Dear MAGA: 20250522 ✾ Thank God ± Theistic Evolution ∈ Thursday Open Topic | Moar AI Spam | Mutually Acceptable Lies About The Clot Shot


This man, making Christmas calls from the White House, believes the world is a sphere. And he has even flown around it! So has our beautiful FLOTUS, who happens to be his wife!

Truth and common sense must be valued by us, as individuals, in order to lastingly disempower the authoritarian fake news media. This includes the perniciously smarmy science media, which never answers for its errors and lies. I believe that the media has been responsible not only for leftist pathologies like scientism, medical fascism, and radical gender ideology, but also for reactionary movements like modern flat Earth, rejection of all medicine, and Biblical geological literalism.


Just as Wheatie’s Stormwatch Monday Open Thread was created as a place for people to openly express their thoughts and opinions, so, too, is this Thank God Thursday Open Thread, where honest but civil discussion of all topics is encouraged. This thread is also to be known as Theistic Evolution Thursdays, due to the author’s expected “pontification” about his scientific, religious, and political opinions. You are welcome to pontificate back! Free speech matters!

Please label all AI-generated content as being such, unless it is patently obvious (e.g., humorous AI images). It is important that we as individuals not begin to pretend that socially derived artificial intelligence is actually our own, as this form of stealthy social information averaging and feedback would be one more pretense and deception between people, in service of stupid Marxist socialism, and of those who wish to substitute their communally protected lies for actual truth.

The source of alleged truth matters, not for the truth itself, but for validation.

And yes, it’s THURSDAY…again.

And that’s it. We’re done stealing from Wheatie.

OK – maybe her rules need to be posted.

  • No food fights.
  • No running with scissors.
  • If you bring snacks, bring enough for everyone.

Other rules may be derivable from these, and that conjecture is left for discussion.


If there is nothing beyond the “W” below, then this is a placeholder. For health reasons, I can’t always post a timely opinion before each Thursday, but I will try. Otherwise, you have this placeholder post, where YOU provide the content. Enjoy!

W


Moar AI Spam

AI is assisting with the proliferation of bullshit, because it puts fairly smart white lies in the hands of fairly dumb people who need them.

Example? This bit of engineered bullshit, either actual spam, or IC AI bullshit disguised as spam, trying to get on this site.

Note – I included Cuppa Covfefe’s last comment on the Open – A REAL COMMENT – for context. That comment was made roughly 4 1/2 years ago.

For those with low vision, the text of the spam post:

‘This Sanctuary Sunday Open Thread’ beautifully fosters unity, faith, and respectful dialogue. I appreciate the emphasis on civility, truth, and open discussion. A great reminder of how meaningful and peaceful conversations can shape a strong, thoughtful community.

I’ll be frank – that’s a nice comment. I won’t say why it’s obviously an AI comment, because I don’t reveal tells of that nature – but for those and other very definitive reasons, I can assure you that it’s an AI comment.

Now, let’s compare that with the following first few paragraphs of Carl’s post, which were analyzed and turned into that AI response.

In the original post, both “Sanctuary Sunday Open Thread” and “Please show respect and consideration” were bolded, and it’s clear that the AI noted this, by putting single quotes around those first four words, which were played back. In the sample from Carl’s post, below, I am bolding almost all of the things on which the AI appeared to be focused.

This Sanctuary Sunday Open Thread, with full respect to those who worship God on the Sabbath, is a place to reaffirm our worship of our Creator, our Father, our King Eternal.

It is also a place to read, post and discuss news that is worth knowing and sharing. Please post links to any news stories that you use as sources or quote from.

In the QTree, we’re a friendly and civil lot. We encourage free speech and the open exchange and civil discussion of different ideas. Topics aren’t constrained, and sound logic is highly encouraged, all built on a solid foundation of truth and established facts.

We have a policy of mutual respect, shown by civility. Civility encourages discussions, promotes objectivity and rational thought in discourse, and camaraderie in the participants – characteristics we strive toward in our Q Tree community.

Please show respect and consideration for our fellow QTreepers. Before hitting the “post” button, please proofread your post and make sure you’re addressing the issue only, and not trying to confront the poster. Keep to the topic – avoid “you” and “your”. Here in The Q Tree, personal attacks, name calling, ridicule, insults, baiting and other conduct for which a penalty flag would be thrown are VERBOTEN.

In The Q Tree, we’re compatriots, sitting around the campfire, roasting hot dogs, making s’mores and discussing, agreeing, and disagreeing about whatever interests us. This board will remain a home for those who seek respectful conversations.

Please also consider the Guidelines for posting and discussion , outlined here https://wqth.wordpress.com/2019/01/01/dear-maga-open-topic-20190101/

Let’s not give the Internet Censors a reason to shut down this intellectual haven that Wolf has created for us.

Note that the word “faith” was not there – it was generated by the AI. The only place “faith” appeared in Carl’s entire post was 12 times in a large paragraph way down in the body of the post. If you want to check it out…..

LINK: https://www.theqtree.com/2020/12/27/dear-kmag-20201227-open-topic/

Thus, the mere mention of “worship” at the beginning, and the entire context of the body of Carl’s post, were likely the origin of “faith” in the AI comment.

Meaningful” and “peaceful” are also derived from the larger context. Those words are not present, although “peace” appears 5 times in the body of the message from Carl.

I want you all to understand that the AI is basically doing what high school students and college students are trained to do, in writing a reply letter, answering essay questions, or otherwise composing written material based on some source, without plagiarizing. It’s reading, grabbing concepts, mixing things up, generalizing about what is observed, then composing a restatement which comes very close to what was originally said, from a reader perspective, without “aping” the original, which is both cringeworthy and considered plagiarism.

AI is pleasing its trainers, just like students try to please their trainers teachers.

This is why AI is being used by students to pass exams.

Andrew Torba has a masterful post about this, which you all really need to read. He predicts that universities themselves, as we know them, are about to be on life support, because of AI.

After reading Torba’s post, I realize that Harvard is falling apart for multiple reasons. IMO, woke does not have the honesty needed to deal with AI, or anything else, for that matter.


TORBA…..

LINK: https://news.gab.ai/ai-is-flipping-education-and-work-on-its-head

ARCHIVE: https://archive.fo/vIvHH

By Andrew Torba in AI — 15 May 2025

AI Is Flipping Education and Work On Its Head

Over the next 15 years, universities will face existential pressure to adapt or perish. Some may evolve into credentialing hubs, offering “micro-degrees” for niche skills.

AI Is Flipping Education and Work On Its Head

Excerpt:

Artificial intelligence is not merely a tool for incremental change it is the architect of a total overhaul. At the heart of this transformation is a radical reimagining of how knowledge is delivered, absorbed, and validated. At Alpha School in Texas, students spend just two hours a day learning with AI, yet they outperform 98% of students nationwide, scoring in the top 1-2% on standardized tests.


WOLF AGAIN…..

The question will not be whether you can use AI to fake out people about how smart you are, in their decaying system. The question will be whether (1) you can use AI for real research, or (2) whether you can change, fix, use, or install AI to do something useful and good to others.

That output of your use of AI may include good stuff, or bad stuff. People who use AI for bad stuff will need to be punished. Good AI and AI in the hands of good people will get it done.

Welcome to the future.


Mutually Acceptable Lies About The Clot Shot

It’s time to be honest about what is going on in HHS, NIH, FDA and CDC.

Reform of these agencies – whose sins almost killed us, and did in fact kill many of us, and many other people around the world – will NOT occur by a quantum leap from bad to good.

It is occurring gradually and continuously, just like the end of government-sanctioned slavery did, in centuries past. And just like The Death of Slavery (cough), the entire process of Death To The Death Jabs (cough, cough) will be a shifting morass of what I call “mutually acceptable lies“.

PAVACA has very nicely documented the various half-measures, quarter-measures, and non-measures which have been taken by the government-ensconced part of MAHA against the clot-shots.

That is the current state of the matter. Not the end state – the current state.

Stated bluntly, the jabs are being gently but not honestly withdrawn from the young and the healthy, and are being kept, with no denial of existing fictions, for the sick, the old, the infirm, and the chronically medicated.

You know – the very people that a socialist depopulation program still wants to remove.

NOW do you see why the current assortment of lies and truths might be mutually acceptable to the two sides?

You don’t normally think like a depopulationist, or like somebody whose kids are being threatened by a shadowy cartel. So you never saw it coming – that our side would accept both some silver and some lead – at least temporarily. Or that the other side – the depop cartel – would accept a mixed bag. Yes – just like the drug cartels, they accept shifting realities.

The BAD SIDE threatened our children and young adults, and showed us that they had the power to not just kill our loved ones, but to make us do it – to make us part of the murder. Having them back off from this extortion is what we get, in return for their continued elimination of the people they wanted to eliminate all along – the weak, the old, the medically costly, the non-productive, and the undesirable, who can be slipped into their caskets at any time by a few shots.

This was very skillful play by the depoppers and their deep state allies. Do you see it? They had a REASON for pushing the jabs too far. So that when their commu-Nazi tide went back out, it was still deep enough to drown the “useless eaters”.

Now – this is not the spoken reality – meaning the lies. What I gave you is the mutually acceptable truth. The mutually acceptable lies are continuation of the scientific bullshit about antibody count, no need for clinical testing, and most of all, the need for those medical pobrecitos (poor young little ones) to get the merciful jabs to protect them from the still mythically Wuhan-dangerous omicron common cold.

