The Infamous “Process 2” Manufacturing Method for the Pfizer-BioNTech modRNA COVID-19 “Vaccines”

The image above is a still from Just Imagine, a 1930 movie about what life in New York City would be like in the year 1980.

This series of pieces on the disaster of COVID-19 (the virus and the modRNA “vaccines” for said virus) is dedicated to the memory of Yours Truly’s cousin Bill, who “died suddenly and unexpectedly” in September, 2023. May he rest in eternal Peace.

Three prefatory notes: One, that what is presented here is only “scratching the surface” regarding the substitution of “Process 2” for the original “Process 1” manufacturing method for the Pfizer-BioNTech “flagship” COVID-19 “vaccine”, BNT162b2; Two, the exact and complete details of “Process 2” are likely a “trade secret” to the company (except that a full description may be in a document given by said company to the FDA, and which was “redacted out” in case it ever got published under FOIA); and, Three, that every Pfizer-BioNTech COVID-19 “vaccine” since October, 2020, has been made using “Process 2” — including the “latest” version, the “2023-2024 Formula” version for use against the (now basically obsolete) XBB.1.5 Omicron variant.

The trail in regards a discussion of the sudden change from the original “Process 1” to the substituted “Process 2” for BNT162b2 can potentially begin in several places; for purposes of today’s presentation, it will begin here: www.bmj.com/content/378/bmj.o1731/rr-2, a letter to the British Medical Journal by Josh Guetzkow, a senior lecturer at Hebrew University in Jerusalem, in response to the BMJ article, “Covid-19: Researchers face wait for patient level data from Pfizer and Moderna vaccine trials.” Prof. Guetzkow points out that the initial clinical trials doses of the Pfizer-BioNTech modRNA COVID-19 “vaccine”, BNT162b2, were made using what was called “Process 1”, from May to October, 2020; but that the company suddenly changed to a new method, called “Process 2” [by 29 October 2020.] He also points out that the “Process 2” batches of BNT162b2 were found to have “…substantially lower mRNA integrity.” It appears that “substantially lower mRNA integrity” includes evidence of what may be termed “fragments” of DNA appearing in these “vaccines”, where they should never be.

Please bear with Yours Truly, this may get a little “technical”, but it is necessary to the whole.

So, what exactly happened by October 2020 that led Pfizer-BioNTech to change to “Process 2” for BNT162b2? One hint is found on Page 54 of the “Protocol Amendment 9, 29 October 2020” document that the company gave to the FDA (www.nejm.org/doi/suppl/10.1056/NEJMoa2034577; scroll down to “Protocol PDF” and click to get the entire document):

Another hint is found on Page 3 of the same document:

It would appear, then, that Pfizer-BioNTech decided, sometime between 1 May and 1 October 2020, to, One: add an “additional exploratory objective” to the C4591001 clinical study of BNT162b2;, and, Two, to support “increased supply” (of BNT162b2, presumably after securing Emergency Use Authorizations from the European Union medicines regulatory agency and from the FDA in the United States to use the “vaccine”, which did happen) — both, by changing from “Process 1” to “Process 2” to manufacture the product. Prof. Guetzkow states that there appears to be no analysis of comparisons between using these two methods. It is also, from what Yours Truly has been able to find, not known exactly when “Process 1” was stopped as a manufacturing method for BNT162b2 and “Process 2” was approved as the sole method.

We now turn to Page 4 of the FDA-issued “Emergency Use Authorization (EUA) for an Unapproved Product Review Memorandum” of 23 June 2023, related to the EUA the agency granted for the use of the Pfizer-BioNTech “2023-2024 Formula” COVID-19 “vaccine” on people ages 6 months to 5 years old in the United States (www.fda.gov/media/172019/download.) Page 4, in Yours Truly’s opinion, is a tacit admission that this “vaccine” is indeed made according to “Process 2”:

Finally, there is the following hint in the description of the manufacturing process for the Pfizer-BioNTech “vaccine” against meningitis, called PENBRAYA, in the 11 DESCRIPTION section of the company-issued document (https://labeling.pfizer.com/ShowLabeling.aspx?id=19937):

The work of Dr. Kevin McKernan, Dr. Jessica Rose, and other researchers, has shown that there are numerous serious issues with the integrity of the process of manufacturing BNT162b2 — the “Process 2” that was used to make billions of doses of this Pfizer-BioNTech modRNA COVID-19 “vaccine” — and which process is being used to manufacture the company’s latest modRNA COVID-19 “vaccine”, the “2023-2024 Formula.” These two scientists, along with other colleagues, published a paper on this situation last month. It can be found here: www.researchgate.net/publication/374870815. The paper also has some more details of the “Process 2” method — and, by the way, also stating that Moderna also came up with a similar process for its modRNA COVID-19 “vaccines.”

One suspects that the integrity problems with the manufacturing of the modRNA COVID-19 “vaccines” is a subject that will have much more investigation. This is aside from the accumulating evidence that the ingredients of said “vaccines” are themselves dangerous.

