. And, of course, if A.I. is responsible for this lie, then the situation is even worse, but I’m not ready to help them pass the blame to Rogue Woke A.I.

In looking for any – ANY – news about Didier Raoult’s lawsuit against Elisabeth Bik, I went to Raoult’s Twitter account, and began scanning down below his top, pinned Tweet, which was a kind homage to the director of his institute, who appears to be resigning. Hopefully she is not being forced into resignation, but who knows – things are bad right now, in Globonazi France, and I can imagine that there is yet another attempt to “take care of” Raoult before the next phony pandemic can take place.

Take out a friendly or honest director, and put an opponent or rat fink in place. Oldest trick in the book.

Anyway, I noticed this tweet:

This is followed by two more tweets in a short thread.

Now, I want you to follow what happened to me here.

I translated the first tweet using Google via Twitter, and this is what I got.

For the benefit of those who can’t see tweets, the text plus translation is as follows, with the shocking mistranslation in BOLD:


Didier Raoult

@raoult_didier

Notre étude sur la baisse de la charge virale par le traitement par hydroxychloroquine dans le covid est en ligne et confirme notre première étude.Nous avons fait valider les données de la première par huissier montrant que l’émission”Complément d’ enquête” utilisait des faux.

Translated from French by [Google]

Our study on the drop in viral load by treatment with hydroxychloroquine in covid is online and confirms our first study. used fakes.


912K Views
7,261 Retweets
329 Quotes
16.3K Likes
223 Bookmarks


What the FAAAAAHCK!

There is no chance that this perfectly reversing bad translation is an accident. This is deliberate sabotage under the color of a program error.

The mistranslation is easily removed/prevented by adding the missing space in “étude.Nous”, which results in (using Google Translate):


Our study on the drop in viral load by treatment with hydroxychloroquine in covid is online and confirms our first study. We had the data from the premiere validated by a bailiff showing that the ”Complément d’Enquête” program was using fakes.


Sneaky.

For completeness and durability of my evidence, screen captures:

Missing Space:

Added Space:

I alerted Raoult to this very nasty jab by the Nasty Jabbists:

For the visually impaired or deprived, my tweets, including the Google translations:


S’il vous plaît, remarquez comment à cause d’un espace manquant, Google traduit “par erreur” ce tweet en un terrible aveu de fraude! [Please notice how due to a missing space, Google “erroneously” translates this tweet into a terrible admission of fraud!]

“Our study on the drop in viral load by treatment with hydroxychloroquine in covid is online and confirms our first study. used fakes.”

Ajout d’un espace (étude. Nous): [Addition of a space …]

Our study on the drop in viral load by treatment with hydroxychloroquine in covid is online and confirms our first study. We had the data from the premiere validated by a bailiff showing that the ”Complément d’Enquête” program was using fakes.


It’s also worth looking at the other tweets in the thread, and their translations.

The second tweet simply says “Reference” and provides a link to this article.

Let’s take a look.

LINK: https://www.authorea.com/users/410460/articles/631056-viral-clearance-in-patients-with-covid-19-associated-factors-and-the-role-of-antiviral-treatment?commit=7d50f31134522715e379b80343bc2fe7451aa0c8

Again, for the visually impaired and deprived:

Viral clearance in patients with COVID-19: associated factors and the role of antiviral treatment

ANTIVIRAL AGENTS
CORONAVIRUS
COVID-19
EPIDEMIOLOGY
VIRAL EXCRETION
VIRUS CLASSIFICATION

  • Philippe Brouqui,
  • Jean-Christophe Lagier,
  • P. Parola,
  • M. Million,
  • S. Cortaredona,
  • Léa DELORME,
  • Philippe Colson,
  • Didier Raoult

Abstract

The role of hydroxychloroquine (HCQ) in lowering the viral load of patients with COVID-19 is controversial. In our Institute, we treated more than 30,000 people with COVID-19 in 2020 and 2021, using the same diagnostic tools and the same treatment dosages. In this retrospective comparative study of data collected over this period, we aimed to compare the viral clearance in the nasopharynx as determined by qPCR in patients who were treated with HCQ and those who were not. As a new feature, we adjusted the data according to the most significant confounding factors (age, initial viral load, and timescale between the onset of symptoms and treatment). Of the 1 276 patients selected from our database, 776 were treated with HCQ and 500 were not. Viral clearance in the treatment group was reached significantly earlier than in the non-treatment group, at days 5, 10 and 30. These differences remain significant after adjustments for confounding factors. In conclusion, although age, initial viral load, and time to treatment do influence the viral load in patients with COVID-19, hydroxychloroquine associated with azithromycin still independently significantly lowered viral load more rapidly than other treatments, including azithromycin alone.