THAT is their goal. THAT is what they needed to accomplish.

Somebody is still gonna pick the cotton and go to Heaven.

We know the “dangers” to these fragile patients are all bullshit, already shockingly disproved by the “peer-reviewed” literature. But the media that can never be wrong, and the scientific media that is even worse, are “not done not talking about things” – so we have to wait for memories to cool, so that nobody gets in trouble for slavery killing Black and Indian kids with jabs.

So what do we do?

We keep pushing on. We keep fighting. We make sure the public, the MAHA now in office, and (importantly) the American pope know that the fight for human life is not over – that “depopulation” is real, that it’s insidious, and that its stealthy proponents are not done fighting.

The depoppers will put up a hell of a fight to keep things where they are right now – where they not only have the elderly and the infirm at the end of a population-adjusting needle, but where they also have a prime depopulation AGENT (coronavirus spike protein) authorized for that needle.

And yet, I think we have some strong weapons at hand, against their strong lies.

If our theories are correct, then we will find evidence of safer outcomes with non-mRNA vaccines like Novavax, Coronavac (ChiCom jab), CorbeVax, and others that omit the mRNA technology. Even better, the new “Gold Standard” “universal platform” jabs that are now being pushed by Secretary Kennedy and Dr. Jay Bhattacharya, should prove much safer than mRNA.

Yeah, they’re not perfect – but they’re better. Fewer people will die. SOME people – in fact MANY people – will be rescued from depopulation.

This is war. There will be casualties. But we will win.

W

Dear KMAG: 20250519 Trump Won Three Times ❀ Open Topic


Joe Biden never won. This is our Real President – 45, 46, 47.

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Week:

incompossible

adjective

  • incapable of coexisting
  • not capable of joint existence
  • incompatible
  • inconsistent
  • not mutually possible
  • mutually exclusive in logic

Used in a sentence

Leibniz’s well-known thesis that the actual world is just one among many possible worlds relies on the claim that some possibles are incompossible, meaning that they cannot belong to the same world.

LINK: http://philosophyfaculty.ucsd.edu/faculty/rutherford/papers/LeibnizCompossibility.pdf

Shown in a picture

Shown in a video


MUSIC!

Inconceivable! Incompossible! Incompostable!


THE STUFF

Question: Is mRNA vaccine technology incompossible with “gold standard” treatment, if it is not part of the “Generation Gold Standard” universal vaccine platform for “pandemic” viruses?

I remain surprised that nobody in public is talking about mRNA technology being EXCLUDED from the new vaccine platform being promoted by HHS and NIH.

Is this due to the fact that, if nobody ever talks about the elephant in the room, then nobody will talk about it when it leaves the room? If so, then strategic opportunities abound!


Next Question…..

Is autoimmune disease in COVID-vaccinated kids the end of the shots for kids? First, what’s happening…..

LINK: https://www.thefocalpoints.com/p/breaking-hhs-to-end-covid-19-vaccine


BREAKING: HHS to END COVID-19 Vaccine Recommendations for Kids & Pregnant Women

With over 600,000 estimated COVID shot deaths in the U.S., HHS moves to roll back CDC guidance—amid mounting criminal referrals, legislative efforts, and growing calls for a complete moratorium.

Nicolas Hulscher, MPH's avatar

Nicolas Hulscher, MPH

May 15, 2025

by Nicolas Hulscher, MPH

According to the Wall Street Journalthe Trump administration—under the leadership of HHS Secretary Robert F. Kennedy Jr.—is preparing to end routine CDC recommendations that pregnant women, teenagers, and children receive COVID-19 vaccines. This decision, expected to be announced in the coming days, represents a long-overdue departure from current ill-advised CDC guidance, which still urges vaccination for everyone aged six months and older, including during pregnancy.


Well, take a look at this. Is this why?

TL;DR / BLUF – COVID vaccines, not COVID, cause autoimmune problems in kids, and they do it about 9 months later, on average, thus escaping scrutiny.

LINK: https://www.thefocalpoints.com/p/new-study-covid-19-vaccines-increase

More details…..

NEW STUDY: COVID-19 Vaccines Increase Risk of Long-Term Autoimmune Disease in Children — Not the Virus

A massive study of 493,705 children found a 23% increased risk of developing autoimmune disease after COVID-19 vaccination, with symptoms emerging about 9 months after injection.

Nicolas Hulscher, MPH's avatar

Nicolas Hulscher, MPH

May 16, 2025

by Nicolas Hulscher, MPH

The study titled “Investigating the association between SARS-CoV-2 infection, COVID-19 vaccination, and autoimmune diseases in a pediatric population: a comprehensive analysis” was just published in the journal Pediatric Rheumatology:

Background

During the COVID-19 pandemic there were reports of an increased association between COVID 19 and various autoimmune diseases (AID) in adults. This study aims to investigate the incidence of AIDs in children before and during the pandemic and explores potential links to SARS-CoV-2 vaccination.

Methods

We analyzed 493,705 anonymized medical records from Maccabi Healthcare Services, Israel’s second-largest healthcare provider, to study AID incidence during 2014–2022. The study period was divided into three phases: two pre-pandemic phases of equal duration (A and B) and a pandemic phase (C).

Results

Of 4,596 (0.9%) patients diagnosed with an AID in the cohort, incidence rates were 0.9% for Group A (2014–2016), 1.0% for Group B (2017–2019), and 0.9% for Group C (2020–2022) (p = 0.13). Logistic regression showed no significant differences in overall autoimmune disease incidence between the pre-COVID and COVID periods. Notably, specific conditions like celiac disease showed reduced incidence in Group A (OR 0.8309, p = 0.0071) while arthritis was significantly more common in Groups A and B. Additionally, COVID-19 diagnosis was not significantly associated with increased autoimmune disease risk (HR 1.092, p = 0.491); however, receiving at least one COVID vaccine was linked to higher risk (HR 1.2323, p = 0.0033).

Conclusion

Our findings suggest that the overall incidence of new-onset autoimmune diseases in children remained relatively stable during the COVID-19 pandemic. The study indicates a potential association between COVID-19 vaccination and an increased risk of developing autoimmune diseases, necessitating further research to elucidate long-term effects in the pediatric population.

Suddenly the multiple cases of “sudden new autoimmune problems” among my vax-friendly liberal friends and neighbors make a lot of sense.


Is photonic quantum computing the way? Maybe so!

Don’t feel bad if this sounds complicated. Even the following 2021 explanation is not easy stuff.

LINK: https://physicsworld.com/a/programmable-photonic-chip-lights-up-quantum-computing/

Just sayin’!

And remember…….

Until victory, have faith!

And trust the big plan, too!

And as always….

ENJOY THE SHOW

W


Dear MAGA: 20250508 ✾ Thank God ± Theistic Evolution ∈ Thursday Open Topic / Q-Level Vaccine Strategy


This man, making Christmas calls from the White House, believes the world is a sphere. And he has even flown around it! So has our beautiful FLOTUS, who happens to be his wife!

Truth and common sense must be valued by us, as individuals, in order to lastingly disempower the authoritarian fake news media. This includes the perniciously smarmy science media, which never answers for its errors and lies. I believe that the media has been responsible not only for leftist pathologies like scientism, medical fascism, and radical gender ideology, but also for reactionary movements like modern flat Earth, rejection of all medicine, and Biblical geological literalism.


Just as Wheatie’s Stormwatch Monday Open Thread was created as a place for people to openly express their thoughts and opinions, so, too, is this Thank God Thursday Open Thread, where honest but civil discussion of all topics is encouraged. This thread is also to be known as Theistic Evolution Thursdays, due to the author’s expected “pontification” about his scientific, religious, and political opinions. You are welcome to pontificate back! Free speech matters!

Please label all AI-generated content as being such, unless it is patently obvious (e.g., humorous AI images). It is important that we as individuals not begin to pretend that socially derived artificial intelligence is actually our own, as this form of stealthy social information averaging and feedback would be one more pretense and deception between people, in service of stupid Marxist socialism, and of those who wish to substitute their communally protected lies for actual truth.

The source of alleged truth matters, not for the truth itself, but for validation.

And yes, it’s THURSDAY…again.

And that’s it. We’re done stealing from Wheatie.

OK – maybe her rules need to be posted.

  • No food fights.
  • No running with scissors.
  • If you bring snacks, bring enough for everyone.

Other rules may be derivable from these, and that conjecture is left for discussion.


If there is nothing beyond the “W” below, then this is a placeholder. For health reasons, I can’t always post a timely opinion before each Thursday, but I will try. Otherwise, you have this placeholder post, where YOU provide the content. Enjoy!

W


I begin this first post with an aside. The header for Thank God / Theistic Evolution Thursdays is a stained glass depiction of the first chapter of Genesis from the Tree of Life Synagogue in Pittsburgh, Pennsylvania.

It is the author’s contention that there ARE actual answers in Genesis – but they’re more profound and astounding than even the very smart people of antiquity could imagine, or even more recent minds from the 1800s, when modern humanity fell hard for the “6000 year” trickery.

To uncover the mechanistic details of the creation outline in Genesis, requires the work of many people over a long period of time. THAT very point – big things, long times – being a pattern worth noting.

God works with WAY bigger math than we can comprehend. At least, that is MY conjecture.


Q-Level Vaccine Strategy

It is my belief that what we are seeing unfolding right now, in HHS, NIH, FDA, and CDC, is the result of deep strategy and planning by some very smart and well-intended people, who are changing American healthcare for the better, whether it wants to make the necessary changes or not.