Peace, Good Energy, Respect: PAVACA

The COVID-19 Virus and the modRNA COVID-19 “Vaccines” Induce Accelerated Aging

https://i.postimg.cc/gch5SRRq/Ponce-de-Leon-and-the-mythical-Fountain-of-Youth.jpg

Prefatory Note: This series of pieces on the ongoing disaster of COVID-19 and the COVID-19 “vaccines” is dedicated to my late cousin Bill, who “died suddenly and unexpectedly” in September, 2023. He was a quiet-spoken man, studied philosophy at Notre Dame, owned and ran his own companies. He was, as Yours Truly is, the child of a pharmacist — his father, my late uncle William, went to pharmacy school with my late father on the GI Bill after they served in World War II. Cousin Bill was a hearty man who enjoyed life. He was diagnosed with two heart ailments in the spring of 2022, and was doing well with treatment — until September, 2023. May he rest in eternal Peace.

What Yours Truly will present today regards how the COVID-19 virus itself, let alone the modRNA COVID-19 “vaccines”, can apparently induce a form of “accelerated aging” that Yours Truly will call “quasi-progeria.” This topic was presented and discussed on the board here some months ago. There is more information now about how this induced “accelerated aging” occurs.

The following is “not to weary by recitals”, in the words of the Duc de Saint-Simon, the memoirist, but some basic background information is useful.

There are several important “mechanical” body elements that are involved in the aging process: the mitochondria; the telomeres; and the endothelium, among others. Mitochondria are things called organelles and are found in cells. They have a kind of double “membrane” and perform a type of “breathing” called aerobic respiration. This respiration is then used by the cell as a chemical energy source. Telomeres are tiny areas on the ends of chromosomes that have nuclear sequences. When these sequences begin die off, they aren’t replaced; the telomeres simply “shorten” themselves. Cell death occurs when the telomeres become too short to “keep going.” The endothelium is the layer of cells that line the inner surface of the body’s blood vessels. Dysfunction of, or damage to, any or all of these organisms can have a negative effect on the aging process of the body. In the case of HGPS (Hutchinson-Gilford Progeria Syndrome, or, simply, progeria), these elements and more are involved in a body-wide rapid and progressive “early aging” condition that begins in early childhood and which is invariably fatal to the patient. Most people who have HGPS die before the age of 20, with severe heart complications leading to death as the cause. (Remember the item about heart complications for later on in this piece.)

It appears that there are elements within the SARS-CoV-2 virus (the COVID-19 virus) itself that damage or cause dysfunction to the mitochondria, the telomeres, and the endothelium of the body of someone who contracts an infection of the virus. Since the SARS-CoV-2 virus itself is the foundation of the COVID-19 “vaccines”, it is reasonable to assume, and arguable, that the elements that damage or cause dysfunction as described above will also be present in said “vaccines.” Without getting extremely technical, Yours Truly believes that a great deal of detailed investigation — and, possibly, experimentation — took place while the SARS-CoV-2 virus was in lab development in order for certain exact elements to be inserted into the virus which would specifically target certain exact mechanisms and elements of the mitochondria, the telomeres, and the endothelium of the body. One certain exact element, for example, could be the MCLK1 enzyme of the mitochondria, a reduced level of which causes dysfunction, oxidative distress, and ultimately cell death. “Mitochondria and Reactive Oxygen Species in Aging and Age-Related Diseases”, Carlotta Giorgi, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC8127332/

One now turns to the research of Walter M Chesnut on the topic of “accelerated aging” caused by the COVID-19 virus (and, by extension, the COVID-19 “vaccines.”) Mr. Chesnut has been writing on his blog (see below) about this “accelerated aging”, and what it does to the body, for over a year; for example, this blog post of January, 2023: https://wmcresearch.substack.com/p/urgentbreaking-updated-summation. The pull quote from this post: “The Wizard is indeed behind the curtain. We are seeing a 26-year-old die. But that 26-year-old has the organs of a 96-year-old. No surprise in rapid cancers, neurodegeneration, or sudden cardiac death — for a 96-year-old.”

Mr. Chesnut is writing about what the COVID-19 virus itself can do to “prematurely age” the body of a person who contracts a COVID-19 infection. Yours Truly will return to the charge regarding the modRNA COVID-19 “vaccines.”

The COVID-19 virus itself can be detected by the body of the infected person as an “enemy”, then destroyed and eliminated from the body by the natural immune system. Is it possible for the virus itself to damage the body of the infected person? Absolutely. Can this damage include negative effects to the mitochrondria, the telomeres, and the endothelium, among other areas of the body? It can. Can the damage impact what is now known as “Long COVID?” It can. Can a COVID-19 virus infection itself cause the death of the infected person? It can. However, if a person is “vaccinated” with modRNA COVID-19 “vaccines”, whether or not the “vaccinated” person also comes down with a COVID-19 infection, the situation is different, since these “vaccines” contain items that create more problems for the body: pseudouridine; lipid nanoparticles; the SV40 cancer gene promoter, and the presence of the PRRARSV “backdoor key”, among other things. The “vaccine” itself will induce a kind of continuous “fake COVID-19 infection” in the “vaccine” recipient, so the body will have to continually fight this off. The pseudouridine assists the “vaccine” to evade the body’s “are you an enemy” immune system detection defenses. The lipid nanoparticles (in and of themselves, dangerous) help to quickly spread the “vaccines” throughout the recipient’s body. The SV40 cancer promoter now has the door wide open to go to work. The PRRARSV “backdoor key” assists the “vaccine” elements to enter all the cells of the recipient’s body. The result, in Yours Truly’s opinion, is that the “vaccinated” person’s body is now much more vulnerable to all kinds of medical issues, from stroke to heart disease to “turbo cancer” to “accelerated aging”, among many others.