Peer review status: UNDER REVIEW

22 Mar 2023
Submitted to Journal of Medical Virology 

Show details

27 Mar 2023 Reviewer(s) Assigned

Cite as: Philippe Brouqui, Jean-Christophe Lagier, P. Parola, et al. Viral clearance in patients with COVID-19: associated factors and the role of antiviral treatment. Authorea. March 22, 2023.
DOI: 10.22541/au.167948825.59270994/v1


The translation of the third tweet is the best.



Again, as text:


” Ce qui me bouleverse ce n’ est pas que tu m’ aies menti, c’ est que je ne pourrai plus te croire” Nietzsche

Translated from French by [Google]

“What upsets me is not that you lied to me, it’s that I won’t be able to believe you anymore” Nietzsche


SO – the bottom line is simple.

The other side is NOT giving up.

They lie, they cheat, and they attack good men by scurrilous means.

They sacrifice their own in the process.

The Trump Curse is real, and the WOKE are BROKEN when they attack the good and the true.

And when we stand up for what is right, we WIN in the end.

STAY THE COURSE. TO VICTORY!

W

Dear KMAG: 20230417 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


Welcome to this QTH OF APRIL Open Thread!


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

Swingingly!

Happily!

Laughingly!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Never talk about committing violence in a reply to Wolf or in response to anything Wolf has said, or you may get put into moderation so that your comments can be screened. This is ONLY because DHS is now playing door-knock Gestapo with people who have spoken at school board meetings, made public comments, etc. DHS regime jackboots are knocking on doors of school board mama bears and stupidly insinuating potential violence from things people say or don’t say on social media. A guy in Ohio pointed his FINGER at the school board, and they went after him, armed with pictures of the pointing, and screen captures of online comments. Yeah.

SO – give the Nazis ZERO ammo. Keep any mention of violence, even joking, away from Wolf, so that he doesn’t have to “explain” humor to humorless jackboots who pretend not to know things.

As for discussion of “violent humor” among yourselves (e.g., “#TeamHeadsOnPikes”), just use whatever discretion you think is appropriate for yourselves. I will only put you in moderation if your comments create problems for ME or THIS SITE, but not if they only impact you.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Heard this one on the radio – nice!

As somebody said in comments, one of the bright spots of the 2023 CMT Awards.

https://youtu.be/BpvlknhpGxU

CMT? That’s worth some multiple TIME WARP…… 2008!

But now let’s turn the time machine up to 10…..

….and maybe even ELEVENTY!!!

https://youtu.be/urONLg-9LEk

Whatever! The guy is still putting out some great country!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://twitter.com/Sanfedisti1/status/1647383919975645187

We can give in to despair…or we can be defiant and fight back in any way that we can.

Sometimes you have to look at the big picture…..

Sometimes you just have to keep pushing…..

Sometimes you just have to dig deep…..

And sometimes you just have to laugh!

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


desolation

noun

  • an act or instance of destroying or devastating land, population, community, etc.
  • the state of being destroyed or devastated, as land, population, community, etc.
  • dreariness; barrenness.
  • deprivation of companionship; loneliness.
  • sorrow; grief; woe.
  • desolate place.

Used in a Sentence:

  • The war’s desolation of the land destroyed years of hard and hopeful work.
  • The utter desolation of the Western Front was captured in unforgettable photographs.
  • The poet fashions a mood of desolation and despair in his works.
  • Some homesteaders could not endure the desolation of life on the prairie, and returned to the city.
  • She was so deep in her desolation, we don’t know if our words of comfort reached her.
  • The town was once a desolation.

Used in the Bible:

The Abomination of Desolation
(Matthew 24:15–25Luke 21:20–24)

14So when you see the abomination of desolationa standing where it should not beb (let the reader understand), then let those who are in Judea flee to the mountains. 15Let no one on the housetop go back inside to retrieve anything from his house. 16And let no one in the field return for his cloak.

17How miserable those days will be for pregnant and nursing mothers! 18Pray that this will not occur in the winter. 19For those will be days of tribulation unmatched from the beginning of God’s creation until now, and never to be seen again. 20If the Lord had not cut short those days, nobody would be saved. But for the sake of the elect, whom He has chosen, He has cut them short.

21At that time if anyone says to you, ‘Look, here is the Christ!’ or ‘There He is!’ do not believe it. 22For false Christs and false prophets will appear and perform signs and wonders that would deceive even the elect, if that were possible. 23So be on your guard; I have told you everything in advance.

LINK: https://biblehub.com/bsb/mark/13.htm

LINK: https://www.thegospelcoalition.org/article/what-is-the-abomination-of-desolation/

Safe Viewer for the Desolation of Obama Nation


ENJOY THE SHOW

Have another great week!

W


“A long, long time ago in a blog far, far away…..”

And just for the heck of it…..