If that sounds like the Q folks, then good. If that merely sounds like the Trump administration, doing what it was elected to do, then good. If that sounds like some super-secret project of some other nature, then good. If that sounds like God taking a hammer to Satan’s bureaucracy, then good. I don’t care so much to convince you WHY it’s happening, as much as I want to show you THAT it’s happening.

What I hope to do here, is to quickly and simply explain where I see this hidden hand making plays, and why it might be making them.

I begin by explaining when and where I became aware that something good was going on.

First, barkerjim reported this item discussed on “Coffee and COVID”:

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454816

Here is the link to Coffee & COVID:

LINK: https://www.coffeeandcovid.com/p/anomalous-thursday-may-1-2025-c-and

Here is the link to the Daily Fail article causing the excitement:

LINK: https://www.dailymail.co.uk/health/article-14668777/trump-admin-rfk-jr-universal-vaccines-project-hhs.html

Gail Combs then explained the significance.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454911

Gudthots then provided a much longer explanation of this significant change in vaccine testing.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454980

In summary, vaccines will now need to be tested against placebos – in ways that will critically distinguish safe vaccines from risky vaccines. This is a HUGE win for honest medicine.

I want to emphasize how strategically brilliant this is. Asking that vaccines be tested “normally” not only reverses outrageous vaccine non-testing that was installed by Fauci and Friends during COVID – it reverses sketchy and abused science all the way back to the 1960s and 1970s.

It’s undoing ALL of the bad stuff that has happened in vaccination since the middle of the last century.

And yet – “nutjob” RFK Jr. isn’t demanding the banning of even a single vaccine, as his opponents screamed and howled he would. No – he’s simply asking that vaccines be tested for safety like everything else.

What is happening here is unassailable. And yet, this move is going to stop sketchy vaccines like the COVID vaxxes IN THEIR TRACKS. Even other vaccines with “good” track records are going to have to prove themselves. And some “good” ones may turn out to be “not so good”.

This is the perfect move right now. Does this sound like something “beginner” secretary RFK Jr. would choose to play, all on his own, in the deadly DC chess game, against highly experienced globalist scum bureaucrats?

I don’t think so. It’s too smart. Something is going on.

But it gets better. And it was at the “gets better” point that I knew something very awesome was going on.

And no – I’m not talking about this, that eilert brought!


WOW. But no, that’s not what I’m talking about.

I’m talking about this, that holly brought.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454912

Yes – at first this looks spooky. And probably looks spooky-good to the stupid left.

Here is the Daily Fail link to that one.

LINK: https://www.dailymail.co.uk/health/article-14668777/trump-admin-rfk-jr-universal-vaccines-project-hhs.html

Cuppa Covfefe correctly spots that the Daily Fail is massively fear-mongering here.

Then holly brings the information that perked up my wolf ears BIG TIME.

Here’s the link to that HHS/NIH announcement:

LINK: https://www.hhs.gov/press-room/hhs-nih-announces-generation-gold-standard.html

This is the point where I FREAKED!

It only took about 2 seconds for Aubergine to figure out what I was saying.

Reread that if you have to – that’s the bottom line, pretty much.

I’m going to explain it in more detail below.

And that’s why we’re here. I’ll get to it in a minute, but let’s finish capturing the discussion.

Here, PAVACA notes that this “universal vaccine platform” isn’t being championed by only the good guys, and being openly opposed by the bad guys. Not at all. The bad guys have their fingerprints all over it, too, and seem to be helping it. But note the military connections. I suspect that’s important.

Things get interesting here, and require some explanation.

As Trump says….

“Complicated business.”

IMO Fauci was doing what Fauci does. Get close to it. Get power over it. Then kill it or sabotage it. So we need to watch out for the Fauci Minions trying to take down MAHA.

Kalbo opined that it would be nice to get those deadly COVID mRNA vaccine EUAs withdrawn ASAP, and I have to agree. But again, it looks like what is being done here is strategic, and even in a military way, where a non-zero number of casualties are accepted to insure victory.

What I mean here is that by making two ostensibly pro-vax moves that are going to nuke the COVID vaccines shortly, guaranteed, it will be impossible to stop the withdrawal of the EUAs down the road. No amount of media-Democrat propaganda acting and photo ops will be able to stop the EUAs from being withdrawn.

Finally, this comment of mine, which I will explain.

So what the heck is going on? The “test vaccines against placebos” part sounds like a no-brainer, and also like a “no-risk winner”. But why should we trust ANYBODY talking about some new vaccine platform? They’re even using Fauci’s cynical, cringe-inducing “gold standard” terminology, which was even used for remdesivir and all kinds of other Fauci horrors.

Time for me to explain my opinions on some fundamentals.


The mRNA COVID-19 vaccines were always flawed, but in more fundamental ways than even most scientists realized. By being authoritarian drones, most scientists never questioned the most fundamental problem with the Pfizer, Moderna, Novavax, and Corbevax vaccines, which affected them all, despite their multiple different technologies.

None of these vaccines targeted anything but the spike protein.

NONE of them.

NOTHING more.

In contrast, the Chinese CoronaVac / Sinovac whole-virus vaccine, using the same beta-propiolactone deactivation method as the new proposed universal vaccine platform, targets every protein coded in the viral genome.

Stated differently, immunity created by the Chinese CoronaVac whole-virus vaccine technology, is much more like natural immunity, than is immunity created by the mRNA vaccines.

That means that the immunity is broader – targets more viral proteins – and thus acts against more variants and future variants.

So by now, readers have to be asking why on Earth the Americans would be pursuing the “clot shot” technology – and not the likely best vaccine technology, which was being pursued by China.

This, in spite of (or perhaps because of) the fact that the storage and processing of Pfizer’s clinical data is done in China. ALL of it. In China.

I don’t want to get sidetracked by the “why” of American stupidity and errors on vaccines, which potentially gets into medicine under communism versus under capitalism, as well as what communists might do, medically, in a war on capitalism. But I do want to point out that – for some very good but very weird reason, we are suddenly doing things right in the area of vaccines.

It’s important to look at the HHS announcement on the universal vaccine platform. Reading it really sheds light on what is going on.

I will include the text here, with my comments in ***bold. Note the date of the press release – May 1, 2025. This is happening right now, basically.


HHS, NIH Launch Next-Generation Universal Vaccine Platform for Pandemic-Prone Viruses

*** Note that this is not only changing all these vaccines to a “new” platform – it is clearly targeting anything over which the wicked Fake News Media might declare a “pandemic”. IMO the use of the terms “Next-Generation” and “Universal” are targeted and very intentional.

Washington, D.C. – The U.S. Department of Health and Human Services (HHS) and the National Institutes for Health (NIH) today announced the development of the next-generation, universal vaccine platform, Generation Gold Standard, using a beta-propiolactone (BPL)-inactivated, whole-virus platform.

*** Again, this is the Chinese CoronaVac technology.

This initiative represents a decisive shift toward transparency, effectiveness, and comprehensive preparedness, funding the NIH’s in-house development of universal influenza and coronavirus vaccines, including candidates BPL-1357 and BPL-24910. These vaccines aim to provide broad-spectrum protection against multiple strains of pandemic-prone viruses like H5N1 avian influenza and coronaviruses including SARS-CoV-2, SARS-CoV-1, and MERS-CoV.

*** The goal shift toward broad-spectrum protection is key. This is good for doctors, patients, and society – it is BAD for drug company profits. It does not provide an enduringly problematic if not endless money churn, like spike protein vaccines do.

“Our commitment is clear: every innovation in vaccine development must be grounded in gold standard science and transparency, and subjected to the highest standards of safety and efficacy testing,” said HHS Secretary Robert F. Kennedy, Jr.

*** First note that Kennedy is making this statement. Next, note the tie-in to the improved testing with real placebos and not morally framed but morally sketchy tricks to avoid them. Transparency seems to imply that past vaccine development was done quietly between government and drug companies, and not in public, where it should be done.

The program realigns BARDA’s operations with its statutory mission under the Public Health Service Act—to prepare for all influenza viral threats, not just those currently circulating.

*** Changing the focus of BARDA to include “sustainability” of viral control – meaning it has to think about future virus variants and not just the variant of the week, is a brilliant way to break up the grift between regulators and vaccine makers, which is based on evolutionary churn of targeted proteins (like the spike), and pretending not to know that this is fundamentally designed to continuously fail. The designed failure, which seems to have the purpose of sticking more needles into more people at younger and younger ages, is certainly advantageous for depoppers, who IMO may be identifiable from decisions that ultimately supported the grift. A key point is that Geert vanden Bossche’s warnings about viral mutation under the pressure of leaky vaccines must now be considered – these warnings cannot be ignored by intentionally blind policy, which is a cold but effective technique.

“Generation Gold Standard is a paradigm shift,” said NIH Director Dr. Jay Bhattacharya. “It extends vaccine protection beyond strain-specific limits and prepares for flu viral threats – not just today’s, but tomorrow’s as well – using traditional vaccine technology brought into the 21st century.”

*** Look whose name is on this! Jay Bhattacharya! This shows that honest science is re-taking control of what Pfizer was running. The point about “traditional vaccine technology brought into the 21st century” is talking precisely about CoronaVac, using smarter and smarter inactivation technologies.

Generation Gold Standard, developed exclusively by NIH’s National Institute of Allergy and Infectious Diseases (NIAID):

*** This sounds like bullshit to me, probably to placate the demons in NIAID, but maybe there were honest people in NIAID who were liberated from their captivity and suppression under Fauci, and they created this effort. If so, great!