The Giorgi, et al., paper mentions several things that can mitigate the aging effects on the body caused by mitochondrial dysfunction: resveratrol; vitamin C; vitamin E; CoQ10; flavenoids; carotenoids; glutathione; melatonin; and exercise. Can these same things mitigate the “accelerated aging” that can happen in a COVID-19 “vaccinated” person? Possibly; along with following a spike protein detox / mitigate protocol such as found at the FLCCC website. Yours Truly will caution that people need to talk with their healthcare practitioner before adding a new element to their diet, vitamins or supplements, or changing the amount taken of an already-existing element.

What follows is a graphic of COVID-19 spike protein damage to the mitochondria, and links to papers, WMC Research, and to FLCCC.

Peace, Good Energy, Respect, PAVACA

https://i.postimg.cc/SQ6cRNCf/COVID-19-spike-protein-and-mitochondrial-damage.jpg

“The Hallmarks of Aging”, Carlos Lopez-Otin, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC3836174/pdf/emss-55354.pdf

https://wmcresearch.substack.com/p/confirmation-of-my-2021-hypothesis

https://wmcresearch.substack.com/p/mitochondrial-carpet-bombing-the

“Mitochondrial oxidative stress in aging and health span”, Peter S Rabinovitch, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC4013820/

https://covid19criticalcare.com/

Dear KMAG: 20231016 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

Pfizer-affirming care

noun

  • mRNA-based coronavirus vaccines manufactured by Pfizer
  • the dual-component COVID drug paxlovid
  • any drug or vaccine made by Pfizer or a subsidiary thereof.
  • prescription or administration of any of the above
  • legislation supporting any of the above
  • mandating any of the above

Shown in a picture

Shown in another picture


Assorted Tweets

On oldie but goody.

This post just makes me smile, too.

New CDC Director in 3….2….1….

While I think Rochelle’s replacement is pretty clueless, I did find one of her college pictures, when she was, like, totally serious!

Looks like Elon has a new vintage toy!

Truly, it is nice having a Twitter X CEO (no, I don’t mean Dorsey) who gets it.

What the heck! This chick will NOT get out of my Twitter X feed!

Bay area. Well, THAT makes sense.

And then there’s this. An important point.

Amen.

No, not that plan. The other one. The one that includes this plan, all other plans, and itself.

So how does that work?

Sorry – it’s complicated. Maybe just Trust In God for now!

How did they put it?

ENJOY THE SHOW

W


Dear KMAG: 20230612 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

With Wheatie style!

With our wonderful REALPOTUS in the lead!

HANG ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Let’s start off in a “Wheatie way” with some epic orchestral violins!

OK – how about some country music? I just heard this one on the radio. Never heard it before.

Now this is just interesting. YouTube keeps trying to suggest Taylor Swift to me, but the first song it suggested was a duet with one of the [Dixie] Chicks, which shows you exactly where Menshevik YouTube was trying to send me – to MARXIST QUISLING CITY.

Well, I looked further down the list of treasonous suggestions, and the same guest vocalist Luke Bryan in the above video is in this one, but it’s six years earlier.

Remember – Taylor Swift started off in country / folk. Then Hollywood does its thing.

Useful strategic information in the culture wars.

But let’s finish off with a real treat.

Some country line dancers send off one of their friends with his favorite song.

OK – I’m not done. ONE. MORE. SONG!!!

Let’s finish off with something “fresh” in SuSE world!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Take this one from Wolf. Be UNPERTURBED by what they’re doing to Trump.

Water rolling off the back. LOVE TRUMP MORE.

And if you have to – COOL OFF.

https://twitter.com/buitengebieden/status/1667977143060422656

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Week:


Wolbachia

proper noun (how to pronounce)

Wolbachia is a genus of intracellular bacteria that infects mainly arthropod species, including a high proportion of insects, and also some nematodes. It is one of the most common parasitic microbes, and is possibly the most common reproductive parasite in the biosphere. Its interactions with its hosts are often complex, and in some cases have evolved to be mutualistic rather than parasitic. Some host species cannot reproduce, or even survive, without Wolbachia colonization. One study concluded that more than 16% of neotropical insect species carry bacteria of this genus, and as many as 25 to 70% of all insect species are estimated to be potential hosts.

History of Wolbachia:

The genus was first identified in 1924 by Marshall Hertig and Simeon Burt Wolbach in the common house mosquito. They described it as “a somewhat pleomorphic, rodlike, Gram-negative, intracellular organism [that] apparently infects only the ovaries and testes“. Hertig formally described the species in 1936, and proposed both the generic and specific names: Wolbachia pipientis. Research on Wolbachia intensified after 1971, when Janice Yen and A. Ralph Barr of UCLA discovered that Culex mosquito eggs were killed by a cytoplasmic incompatibility when the sperm of Wolbachia-infected males fertilized infection-free eggs. The genus Wolbachia is of considerable interest today due to its ubiquitous distribution, its many different evolutionary interactions, and its potential use as a biocontrol agent.

Why Bill Gates is probably interested in Wolbachia:

Note: This is just the beginning. Look HERE for more.

These bacteria can infect many different types of organs, but are most notable for the infections of the testes and ovaries of their hosts. Wolbachia species are ubiquitous in mature eggs, but not mature sperm. Only infected females, therefore, pass the infection on to their offspring. Wolbachia bacteria maximize their spread by significantly altering the reproductive capabilities of their hosts, with four different phenotypes:

  • Male killing occurs when infected males die during larval development, which increases the rate of born, infected females.
  • Feminization results in infected males that develop as females or infertile pseudofemales. This is especially prevalent in Lepidoptera species such as the adzuki bean borer (Ostrinia scapulalis).
  • Parthenogenesis is reproduction of infected females without males. Some scientists have suggested that parthenogenesis may always be attributable to the effects of Wolbachia. Though this is not the case for the marbled crayfish. An example of parthenogenesis induced by presence of Wolbachia are some species within the Trichogramma parasitoid wasp genus, which have evolved to procreate without males due to the presence of Wolbachia. Males are rare in this genus of wasp, possibly because many have been killed by that same strain of Wolbachia.
  • Cytoplasmic incompatibility is the inability of Wolbachia-infected males to successfully reproduce with uninfected females or females infected with another Wolbachia strain. This reduces the reproductive success of those uninfected females and therefore promotes the infecting strain. In the cytoplasmic incompatibility mechanism, Wolbachia interferes with the parental chromosomes during the first mitotic divisions to the extent that they can no longer divide in synchrony.

Several host species, such as those within the genus Trichogramma, are so dependent on sexual differentiation of Wolbachia that they are unable to reproduce effectively without the bacteria in their bodies, and some might even be unable to survive uninfected.

One study on infected woodlice showed the broods of infected organisms had a higher proportion of females than their uninfected counterparts.

Wolbachia, especially Wolbachia-caused cytoplasmic incompatibility, may be important in promoting speciation. Wolbachia strains that distort the sex ratio may alter their host’s pattern of sexual selection in nature, and also engender strong selection to prevent their action, leading to some of the fastest examples of natural selection in natural populations.

The male killing and feminization effects of Wolbachia infections can also lead to speciation in their hosts. For example, populations of the pill woodlouse, Armadillidium vulgare which are exposed to the feminizing effects of Wolbachia, have been known to lose their female-determining chromosome. In these cases, only the presence of Wolbachia can cause an individual to develop into a female. Cryptic species of ground wētā (Hemiandrus maculifrons complex) are host to different lineages of Wolbachia which might explain their speciation without ecological or geographical separation.

Wolbachia infection has been linked to viral resistance in Drosophila melanogaster, Drosophila simulans, and mosquito species. Flies, including mosquitoes, infected with the bacteria are more resistant to RNA viruses such as Drosophila C virus, norovirus, flock house virus, cricket paralysis virus, chikungunya virus, and West Nile virus.

In the common house mosquito, higher levels of Wolbachia were correlated with more insecticide resistance.

In leafminers of the species Phyllonorycter blancardella, Wolbachia bacteria help their hosts produce green islands on yellowing tree leaves, that is, small areas of leaf remaining fresh, allowing the hosts to continue feeding while growing to their adult forms. Larvae treated with tetracycline, which kills Wolbachia, lose this ability and subsequently only 13% emerge successfully as adult moths.

Muscidifurax uniraptor, a parasitoid wasp, also benefits from hosting Wolbachia bacteria.

In the parasitic filarial nematode species responsible for elephantiasis, such as Brugia malayi and Wuchereria bancrofti, Wolbachia has become an obligate endosymbiont and provides the host with chemicals necessary for its reproduction and survival. Elimination of the Wolbachia symbionts through antibiotic treatment therefore prevents reproduction of the nematode, and eventually results in its premature death.

Some Wolbachia species that infect arthropods also provide some metabolic provisioning to their hosts. In Drosophila melanogaster, Wolbachia is found to mediate iron metabolism under nutritional stress and in Cimex lectularius, the Wolbachia strain cCle helps the host to synthesize B vitamins.

Some Wolbachia strains have increased their prevalence by increasing their hosts’ fecundity. Wolbachia strains captured from 1988 in southern California still induce a fecundity deficit, but nowadays the fecundity deficit is replaced with a fecundity advantage such that infected Drosophila simulans produces more offspring than the uninfected ones.

Wolbachia often manipulates host reproduction and life-history in a way that favours its own propagation. In the Pharaoh ant, Wolbachia infection correlates with increased colony-level production of reproductives (i.e., greater reproductive investment), and earlier onset of reproductive production (i.e., shorter life-cycle). Infected colonies also seem to grow more rapidly. There is substantial evidence that the presence of Wolbachia that induce parthenogenesis have put pressure on species to reproduce primarily or entirely this way.