*** The following points are most excellent, and explain why modern inactivated whole virus vaccines are so good. But the bottom line is that this is a MASSIVE shift away from the mRNA vaccines. Just read this carefully.

  • Recalibrates America’s pandemic preparedness. Unlike traditional vaccines that target specific strains, BPL-inactivated whole-virus vaccines preserve the virus’s structural integrity while eliminating infectivity. This approach induces robust B and T cell immune responses and offers long-lasting protection across diverse viral families. Moreover, the intranasal formulation of BPL-1357 is currently in Phase Ib and II/III trials and is designed to block virus transmission—an innovation absent from current flu and COVID-19 vaccines.
  • Embodies efficient, transparent, and government-led research. The BPL platform is fully government-owned and NIH-developed. This approach ensures radical transparency, public accountability, and freedom from commercial conflicts of interest.
  • Marks the future of vaccine development. In addition to influenza and coronavirus, the BPL platform is adaptable for future use against respiratory syncytial virus (RSV), metapneumovirus, and parainfluenza. It also offers the unprecedented capability to protect against avian influenza without inducing antigenic drift—a major step forward in proactive pandemic prevention.

Clinical trials for universal influenza vaccines are scheduled to begin in 2026, with FDA approval targeted for 2029. The intranasal BPL-1357 flu vaccine, currently in advanced trials, is also on track for FDA review by 2029.

###

SO – you can certainly see that it sure looks like the “good guys” are winning – and winning very easily. Too easily, IMO.

As long as the Fauci embeds are being watched carefully, to make sure they don’t interfere and sabotage, then I think we are headed in a very good direction.

Bottom Line – There is too much winning here to be just lucky beginner success by MAHA.

IMO, MAHA is getting help from behind the green curtain. And I would not be surprised if I was to learn that “Q players and Q friendlies” are part of that help.

JUST SAYIN’!

Have a great Thursday!

W

Wolf Pub

https://en.wikipedia.org/wiki/%CE%92-Propiolactone

The 2024-2025 Formula COVID-19 “Vaccines”: Injection Dose #10

The above is a vintage image of mass vaccination. (Courtesy Google Images.)

This series on the disaster of the COVID-19 virus itself, and of the COVID-19 “vaccines”, is dedicated to the memory of Yours Truly’s cousin Bill, who “died suddenly and unexpectedly” in September 2023.

The origination of today’s post begins here: www.dossier.today/p/double-digits-biden-admin-tells-americans, “Double Digits: Biden Admin tells Americans that it’s soon time for their 10th Covid shot“, by Jordan Schachtel, 13 June 2024. (Mr. Schachtel wrote about the ninth COVID-19 “vaccine” injection here: www.dossier.today/p/dose-number-nine-cdc-panel-green, “Dose number NINE: CDC panel green lights yet another Covid mRNA shot“, 29 February 2024. The CDC recommended that persons over age 65 take another “booster shot” of either the Pfizer-BioNTech or of the Moderna “2023-2024 Formula COVID-19 Vaccine” of these manufacturers.) A person age 65 or older, if that person adhered to every CDC recommendation regarding taking a COVID-19 “vaccine” injection since December 2020 (when the FDA granted first Emergency Use Authorization (EUA) to Pfizer-BioNTech and to Moderna for these companies’ “flagship” modRNA COVID-19 “vaccines” (BNT162b2 by Pfizer-BioNTech; and, mRNA-1273 by Moderna), would have taken injection number nine starting on 28 February 2024.

Today’s post is long. There is a large amount of information to “unpack.” Stay with me here.

Below is an image from the FDA’s 13 June “updated” authorization announcement for the “2024-2025 Formula COVID-19 Vaccine”, the TENTH injection dose of the modRNA “vaccine” formula: www.fda.gov/vaccines-blood-biologics/updated-covid-19-vaccines-use-united-states-beginning-fall-2024.

Note the language regarding the “selection of a specific JN.1 lineage SARS-CoV-2 strain…” More about that later.

The trail behind the 5 June 2024 FDA announcement begins with the VRBPAC Briefing Document for the meeting held on 28 June 2022: www.fda.gov/media/159452/download, “FDA Briefing Document Vaccines and Related Biological Products Advisory Committee Meeting June 28, 2022.” It was at this meeting that the FDA “codified” the types of “strain composition recommendations” that the agency would use regarding “new versions” of COVID-19 “vaccines.” Yours Truly presents page 17, page 18, and page 19 of this document:

It appears that the FDA simply decided that it would be permissible for the agency to authorize a new COVID-19 “vaccine” strain composition along what, in Yours Truly’s opinion, may be called “very flexible” options. For example, the Pfizer-BioNTech XBB.1.5 COVID-19 “vaccine”, which was FDA authorized in the fall of 2023, had test results only from mouse testing prior to FDA authorization. Following are: The link to the Pfizer-BioNTech slide presentation about this “vaccine” to the CDC’s ACIP committee (Advisory Committee on Immunization Practices) meeting of 12 September 2023; and, an image of slide CC4 from this presentation. First, the presentation: www.cdc.gov/vaccines/acip/meetings/downloads/slides-2023-09-12/10-COVID-Modjarrad-508.pdf.

Second, slide CC-4 from the above presentation:

The XBB.1.5. Pfizer-BioNTech COVID-19 “vaccine” had only been given as a single injection to humans in the company’s clinical trial; a clinical trial which had only just begun prior to the ACIP meeting. Slide CC-5 of the presentation, the start of the company’s human trial of this “vaccine”, is below:

Slide CC-6 of the presentation has to do with the mouse studies of this “vaccine”, which were of longer duration.

Notwithstanding the above, the FDA authorized the use of the company’s XBB.1.5 COVID-19 “vaccine” on 11 September 2023 (in Yours Truly’s opinion, it appears that the ACIP meeting of 12 September 2023 was a “catch-up” formality.) It also appears (again, in Yours Truly’s opinion), that the FDA used a very loose interpretation of “Option 4” on page 18 of the FDA Briefing Document above in granting the EUA for this “vaccine”.

** Now, on to the latest “new version” of the COVID-19 “vaccines”, the “2024-2025 Formula COVID-19 Vaccines”, that the FDA authorized in June 2024.

The following linked items are important regarding background information related to this situation and to the FDA: First, the FDA document, stating that the agency would “align” its COVID-19 “vaccine” antigen composition to the recommendations of the World Health Organization’s TAG-CO-VAC recommendations: www.fda.gov/media/179139/download (the TAG-CO-VAC recommendation for the “2024-2025 Formula COVID-19 Vaccines” was to use the JN.1 strain); second, the FDA document regarding “considerations and recommendations” for the “2024-2025 Formula COVID-19 Vaccine” composition: www.fda.gov/media/179145/download; third, the FDA announcement of the 5 June meeting of its VRBPAC committee (Vaccines and Related Biological Products Advisory Committee.): www.fda.gov/advisory-committees/advisory-committee-calendar/vaccines-and-related-biological-products-advisory-committee-june-5-2024-meeting-announcement. From this last link, chick on “Event Materials” to see the slide presentations and other items that were discussed at this meeting.

Two important items from the “Event Materials” list: the FDA Briefing Document; and the VRBPAC roster for this meeting. First, the FDA Briefing Document: www.fda.gov/media/179003/download; and, second, the VRBPAC roster for this meeting: www.fda.gov/media/179225/download. The roster for the 5 June 2024 meeting has some “familiar” members and speakers: Paul Offit, MD; and Peter Marks, MD (director of CBER [Center for Biologics Evaluation the Research of the FDA]); and, among the “Temporary Voting Members”, are: Bruce Gellin, M.D., M. PH., the Chief of Global Public Health Strategy for the Rockefeller Foundation; and, Melinda Wharton, M.D., M. PH., Associate Director of Vaccine Policy of the CDC. (Italics mine)

The VRBPAC members voted unanimously to endorse the Pfizer-BioNTech, the Moderna, and the Novavax “2024-2025 Formula COVID-19 Vaccine” by these companies, based on the presentations of these companies’ representatives at the meeting. Yours Truly can find no registered human clinical trials performed in advance of the 5 June VRBPAC meeting by Pfizer-BioNTech, or by Moderna, or by Novavax, for any “2024-2025 Formula COVID-19 Vaccine”; that would indicate that any “clinical trials” were performed in these companies’ facilities on mice; and that any “human trials” were also performed in these companies’ facilities, prior to the meeting. The FDA then issued the agency’s original announcement of 7 June 2024: www.fda.gov/news-events/press-announcements/fda-roundup-june-7-2024; and, a screenshot from this announcement:

Note in particular “…the selection of a specific JN.1 lineage SARS-CoV-2 strain (e.g., JN.1. or KP.2) and expressed a strong preference for JN.1.” Here’s where it starts to “get interesting.”

First, on 12 April 2024 (well ahead of the 5 June VRBPAC meeting), Pfizer-BioNTech issues a statement regarding the company’s “taking reservations” for the coming “2024-2025 Formula COVID-19 Vaccine” (also, see the Pfizer-BioNTech presentation at the 5 June meeting, linked above): www.cvdvaccine-us.com/reservation. This is followed, after the meeting, by Moderna filing an application with the FDA for a “vaccine” to target the JN.1. COVID-19 strain (also, see the Moderna presentation at the 5 June meeting, linked above): https://investors.modernatx.com/news/news-details/2024/Moderna-Files-FDA-Application-for-the-JN.1-Targeting-COVID-19-Vaccine/default.aspx; then, Novavax files with the FDA for that company’s version (also, see the Novavax presentation at the 5 June meeting, linked above): https://ir.novavax.com/press-releases/2024-06-14-Novavax-Submits-Application-to-U-S-FDA-for-Updated-Protein-based-2024-2025-Formula-COVID-19-Vaccine.

But then, “something happens”, and the FDA suddenly makes a large “about-face” and switches its “2024-2025 Formula COVID-19 Vaccine” choice to the KP.2 strain on 13 June 2024: www.fda.gov/vaccines-blood-biologics/updated-covid-19-vaccines-use-united-states-beginning-fall-2024. This is the “second” announcement, which was cited at the beginning of today’s post.

What was it that happened? Part of the answer lies in the fact that the NIH and Moderna co-own the patents (and, therefore, share the royalties) for the Moderna “flagship” modRNA COVID-19 “vaccine”, mRNA-1273. This agreement would extend to “descendant clone COVID-19 vaccines” by Moderna. www.citizen.org/article/modernas-mrna-1273-vaccine-patent-landscape/. The NIH’s Dale and Betty Bumpers Vaccine Research Center (part of NIAID — which Dr. Anthony Fauci led from November 1984 until his retirement in December 2022) and Moderna co-developed mRNA-1273. https://covid19.nih.gov/news-and-stories/nih-vaccine-research-center; a screenshot from the article is below:

The other part of the answer is that Moderna was already developing a KP.2 strain COVID-19 “vaccinefor 2024-2025. This, and the FDA’s decision to shift away from the JN.1 strain to the KP.2 strain, are described in this post at Sasha Latypova’s blog: https://sashalatypova.substack.com/p/all-roads-lead-to-resilience, “All Roads lead to Resilience. FDA is removing competitors for the Pentagon & CIA’s baby…Moderna”, 23 June 2024.

The FDA’s “about-face” announcement regarding the switch from the JN.1 strain to the KP.2 strain was also covered here: www.contagionlive.com/view/fda-advises-manufacturers-to-consider-kp-2-strain-for-covid-19-vaccines, 14 June 2024, by Sophia Abene. Below is a screenshot from this article:

However, there’s yet another detail in play here, regarding the FDA’s switch, “based on evaluation of the most recent circulating strains of COVID-19”, from JN.1 to KP.2 — the CIA and the Pentagon. Here is a screenshot from Sasha Latypova’s Substack article:

Here is the report, linked from the Latypova blog article cited above, that describes the CIA-linked company, “National Resilience”, or “Resilience”, that manufactures the RNA for the Moderna modRNA line of COVID-19 Omicron “vaccines”: https://unlimitedhangout.com/2022/08/investigative-reports/rna-for-modernas-omicron-booster-manufactured-by-cia-linked-company/, by Whitney Webb, 17 August 2022. Below is a screenshot image from this blog article:

And here is story on this “interesting development”, from Resilience: www.businesswire.com/news/home/20210908005443/en/Resilience-to-Manufacture-mRNA-for-Moderna’s-COVID-19-Vaccine, 8 September 2021. Note that per this “multi-year contract”, Resilience manufactures the mRNA for the Moderna COVID-19 “vaccines” at this Canadian facility. Resilience was founded in 2020.

But wait, there’s more! Resilience lists multiple “partners”, such as the Mayo Clinic. The company also, apparently, has a “partnership” with the United States Army’s Joint Program Executive Office for Chemical, Biological, Radiological and Nuclear Defense https://resilience.com/learn/partnerships. Below is a screenshot from this website:

The website link in the screenshot above is broken. Here is the Army’s website on this: wwwt2.army.mil/T2-Laboratories/Designated-Laboratories/Joint-Program-Executive-Office-for-Chemical-Biological-Radiological-and-Nuclear-Defense/. Note: this link may or may not work. One will need to do a search for “Joint Program Executive Office for Chemical, Biological, Radiological and Nuclear Defense” to see links to this department of the United States Army. One such link: https://globalbiodefense.com/directory/name/joint-program-executive-office-for-chemical-biological-defense-jpeo-cbd/.

It appears, then, in Yours Truly’s opinion, that the FDA was perhaps “reminded” of the”details” regarding the NIH-Moderna co-ownership (and royalties – sharing) agreement related to Moderna’s modRNA COVID-19 “vaccines”; and, the role of the CIA-Pentagon-National Resilience (aka Resilience) in manufacturing the mRNA used in the Moderna COVID-19 Omicron “booster vaccines” — and the KP.2. strain is indeed a “descendant strain” in the Omicron lineage (as is the JN.1 strain.) Hence, the FDA’s 2024-2025 COVID-19 “vaccine” strain “sudden switch” announcement of 13 June 2024, only one week after the agency gave the nod to the JN.1 strain.

In Yours Truly’s opinion, it is statistically, medically, and ethically impossible for a new vaccine (let alone any COVID-19 “vaccine”) to be developed; tested (on lab animals, then on human subjects); the test data thoroughly collated and analyzed for “safety and efficacy” on both lab animals and on human subjects; then, which data is presented to the CDC / FDA for consideration; then, these agencies doing their own “due diligence” research; then, and only then, being granted an EUA by the FDA; then, and only then, manufactured for use in humans — in a time span of fewer than three to five years, let alone within a time span of only a few months. It appears, again in Yours Truly’s opinion, that the CDC and the FDA are playing “fast and loose” with the health and safety of the people who choose (or will be “mandated”) to take the “2024-2025 Formula COVID-19 Vaccine.” And, also, that “other entities” are in play here to perhaps “influence” decision making by these agencies.

All of above is in addition to the fact that the COVID-19 “vaccines” (actually, gene therapy injections) have caused, are causing, and will cause, multiple health issues, serious adverse reactions, and deaths, in those who are “vaccinated.” Just two of the most recent discoveries: One, the COVID-19 “vaccines” can cause brain damage, an article by Dr. William Makis: www.globalresearch.ca/brain-damage-covid-19-mrna-vaccines/5861012, “Brain Damage Caused by COVID-19 mRNA Vaccines”, 26 June 2024. Below is a screenshot from Dr. Makis’ article:

The second most recent discovery, that the COVID-19 “vaccines” reduce life expectancy (even in “all-cause” analysis) among COVID-19 “vaccinated” persons, by Dr. Peter A. McCullough: https://petermcculloughmd.substack.com/p/breaking-publication-a-critical-analysis, “BREAKING Publication — A Critical Analysis of All-Cause Deaths during COVID-19 Vaccination in an Italian Province”, 1 July 2024. The peer-reviewed paper is here: https://doi.org/10.3390/microorganisms12071343, “A Critical Analysis of All-Cause Deaths during COVID-19 Vaccination in an Italian Province”, Marco Alessandria, et al., published 30 June 2024. Below is a screenshot from the Conclusions section of this paper:

In Yours Truly’ opinion, it is apparent at “half a glance” that the COVID-19 “vaccines” (actually, gene therapy injections) must be completely withdrawn for human use until these products have been fully investigated, and then re-designed, before being re-introduced for human use; and, that there is no “co-ownership” or sharing of royalties between a government agency and a COVID-19 “vaccine” manufacturer; and, that there is no involvement of the United States military in the development or manufacture of such products.

Peace, Good Energy, Respect: PAVACA


Dear KMAG: 20231218 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

G-quadruplex

and related terms such as

G4 knot and G-tetrad

nouns

In molecular biology, G-quadruplex secondary structures (G4) are formed in nucleic acids by sequences that are rich in guanine.[2] They are helical in shape and contain guanine tetrads that can form from one,[3] two[4] or four strands.[5] The unimolecular forms often occur naturally near the ends of the chromosomes, better known as the telomeric regions, and in transcriptional regulatory regions of multiple genes, both in microbes[6][7] and across vertebrates [8][7] including oncogenes in humans.[9] Four guanine bases can associate through Hoogsteen hydrogen bonding to form a square planar structure called a guanine tetrad (G-tetrad or G-quartet), and two or more guanine tetrads (from G-tracts, continuous runs of guanine) can stack on top of each other to form a G-quadruplex.

The placement and bonding to form G-quadruplexes is not random and serve very unusual functional purposes. The quadruplex structure is further stabilized by the presence of a cation, especially potassium, which sits in a central channel between each pair of tetrads.[3] They can be formed of DNARNALNA, and PNA, and may be intramolecularbimolecular, or tetramolecular.[10] Depending on the direction of the strands or parts of a strand that form the tetrads, structures may be described as parallel or antiparallel. G-quadruplex structures can be computationally predicted from DNA or RNA sequence motifs,[11][12] but their actual structures can be quite varied within and between the motifs, which can number over 100,000 per genome. Their activities in basic genetic processes are an active area of research in telomere, gene regulation, and functional genomics research.[13][14]

LINK: https://en.wikipedia.org/wiki/G-quadruplex

Shown in a picture

Wolf’s easy description

Those genetic bases (the little flat molecules with one or two rings and lots of “N” and “O” in them) can not only bond to each other in PAIRS between different bases – the base guanine (G) can bond to itself if it makes a circle big enough for FOUR of them instead of just a pair (see left picture above). Sometimes a metal ion in the center can help this happen.

This competing form of binding disrupts the nice, neat, normal “double helix” binding, but not permanently.