Additionally, Wolbachia has been seen to decrease the lifespan of Aedes aegypti, carriers of mosquito-borne diseases, and it decreases their efficacy of pathogen transmission because older mosquitoes are more likely to have become carriers of one of those diseases. This has been exploited as a method for pest control.

The first Wolbachia genome to be determined was that of one that infects D. melanogaster fruit flies. This genome was sequenced at The Institute for Genomic Research in a collaboration between Jonathan Eisen and Scott O’Neill. The second Wolbachia genome to be determined was one that infects Brugia malayi nematodes. Genome sequencing projects for several other Wolbachia strains are in progress. A nearly complete copy of the Wolbachia genome sequence was found within the genome sequence of the fruit fly Drosophila ananassae and large segments were found in seven other Drosophila species.

In an application of DNA barcoding to the identification of species of Protocalliphora flies, several distinct morphospecies had identical cytochrome c oxidase I gene sequences, most likely through horizontal gene transfer (HGT) by Wolbachia species as they jump across host species. As a result, Wolbachia can cause misleading results in molecular cladistical analyses. It is estimated that between 20 and 50 percent of insect species have evidence of HGT from Wolbachia—passing from microbes to animal (i.e. insects).

Wolbachia species also harbor a bacteriophage called bacteriophage WO or phage WO. Comparative sequence analyses of bacteriophage WO offer some of the most compelling examples of large-scale horizontal gene transfer between Wolbachia coinfections in the same host. It is the first bacteriophage implicated in frequent lateral transfer between the genomes of bacterial endosymbionts. Gene transfer by bacteriophages could drive significant evolutionary change in the genomes of intracellular bacteria that were previously considered highly stable or prone to loss of genes over time.

The small non-coding RNAs WsnRNA-46 and WsnRNA-59 in Wolbachia were detected in Aedes aegypti mosquitoes and Drosophila melanogaster. The small RNAs (sRNAs) may regulate bacterial and host genes. Highly conserved intragenic region sRNA called ncrwmel02 was also identified in Wolbachia pipientis. It is expressed in four different strains in a regulated pattern that differs according to the sex of the host and the tissue localisation. This suggested that the sRNA may play important roles in the biology of Wolbachia.

Outside of insects, Wolbachia infects a variety of isopod species, spiders, mites, and many species of filarial nematodes (a type of parasitic worm), including those causing onchocerciasis (river blindness) and elephantiasis in humans, as well as heartworms in dogs. Not only are these disease-causing filarial worms infected with Wolbachia, but Wolbachia also seems to play an inordinate role in these diseases.

A large part of the pathogenicity of filarial nematodes is due to host immune response toward their Wolbachia. Elimination of Wolbachia from filarial nematodes generally results in either death or sterility of the nematode. Consequently, current strategies for control of filarial nematode diseases include elimination of their symbiotic Wolbachia via the simple doxycycline antibiotic, rather than directly killing the nematode with often more toxic antinematode medications.

For more, see Wikipedia: https://en.wikipedia.org/wiki/Wolbachia


ENJOY THE SHOW

Have a great week!

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do?


TL;DR –

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.


The central dogma of molecular biology. They shilled the blue arrows to the masses as lies about safety, while hiding the special red arrow and actually working to open it up for business.


Show-Time (Introduction)

I have finally realized that I need to spell out, in as many ways as needed, what is really going on with SARS-CoV-2 and these derived mRNA vaccines.

I had hoped that people would see the implications of the science which is now open to us, with the publication of first the Jaenish paper, then the De Marinis paper, and finally the Mehedi paper. I have commented extensively on each one of these papers, including very recently on the Mehedi paper, which really makes things obvious. I had thought that somebody more notable than me would try to make the point I am about to make. Sadly, nobody has, so it looks like I’m going to have to do it.

These vaccines are designed to BEGIN to change us on a fundamental level which is not exactly the same as the “transhumanism” that constitutes most of the “clickbait” against the vaccines. It’s similar, but it’s not the same. What we see in the clickbait is a distraction from the actual danger, which is not strange and distant and unbelievable, but is in fact right here, and right now, and very believable, once you understand it.

The truth is a lot more like GATTACA, and a lot less like Transcendence.

It’s already starting, and the infrastructure is being set up. The first step has actually been accomplished, and it was in many ways a HUGE success.

Humans ARE being engineered right in front of our eyes. I hope that you can see this point by the end of this article.

They (meaning WEF and its backers) hacked the human cell nucleus on a population genome level. They created a “Trojan” virus that appears to have “zero-dayed” the human cell nucleus. Artfully, the hack is a lot like state-level “APT” (advanced persistent threat) computer hacks, in that it gets in and holds the door open. Of course, better models can be created, but the self-replicating crowbar for the cell nucleus has obviously arrived, and its imperial version of SPQR is PRRARSV.

THAT is the fundamental advance that was achieved here.

I have to say, it was ingenious and “admirable”, in several senses – scientific, military, and criminal. Of course, your mileage may vary on “admirable”. Many will consider it “diabolical”.