When G4 binding happens, there are many working ways that the little squares can form. These squares tend to STACK just like in normal DNA, and so sequences that are rich in guanine can build these stacks easily, if the guanines are in the right places. Alternatively, two or more strands of DNA or RNA can join in these knots, but at a minimum, a single strand can do it, as shown on the right of the graphic above, where the sequence knots up against itself.

Note that this is more like “knots in velcro”, and not like various circling knots we are familiar with.

Used in a sentence

“For over two decades, the prime objective of the chemical biology community studying G-quadruplexes (G4s) has been to use chemicals to interact with and stabilize G4s in cells to obtain mechanistic interpretations.”

LINK: https://www.sciencedirect.com/science/article/pii/S2451945621000416

Why it’s important for COVID vaccines

The COVID vaccine mRNA is not natural – and not only in that normal bases are substituted with modified bases. It also has been “codon optimized”, meaning the very sequence of bases was changed from the viral sequence, by substituting base triplets with synonymous ones, that are known to process faster in humans. But the problem is that these changes are rich in guanine, making the knotting more likely. This not-fully-equivalent substitution has potential pharmacological consequences. In a sense, viral evolutionary intelligence was ignored (a beautiful point made by Kevin McKernan).


Music

Let’s start off with some LIVE DRINKABY

Sadly, DRINKABY line dancing hasn’t just infected the other side of the Pacific – it has become a destructive influence in Spongebob’s hometown of Bikini Bottom.

https://youtu.be/xGTdVy7t1K8

This led to me watching (please skip, unless you desire to prove the full effect that follows) a video compilation of the times the town of Bikini Bottom was destroyed in the cartoon “Spongebob Squarepants”.

When that destructive propaganda of mayhem was over (yes, even Spongebob is one of their tentacles), I needed the following.

This is only 18 minutes – and worth every one of them.

But here is the one you need right now!


You know, maybe we’ll just leave it right there and skip the usual worldly “stuff”!

Although I did promise PAVACA that I would explain something, so we’ll try that.


MOAR DNA and RNA STUFF

Check out this video, which shows TRANSCRIPTION – the normal, natural way that DNA is turned into RNA in living organisms on this planet.

What you are seeing here is “good”!

https://twitter.com/Levandov_2/status/1735919142086041794

NEXT – Somebody else posted this under their own timeline on X.

NOW – the molecular biologist who found the DNA contamination problem in the mRNA vaccines – Kevin McKernan – reposted the latter video with a comment about something which is NOT in the video, but which would change it. Here is his comment.

Let me explain what Kevin is saying.

Kevin is not commenting about the transcription process shown here. He is NOT talking about the red DNA strand, either. He is commenting about the yellow strand of mRNA which is being produced.

“Now add N1 methyl Pseudouridine and watch that yellow strand turn into quadruplex G knot.”

He is saying that if you change the uridines in that molecule to N1-methyl-pseudouridine, as was done in the Pfizer vaccine, the yellow strand of mRNA will “kink up” with G-quadruplex knots.

He explains that further, when somebody wrongly claims the video is showing translation (creation of proteins) and not transcription (creation of mRNA). Observe.

So to sum up, he is saying that the “good” “yellow” mRNA produced in the video was corrupted by the modifications that were made to it by Pfizer.

He says the following things:

  • it’s transcription, not translation, that is being shown
  • the “pseudo-uridine” changes done to the viral mRNA sequence make the mod-RNA dissociate more easily
  • the same changes make the mod-RNA form G4-quadruplexes easier
  • Pfizer also changed the code to include more guanines (G), which means more quadruplexes
  • all the G4-based KNOTS that are present in the mod-RNA cause the subsequent TRANSLATION step (looks similar to the video, but it’s PROTEIN being formed) to suddenly PAUSE, just like a KNOT in a climbing rope will lock up against a device until it is untangled. This is the “ribosomal pausing” he’s talking about.

So how does the DeMarinis paper figure into this?

The DeMarinis paper showed that the Pfizer vaccine can be reverse-transcribed from mod-RNA back into DNA by human liver cells. Reverse transcription would look pretty much like the video of transcription, except that RNA would be read, and DNA would spit out.

Whether that DNA is incorporated into the genome or not is unknown, but it is a huge concern, because another group (Jaenisch paper) showed that the COVID virus SARS-CoV-2 can and does incorporate its spike into the genome of some patients, AND yet another group (Mehedi paper) showed that the viral spike shepherds its own mRNA into the nucleus of human cells, where reverse transcription could happen.

I wanted people to see a bigger point – that this repeated and coincidentally connected “bungling” by Pfizer and its allies, which weirdly matches WEF’s dream of “hacking humanity”, is worthy of a bit of suspicion.

When a trail of disconnected yet matching footprints goes in some direction, it’s rather logical that somebody was purposefully passing that way.

It sure looks to me like the various “negligent” yet clearly convenient aspects of this whole exercise, add up to an attempt to gain a population-wide hack into the human cell nucleus.

Just sayin’!

That’s all for now.

Until victory, have faith!

And trust the big plan, too!

And as always….

ENJOY THE SHOW

W


The Infamous “Process 2” Manufacturing Method for the Pfizer-BioNTech modRNA COVID-19 “Vaccines”

The image above is a still from Just Imagine, a 1930 movie about what life in New York City would be like in the year 1980.

This series of pieces on the disaster of COVID-19 (the virus and the modRNA “vaccines” for said virus) is dedicated to the memory of Yours Truly’s cousin Bill, who “died suddenly and unexpectedly” in September, 2023. May he rest in eternal Peace.

Three prefatory notes: One, that what is presented here is only “scratching the surface” regarding the substitution of “Process 2” for the original “Process 1” manufacturing method for the Pfizer-BioNTech “flagship” COVID-19 “vaccine”, BNT162b2; Two, the exact and complete details of “Process 2” are likely a “trade secret” to the company (except that a full description may be in a document given by said company to the FDA, and which was “redacted out” in case it ever got published under FOIA); and, Three, that every Pfizer-BioNTech COVID-19 “vaccine” since October, 2020, has been made using “Process 2” — including the “latest” version, the “2023-2024 Formula” version for use against the (now basically obsolete) XBB.1.5 Omicron variant.

The trail in regards a discussion of the sudden change from the original “Process 1” to the substituted “Process 2” for BNT162b2 can potentially begin in several places; for purposes of today’s presentation, it will begin here: www.bmj.com/content/378/bmj.o1731/rr-2, a letter to the British Medical Journal by Josh Guetzkow, a senior lecturer at Hebrew University in Jerusalem, in response to the BMJ article, “Covid-19: Researchers face wait for patient level data from Pfizer and Moderna vaccine trials.” Prof. Guetzkow points out that the initial clinical trials doses of the Pfizer-BioNTech modRNA COVID-19 “vaccine”, BNT162b2, were made using what was called “Process 1”, from May to October, 2020; but that the company suddenly changed to a new method, called “Process 2” [by 29 October 2020.] He also points out that the “Process 2” batches of BNT162b2 were found to have “…substantially lower mRNA integrity.” It appears that “substantially lower mRNA integrity” includes evidence of what may be termed “fragments” of DNA appearing in these “vaccines”, where they should never be.

Please bear with Yours Truly, this may get a little “technical”, but it is necessary to the whole.

So, what exactly happened by October 2020 that led Pfizer-BioNTech to change to “Process 2” for BNT162b2? One hint is found on Page 54 of the “Protocol Amendment 9, 29 October 2020” document that the company gave to the FDA (www.nejm.org/doi/suppl/10.1056/NEJMoa2034577; scroll down to “Protocol PDF” and click to get the entire document):

Another hint is found on Page 3 of the same document:

It would appear, then, that Pfizer-BioNTech decided, sometime between 1 May and 1 October 2020, to, One: add an “additional exploratory objective” to the C4591001 clinical study of BNT162b2;, and, Two, to support “increased supply” (of BNT162b2, presumably after securing Emergency Use Authorizations from the European Union medicines regulatory agency and from the FDA in the United States to use the “vaccine”, which did happen) — both, by changing from “Process 1” to “Process 2” to manufacture the product. Prof. Guetzkow states that there appears to be no analysis of comparisons between using these two methods. It is also, from what Yours Truly has been able to find, not known exactly when “Process 1” was stopped as a manufacturing method for BNT162b2 and “Process 2” was approved as the sole method.

We now turn to Page 4 of the FDA-issued “Emergency Use Authorization (EUA) for an Unapproved Product Review Memorandum” of 23 June 2023, related to the EUA the agency granted for the use of the Pfizer-BioNTech “2023-2024 Formula” COVID-19 “vaccine” on people ages 6 months to 5 years old in the United States (www.fda.gov/media/172019/download.) Page 4, in Yours Truly’s opinion, is a tacit admission that this “vaccine” is indeed made according to “Process 2”:

Finally, there is the following hint in the description of the manufacturing process for the Pfizer-BioNTech “vaccine” against meningitis, called PENBRAYA, in the 11 DESCRIPTION section of the company-issued document (https://labeling.pfizer.com/ShowLabeling.aspx?id=19937):

The work of Dr. Kevin McKernan, Dr. Jessica Rose, and other researchers, has shown that there are numerous serious issues with the integrity of the process of manufacturing BNT162b2 — the “Process 2” that was used to make billions of doses of this Pfizer-BioNTech modRNA COVID-19 “vaccine” — and which process is being used to manufacture the company’s latest modRNA COVID-19 “vaccine”, the “2023-2024 Formula.” These two scientists, along with other colleagues, published a paper on this situation last month. It can be found here: www.researchgate.net/publication/374870815. The paper also has some more details of the “Process 2” method — and, by the way, also stating that Moderna also came up with a similar process for its modRNA COVID-19 “vaccines.”

One suspects that the integrity problems with the manufacturing of the modRNA COVID-19 “vaccines” is a subject that will have much more investigation. This is aside from the accumulating evidence that the ingredients of said “vaccines” are themselves dangerous.

Peace, Good Energy, Respect: PAVACA

The COVID-19 Virus and the modRNA COVID-19 “Vaccines” Induce Accelerated Aging

https://i.postimg.cc/gch5SRRq/Ponce-de-Leon-and-the-mythical-Fountain-of-Youth.jpg

Prefatory Note: This series of pieces on the ongoing disaster of COVID-19 and the COVID-19 “vaccines” is dedicated to my late cousin Bill, who “died suddenly and unexpectedly” in September, 2023. He was a quiet-spoken man, studied philosophy at Notre Dame, owned and ran his own companies. He was, as Yours Truly is, the child of a pharmacist — his father, my late uncle William, went to pharmacy school with my late father on the GI Bill after they served in World War II. Cousin Bill was a hearty man who enjoyed life. He was diagnosed with two heart ailments in the spring of 2022, and was doing well with treatment — until September, 2023. May he rest in eternal Peace.

What Yours Truly will present today regards how the COVID-19 virus itself, let alone the modRNA COVID-19 “vaccines”, can apparently induce a form of “accelerated aging” that Yours Truly will call “quasi-progeria.” This topic was presented and discussed on the board here some months ago. There is more information now about how this induced “accelerated aging” occurs.

The following is “not to weary by recitals”, in the words of the Duc de Saint-Simon, the memoirist, but some basic background information is useful.

There are several important “mechanical” body elements that are involved in the aging process: the mitochondria; the telomeres; and the endothelium, among others. Mitochondria are things called organelles and are found in cells. They have a kind of double “membrane” and perform a type of “breathing” called aerobic respiration. This respiration is then used by the cell as a chemical energy source. Telomeres are tiny areas on the ends of chromosomes that have nuclear sequences. When these sequences begin die off, they aren’t replaced; the telomeres simply “shorten” themselves. Cell death occurs when the telomeres become too short to “keep going.” The endothelium is the layer of cells that line the inner surface of the body’s blood vessels. Dysfunction of, or damage to, any or all of these organisms can have a negative effect on the aging process of the body. In the case of HGPS (Hutchinson-Gilford Progeria Syndrome, or, simply, progeria), these elements and more are involved in a body-wide rapid and progressive “early aging” condition that begins in early childhood and which is invariably fatal to the patient. Most people who have HGPS die before the age of 20, with severe heart complications leading to death as the cause. (Remember the item about heart complications for later on in this piece.)

It appears that there are elements within the SARS-CoV-2 virus (the COVID-19 virus) itself that damage or cause dysfunction to the mitochondria, the telomeres, and the endothelium of the body of someone who contracts an infection of the virus. Since the SARS-CoV-2 virus itself is the foundation of the COVID-19 “vaccines”, it is reasonable to assume, and arguable, that the elements that damage or cause dysfunction as described above will also be present in said “vaccines.” Without getting extremely technical, Yours Truly believes that a great deal of detailed investigation — and, possibly, experimentation — took place while the SARS-CoV-2 virus was in lab development in order for certain exact elements to be inserted into the virus which would specifically target certain exact mechanisms and elements of the mitochondria, the telomeres, and the endothelium of the body. One certain exact element, for example, could be the MCLK1 enzyme of the mitochondria, a reduced level of which causes dysfunction, oxidative distress, and ultimately cell death. “Mitochondria and Reactive Oxygen Species in Aging and Age-Related Diseases”, Carlotta Giorgi, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC8127332/

One now turns to the research of Walter M Chesnut on the topic of “accelerated aging” caused by the COVID-19 virus (and, by extension, the COVID-19 “vaccines.”) Mr. Chesnut has been writing on his blog (see below) about this “accelerated aging”, and what it does to the body, for over a year; for example, this blog post of January, 2023: https://wmcresearch.substack.com/p/urgentbreaking-updated-summation. The pull quote from this post: “The Wizard is indeed behind the curtain. We are seeing a 26-year-old die. But that 26-year-old has the organs of a 96-year-old. No surprise in rapid cancers, neurodegeneration, or sudden cardiac death — for a 96-year-old.”

Mr. Chesnut is writing about what the COVID-19 virus itself can do to “prematurely age” the body of a person who contracts a COVID-19 infection. Yours Truly will return to the charge regarding the modRNA COVID-19 “vaccines.”

The COVID-19 virus itself can be detected by the body of the infected person as an “enemy”, then destroyed and eliminated from the body by the natural immune system. Is it possible for the virus itself to damage the body of the infected person? Absolutely. Can this damage include negative effects to the mitochrondria, the telomeres, and the endothelium, among other areas of the body? It can. Can the damage impact what is now known as “Long COVID?” It can. Can a COVID-19 virus infection itself cause the death of the infected person? It can. However, if a person is “vaccinated” with modRNA COVID-19 “vaccines”, whether or not the “vaccinated” person also comes down with a COVID-19 infection, the situation is different, since these “vaccines” contain items that create more problems for the body: pseudouridine; lipid nanoparticles; the SV40 cancer gene promoter, and the presence of the PRRARSV “backdoor key”, among other things. The “vaccine” itself will induce a kind of continuous “fake COVID-19 infection” in the “vaccine” recipient, so the body will have to continually fight this off. The pseudouridine assists the “vaccine” to evade the body’s “are you an enemy” immune system detection defenses. The lipid nanoparticles (in and of themselves, dangerous) help to quickly spread the “vaccines” throughout the recipient’s body. The SV40 cancer promoter now has the door wide open to go to work. The PRRARSV “backdoor key” assists the “vaccine” elements to enter all the cells of the recipient’s body. The result, in Yours Truly’s opinion, is that the “vaccinated” person’s body is now much more vulnerable to all kinds of medical issues, from stroke to heart disease to “turbo cancer” to “accelerated aging”, among many others.

The Giorgi, et al., paper mentions several things that can mitigate the aging effects on the body caused by mitochondrial dysfunction: resveratrol; vitamin C; vitamin E; CoQ10; flavenoids; carotenoids; glutathione; melatonin; and exercise. Can these same things mitigate the “accelerated aging” that can happen in a COVID-19 “vaccinated” person? Possibly; along with following a spike protein detox / mitigate protocol such as found at the FLCCC website. Yours Truly will caution that people need to talk with their healthcare practitioner before adding a new element to their diet, vitamins or supplements, or changing the amount taken of an already-existing element.

What follows is a graphic of COVID-19 spike protein damage to the mitochondria, and links to papers, WMC Research, and to FLCCC.

Peace, Good Energy, Respect, PAVACA

https://i.postimg.cc/SQ6cRNCf/COVID-19-spike-protein-and-mitochondrial-damage.jpg

“The Hallmarks of Aging”, Carlos Lopez-Otin, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC3836174/pdf/emss-55354.pdf

https://wmcresearch.substack.com/p/confirmation-of-my-2021-hypothesis

https://wmcresearch.substack.com/p/mitochondrial-carpet-bombing-the

“Mitochondrial oxidative stress in aging and health span”, Peter S Rabinovitch, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC4013820/

https://covid19criticalcare.com/

Dear KMAG: 20231016 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

Pfizer-affirming care

noun

  • mRNA-based coronavirus vaccines manufactured by Pfizer
  • the dual-component COVID drug paxlovid
  • any drug or vaccine made by Pfizer or a subsidiary thereof.
  • prescription or administration of any of the above
  • legislation supporting any of the above
  • mandating any of the above

Shown in a picture

Shown in another picture


Assorted Tweets

On oldie but goody.

This post just makes me smile, too.

New CDC Director in 3….2….1….

While I think Rochelle’s replacement is pretty clueless, I did find one of her college pictures, when she was, like, totally serious!

Looks like Elon has a new vintage toy!

Truly, it is nice having a Twitter X CEO (no, I don’t mean Dorsey) who gets it.

What the heck! This chick will NOT get out of my Twitter X feed!

Bay area. Well, THAT makes sense.

And then there’s this. An important point.

Amen.

No, not that plan. The other one. The one that includes this plan, all other plans, and itself.

So how does that work?

Sorry – it’s complicated. Maybe just Trust In God for now!

How did they put it?

ENJOY THE SHOW

W


Dear KMAG: 20230612 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

With Wheatie style!

With our wonderful REALPOTUS in the lead!

HANG ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Let’s start off in a “Wheatie way” with some epic orchestral violins!

OK – how about some country music? I just heard this one on the radio. Never heard it before.

Now this is just interesting. YouTube keeps trying to suggest Taylor Swift to me, but the first song it suggested was a duet with one of the [Dixie] Chicks, which shows you exactly where Menshevik YouTube was trying to send me – to MARXIST QUISLING CITY.

Well, I looked further down the list of treasonous suggestions, and the same guest vocalist Luke Bryan in the above video is in this one, but it’s six years earlier.

Remember – Taylor Swift started off in country / folk. Then Hollywood does its thing.

Useful strategic information in the culture wars.

But let’s finish off with a real treat.

Some country line dancers send off one of their friends with his favorite song.

OK – I’m not done. ONE. MORE. SONG!!!