What we are facing is the immediate REAL danger of biological engineering and eugenics, which was employed in a fantasy way, as a technical MacGuffin, in various episodes and productions in the Star Trek universe.

This is a scene from Star Trek II: The Wrath of Khan. These two people are “superhumans” who (according to the story) proved to be disastrous for Earth, during our current century (more or less). The one on the right is “Khan” – obviously in homage to Genghis Khan and his relatives, who ruled much of Asia for centuries.

Don’t get lost in the fantasy stuff. THAT is not the big danger. Stick around for an explanation of the reality which is actually upon us.

Here is how Wikipedia describes Khan, but more importantly, where he CAME FROM.


Khan Noonien Singh is a fictional character in the Star Trek science fiction franchise, who first appeared as the main antagonist in the Star Trek: The Original Series episode “Space Seed” (1967), and was portrayed by Ricardo Montalbán, who reprised his role in the 1982 film Star Trek II: The Wrath of Khan. In the 2013 film Star Trek Into Darkness, he is portrayed by Benedict Cumberbatch.

Khan had controlled more than a quarter of the Earth during the Eugenics Wars of the 1990s.[1] After being revived from suspended animation in 2267 by the crew of the Starship Enterprise, Khan attempts to capture the starship but is thwarted by James T. Kirk and exiled to Ceti Alpha V, where he has the chance to create a new society with his people. In Star Trek II: The Wrath of Khan, set fifteen years after “Space Seed”, Khan escapes his exile and sets out to exact revenge upon Kirk.

In Star Trek Into Darkness, set in the alternate continuity established in Star Trek (2009), Khan is awakened almost a decade before the events of “Space Seed“. Khan is given the false identity John Harrison and coerced by Admiral Marcus into building weapons for Section 31 and Starfleet in exchange for the lives of Khan’s crew. He ultimately rebels and comes into conflict with the crew of Enterprise.


OK – so what are the “Eugenics Wars”?

Back to Wikipedia…..


When the original series of Star Trek was produced, the 1990s were several decades away, and so various elements of the backstory to Star Trek are set in that era, particularly the Eugenics Wars. The references to the Eugenics Wars and to a nuclear war in the 21st century are somewhat contradictory.

The episode “Space Seed” establishes the Eugenics Wars, and has them lasting from 1992 to 1996. The Eugenics Wars are described as a global conflict in which the progeny of a human genetic engineering project, most notably Khan Noonien Singh, established themselves as supermen and attempted world domination. Spock calls them “the last of your so-called World Wars”, and McCoy identifies this with the Eugenics Wars.


OK – don’t get me wrong. I’m not saying it’s EXACTLY like Star Trek, although I do subscribe to the folk notion that Star Trek is a VERY good predictor of things that are likely to happen.

What I AM saying is that genetic engineering of humanity has already started, and now I’m going to explain why this is so.

We will take a brief tour into the PAST, before we return to the future. If a light bulb comes on, keep it lit!


You cannot uninvent the genetic Tommy-gun, nor the gun moll who knows how to code.

Bonnie & Clyde of the Nucleus

BANKS make a really great analogy of the cell nucleus.

  • they’re common and everywhere
  • they contain valuable stuff that needs to be protected yet dispersed
  • they have high security
  • things need to traffic securely in and out of them

Breaking into a bank with very high security is a lot like what the spike protein does. But the spike protein doesn’t do it alone. THAT is an important point from the three papers I keep mentioning. The spike protein has a PARTNER who has all the plans.

OK – just for the record – this is going to deviate a little bit from the ACTUAL story of Bonnie and Clyde. Just warning you – it will get weird.

The spike protein and the spike protein mRNA are a PAIR, and together, they are able to not only break into the bank, but to totally take it over, and keep it taken over. And then to take over more banks.

Here is how it works.

The spike protein is Clyde. He’s got a gun, and he causes all kinds of trouble with it. He’s the “action” guy. He knows how to break into banks, mostly because he has a phony ID that always gets him in. The phony ID says PRRARSV in big letters on it, which makes all the bank guards at Cell Nucleus Bank and Trust say “Why, welcome, Mr. Barrow! We’re pleased to see you at the bank today! Come right on in!”

Or, to use a different analogy…..

These bank guards are such chumps, but it works every time.

Well, here is the problem for the bank. When Clyde goes in, he always brings his partner Bonnie. And SHE is trouble. She’s not so good with a gun or a fake ID, but she is a real scam artist, who knows how to get into the bank and embezzle the hell out of it.

Bonnie gets into the cell nucleus bank, and with some help from Clyde, she gets a permanent job there. Bonnie and Clyde are set for life. None of this “grab the cash, run out, get caught, and die in a hail of bullets” shit. No sir! THIS Bonnie and Clyde are smart.

Bonnie trains many of the new girls at the bank – and like the pod people in “Invasion of the Body Snatchers”, she turns every last one of them into exact copies of HERSELF. NASTY! So all these fresh Bonnies are trained by the bank and sent out to get into new banks.

But wait! Bonnie can’t get into banks. Bonnie doesn’t have a gun or a fake ID! How can she get into more banks?