Let’s finish off with something “fresh” in SuSE world!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Take this one from Wolf. Be UNPERTURBED by what they’re doing to Trump.

Water rolling off the back. LOVE TRUMP MORE.

And if you have to – COOL OFF.

https://twitter.com/buitengebieden/status/1667977143060422656

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Week:


Wolbachia

proper noun (how to pronounce)

Wolbachia is a genus of intracellular bacteria that infects mainly arthropod species, including a high proportion of insects, and also some nematodes. It is one of the most common parasitic microbes, and is possibly the most common reproductive parasite in the biosphere. Its interactions with its hosts are often complex, and in some cases have evolved to be mutualistic rather than parasitic. Some host species cannot reproduce, or even survive, without Wolbachia colonization. One study concluded that more than 16% of neotropical insect species carry bacteria of this genus, and as many as 25 to 70% of all insect species are estimated to be potential hosts.

History of Wolbachia:

The genus was first identified in 1924 by Marshall Hertig and Simeon Burt Wolbach in the common house mosquito. They described it as “a somewhat pleomorphic, rodlike, Gram-negative, intracellular organism [that] apparently infects only the ovaries and testes“. Hertig formally described the species in 1936, and proposed both the generic and specific names: Wolbachia pipientis. Research on Wolbachia intensified after 1971, when Janice Yen and A. Ralph Barr of UCLA discovered that Culex mosquito eggs were killed by a cytoplasmic incompatibility when the sperm of Wolbachia-infected males fertilized infection-free eggs. The genus Wolbachia is of considerable interest today due to its ubiquitous distribution, its many different evolutionary interactions, and its potential use as a biocontrol agent.

Why Bill Gates is probably interested in Wolbachia:

Note: This is just the beginning. Look HERE for more.

These bacteria can infect many different types of organs, but are most notable for the infections of the testes and ovaries of their hosts. Wolbachia species are ubiquitous in mature eggs, but not mature sperm. Only infected females, therefore, pass the infection on to their offspring. Wolbachia bacteria maximize their spread by significantly altering the reproductive capabilities of their hosts, with four different phenotypes:

  • Male killing occurs when infected males die during larval development, which increases the rate of born, infected females.
  • Feminization results in infected males that develop as females or infertile pseudofemales. This is especially prevalent in Lepidoptera species such as the adzuki bean borer (Ostrinia scapulalis).
  • Parthenogenesis is reproduction of infected females without males. Some scientists have suggested that parthenogenesis may always be attributable to the effects of Wolbachia. Though this is not the case for the marbled crayfish. An example of parthenogenesis induced by presence of Wolbachia are some species within the Trichogramma parasitoid wasp genus, which have evolved to procreate without males due to the presence of Wolbachia. Males are rare in this genus of wasp, possibly because many have been killed by that same strain of Wolbachia.
  • Cytoplasmic incompatibility is the inability of Wolbachia-infected males to successfully reproduce with uninfected females or females infected with another Wolbachia strain. This reduces the reproductive success of those uninfected females and therefore promotes the infecting strain. In the cytoplasmic incompatibility mechanism, Wolbachia interferes with the parental chromosomes during the first mitotic divisions to the extent that they can no longer divide in synchrony.

Several host species, such as those within the genus Trichogramma, are so dependent on sexual differentiation of Wolbachia that they are unable to reproduce effectively without the bacteria in their bodies, and some might even be unable to survive uninfected.

One study on infected woodlice showed the broods of infected organisms had a higher proportion of females than their uninfected counterparts.

Wolbachia, especially Wolbachia-caused cytoplasmic incompatibility, may be important in promoting speciation. Wolbachia strains that distort the sex ratio may alter their host’s pattern of sexual selection in nature, and also engender strong selection to prevent their action, leading to some of the fastest examples of natural selection in natural populations.

The male killing and feminization effects of Wolbachia infections can also lead to speciation in their hosts. For example, populations of the pill woodlouse, Armadillidium vulgare which are exposed to the feminizing effects of Wolbachia, have been known to lose their female-determining chromosome. In these cases, only the presence of Wolbachia can cause an individual to develop into a female. Cryptic species of ground wētā (Hemiandrus maculifrons complex) are host to different lineages of Wolbachia which might explain their speciation without ecological or geographical separation.

Wolbachia infection has been linked to viral resistance in Drosophila melanogaster, Drosophila simulans, and mosquito species. Flies, including mosquitoes, infected with the bacteria are more resistant to RNA viruses such as Drosophila C virus, norovirus, flock house virus, cricket paralysis virus, chikungunya virus, and West Nile virus.

In the common house mosquito, higher levels of Wolbachia were correlated with more insecticide resistance.

In leafminers of the species Phyllonorycter blancardella, Wolbachia bacteria help their hosts produce green islands on yellowing tree leaves, that is, small areas of leaf remaining fresh, allowing the hosts to continue feeding while growing to their adult forms. Larvae treated with tetracycline, which kills Wolbachia, lose this ability and subsequently only 13% emerge successfully as adult moths.

Muscidifurax uniraptor, a parasitoid wasp, also benefits from hosting Wolbachia bacteria.

In the parasitic filarial nematode species responsible for elephantiasis, such as Brugia malayi and Wuchereria bancrofti, Wolbachia has become an obligate endosymbiont and provides the host with chemicals necessary for its reproduction and survival. Elimination of the Wolbachia symbionts through antibiotic treatment therefore prevents reproduction of the nematode, and eventually results in its premature death.

Some Wolbachia species that infect arthropods also provide some metabolic provisioning to their hosts. In Drosophila melanogaster, Wolbachia is found to mediate iron metabolism under nutritional stress and in Cimex lectularius, the Wolbachia strain cCle helps the host to synthesize B vitamins.

Some Wolbachia strains have increased their prevalence by increasing their hosts’ fecundity. Wolbachia strains captured from 1988 in southern California still induce a fecundity deficit, but nowadays the fecundity deficit is replaced with a fecundity advantage such that infected Drosophila simulans produces more offspring than the uninfected ones.

Wolbachia often manipulates host reproduction and life-history in a way that favours its own propagation. In the Pharaoh ant, Wolbachia infection correlates with increased colony-level production of reproductives (i.e., greater reproductive investment), and earlier onset of reproductive production (i.e., shorter life-cycle). Infected colonies also seem to grow more rapidly. There is substantial evidence that the presence of Wolbachia that induce parthenogenesis have put pressure on species to reproduce primarily or entirely this way.

Additionally, Wolbachia has been seen to decrease the lifespan of Aedes aegypti, carriers of mosquito-borne diseases, and it decreases their efficacy of pathogen transmission because older mosquitoes are more likely to have become carriers of one of those diseases. This has been exploited as a method for pest control.

The first Wolbachia genome to be determined was that of one that infects D. melanogaster fruit flies. This genome was sequenced at The Institute for Genomic Research in a collaboration between Jonathan Eisen and Scott O’Neill. The second Wolbachia genome to be determined was one that infects Brugia malayi nematodes. Genome sequencing projects for several other Wolbachia strains are in progress. A nearly complete copy of the Wolbachia genome sequence was found within the genome sequence of the fruit fly Drosophila ananassae and large segments were found in seven other Drosophila species.

In an application of DNA barcoding to the identification of species of Protocalliphora flies, several distinct morphospecies had identical cytochrome c oxidase I gene sequences, most likely through horizontal gene transfer (HGT) by Wolbachia species as they jump across host species. As a result, Wolbachia can cause misleading results in molecular cladistical analyses. It is estimated that between 20 and 50 percent of insect species have evidence of HGT from Wolbachia—passing from microbes to animal (i.e. insects).

Wolbachia species also harbor a bacteriophage called bacteriophage WO or phage WO. Comparative sequence analyses of bacteriophage WO offer some of the most compelling examples of large-scale horizontal gene transfer between Wolbachia coinfections in the same host. It is the first bacteriophage implicated in frequent lateral transfer between the genomes of bacterial endosymbionts. Gene transfer by bacteriophages could drive significant evolutionary change in the genomes of intracellular bacteria that were previously considered highly stable or prone to loss of genes over time.

The small non-coding RNAs WsnRNA-46 and WsnRNA-59 in Wolbachia were detected in Aedes aegypti mosquitoes and Drosophila melanogaster. The small RNAs (sRNAs) may regulate bacterial and host genes. Highly conserved intragenic region sRNA called ncrwmel02 was also identified in Wolbachia pipientis. It is expressed in four different strains in a regulated pattern that differs according to the sex of the host and the tissue localisation. This suggested that the sRNA may play important roles in the biology of Wolbachia.

Outside of insects, Wolbachia infects a variety of isopod species, spiders, mites, and many species of filarial nematodes (a type of parasitic worm), including those causing onchocerciasis (river blindness) and elephantiasis in humans, as well as heartworms in dogs. Not only are these disease-causing filarial worms infected with Wolbachia, but Wolbachia also seems to play an inordinate role in these diseases.

A large part of the pathogenicity of filarial nematodes is due to host immune response toward their Wolbachia. Elimination of Wolbachia from filarial nematodes generally results in either death or sterility of the nematode. Consequently, current strategies for control of filarial nematode diseases include elimination of their symbiotic Wolbachia via the simple doxycycline antibiotic, rather than directly killing the nematode with often more toxic antinematode medications.

For more, see Wikipedia: https://en.wikipedia.org/wiki/Wolbachia


ENJOY THE SHOW

Have a great week!

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]