Easy! Bonnie and all her Bonnie clones have the power of multiplication – not just to make more copies of each one herself, but to make more Clydes. Bonnie makes more copies of herself while she’s IN the bank, and she makes copies of Clyde while she’s OUT of the bank.

So every Bonnie that leaves the bank, creates hundreds of new Clydes on the outside. The next time Bonnie wanders near a bank, there are bound to be dozens of Clydes just hanging around, ready to escort her, and maybe even other gals [important], into the bank. If no Bonnie is already working there, she gets a job, and the process starts over.

The KEY POINT is that BONNIE makes the CLYDES who can get her, or women like her, into the next bank.

Bonnie can’t get into the bank, and Clyde can’t get a job in the bank, but together, they can make a living by embezzling banks.

Side Note: This is a beautiful example of a contradiction in the Marxist sense. Proteins and nucleic acids can’t do certain things alone, and thus NEED EACH OTHER.

Once Bonnie is on the payroll, this fact introduces a permanent security problem in the bank, and for all other banks.

And why is that?

Once Bonnie is on the payroll, you can’t get rid of her.

She will just create more Bonnies and more Clydes, and they will scam more banks.

In terms of banks, banks can resist just Clyde or just Bonnie, but they can’t resist the pair.

In terms of the cell nucleus, it can resist the spike protein or the spike mRNA, but it cannot resist both of them together.

Which pair, oddly, is exactly what the vaccines create.

WHAT ARE THE CHANCES?


We can use other analogies, using banks, which emphasize the spike protein more.

Imagine a bank that was convinced to crank out KEYS TO THE BANK, and to send out these keys. Imagine thousands of keys to the bank being sent out by the bank into the community, perhaps in a really stupid PR stunt.

God knows WHO is going to get into the bank now.

God knows WHAT is going to get into the genome now.

Are you starting to see what they did?


Fact Checking the Fact Checkers on DNA Change

The absolute best way for me to convince you that they really said these vaccines could not do what they are now proven to be doing, is to simply play back the words of the “fact checkers”.

See if you can spot how many LIES are told in this video.

If you’re not spotting the lies, read THIS ARTICLE.

AND – by the way – this video is a GREAT explanation of the way things NORMALLY work. It’s totally out to lunch on the way things ACTUALLY work.

Did you spot the lies? Tell me what you found in the comments.

This video is not alone – there are HUNDREDS OF THEM.

There are also hundreds if not thousands of articles of a similar nature. I’m just going to pick one of them – the one that happened to have the graphic I used above. That article is dated from MARCH of 2021 – right when the authorities were hard-selling the “vaccines”.


mRNA Covid-19 vaccines: Facts vs Fiction

MARCH 10, 2021

By: Maria Elisa Almeida Goes
Editing: Offspring Magazine Editorial Team
Images: Nina Lautenschläger.

LINK: https://www.phdnet.mpg.de/offspring/Covid-19_vaccines

ARCHIVE: https://archive.fo/irZec


Interestingly, this archive was made only 5 months ago. It was very likely archived by Wikipedia or somebody else who is shilling the false explanation, when faced with the emerging science showing nuclear translocation and genomic incorporation. But it’s perfect for me to preserve evidence.

As an aside, I find it terribly sad that this particular lover of “Max Planck” era scientific history, lived to see one of Planck’s namesake organizations lying about science on a grand scale, but yet here we are.

Let me just pull out the most relevant section. I was planning on highlighting ALL of the lies, fibs, evasions, etc., but there are so many, I decided to only highlight or [comment on] the most horrible and ironic.


mRNA vaccines will not alter your DNA, this is why:

Concerns about the effects mRNA vaccines over the integrity of our DNA also exist. Thankfully, you do not need to worry about this. Such an event would challenge everything scientists know about basic cell biology, and is so improbable, that one can actually call it impossible.

The main reason for that is that, besides being chemically and structurally different from DNA, mRNA is located in a different cellular compartment. While DNA is enclosed in the nucleus, mRNA is produced in the nucleus, but is quickly exported to the cytoplasm with a one-way ticket: it does not come back. In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction. Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.  Additionally, the RNA molecule is charged and carries the same charge as the nucleus, so as our 6th grade physics taught us, like charges repel, and hence the RNA molecule is physically repelled by the nucleus. [Note added by Wolf – WHAT THE HELL???]

One might also argue [HA! You TOADS! Yes, one “might”!] that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example. The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines. [OH, THE IRONY]

For the same reasons, mRNA vaccines cannot affect your unborn children. This would require genomic mutations [oh, really!] in the reproductive cells – sperm and egg – since only these could potentially be transmitted to the next generation. [AND???!!!]

Speaking of children, you might have heard that Covid-19 vaccines would cause infertility in women [why don’t you just stop there, and not go on to one bad hypothesis?] because antibodies against the spike protein could mistakenly attack placenta cells, due to an alleged similarity with a placental protein called syncytin-1. There is no scientific evidence supporting this claim – and, in fact, the two proteins are barely similar, sharing only 4 sequential amino acids out of 538. [This did seem to be a bit of a miss. Nevertheless, what new hypothesis explains all the pregnancy problems?]

Still, you might want to ask why pregnant women are excluded from the vaccination campaigns [wait a minute….not in the US], and why, during clinical trials, women are asked to use contraceptive methods that will avoid pregnancy [because there might be a problem?]. Again, this is not a red flag. Any clinical trial for a potential vaccine or drug will exclude children, pregnant women, old people and people with specific underlying conditions. Initially, trials are designed to obtain major insights whether the developed pharmaceutical product works at all, in healthy adults. Once safety and efficacy are determined [read what you just said before that, where you excluded safety as a motive], tests are expanded to smaller groups that at first were set aside. Excluding pregnant women from trials only shows that trials are being done systematically and following standard protocols. [I’m sorry, but this sounds like happy horseshit, lady.]


Let’s concentrate on the lies most relevant to this discussion. I’ll isolate them and respond to each one.


In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction.

This is EXACTLY what was found with the spike protein that was produced by the full spike mRNA. What a coincidence! See De Marinis for proof that it happens, and Mehedi for WHY. OH – because there’s a nuclear location signal! Was it a “known” one, and if so, who knew it and who didn’t? If some people knew, and others didn’t, wouldn’t that make it like a “zero day” on the nucleus?

Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.

OH! But isn’t that SO STRANGE that the Mehedi work shows that the spike protein LITERALLY “traffics” the spike protein mRNA into the nucleus? WELL AHHHHH’LLLLL BE! So maybe this explains the nuclear DNA modification that is seen in the De Marinis results. Yes? Maybe? Come on, girl – you’re a scientist at a prestigious institute. Put on your big girl pants and hypothesize with me! You can do it! This is undergraduate, “smart-alec guy in the back of introductory class raises his hand” stuff! And when you were in that class, you thought the same sorts of things but didn’t raise your hand. Maybe it’s time to be brave!

One might also argue that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example.

This should have been your really big hint, girl. Our local accountant named cthulhu realized that Fauci’s HIV interests and his bat virus interests had remarkable similarities, both in what he himself did, and in what he was studying. “This isn’t Fauci’s first rodeo.” Ask yourself – why was Fauci interested in this? Could it have been the same reason that Doudna was so interested in CRISPR-Cas9? The desire for WRITE PERMISSIONS on the genome?

The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines.

Thank you, my lying lady. You have just provided me with a huge clue, by the process of “liar subtraction” – a form of deductive reasoning. We know from De Marinis that genomic incorporation and modification is a fact. We know from Mehedi that “nuclear trafficking” (your point 2) is a fact. This means that it is almost certain that the spike protein ALSO acts as a promoter of reverse transcription (your point 1). You said it – not me. That sure seems convenient, doesn’t it? My question is now – DID YOU KNOW THIS? Were you part of the plot? Or was the person who reminded you of these things part of the plot? Or were we all part of the plot, when I, too, mindlessly parroted the “central dogma” as a defense of mRNA vaccines?

I’m willing to confess that I was wrong. I will admit to my part in promoting the conspiracy. Will you?


But their defenses get worse.

There are now MSM “fact checks” which specifically try to walk back the implications of both the Jaenisch and De Marinis papers, and you can bet there will be similar fact checks on Mehedi’s paper. There has likewise been pressure on those authors to DOWNPLAY the significance of their own works. To me, this is the height of bullshit.


Jaenisch Paper Downplay

Fact Check-Controversial MIT study does not show that mRNA vaccines alter DNA

LINK: https://www.reuters.com/article/factcheck-coronavirus-vaccines-idUSL1N2PK1DC

ARCHIVE: https://archive.fo/vJwBk


De Marinis Paper Downplay:

Swedish study on COVID vaccines and DNA misinterpreted

LINK: https://apnews.com/article/Fact-Check-COVID-Vaccine-Sweden-Study-986569377766

ARCHIVE: https://archive.fo/vJwBk


Rather than take these arguments apart myself, I ask you all to take a first crack at the different techniques used, by clicking the links and observing the UNETHICAL SKEPTICISM. Much of this does not require a science background.

In particular, knowing what we know now, after the Mehedi work, I think it should be very clear how much the media went to bat for the vaccines without honestly questioning the “authorities”.

I will confirm your findings in the comments, and catch any straggler sins of science.

To me, this media mendacity is all simple, stupid, and predictable.

“Nothing to see here!”

Frankly, it changes nothing for me, if any of these authors get talked into walking back their own work, because push-back on critical work is a common phenomenon in the history of science. Not all scientists are capable of weathering the storm. Here are TWO that did. Both got Nobel prizes, by the way.


A classic case, emphasizing a field aversion among an establishment group to a field solution emerging from deductive reasoning, was Van’t Hoff and tetrahedral carbon. Basically, a doctoral candidate in an applied science school had the temerity to take an old hypothesis and revive it as the solution to a very significant current problem. The guy was good – he went on to win a Nobel prize for other work. However, many chemists, especially older ones, rejected the idea, in my opinion by not prioritizing explanatory power over their own abstract philosophical preconceptions. The fact that important people rejected an elegant solution of remarkable utility and truth shows how bad group-think problems can be in science.

Another case was Rick Smalley and C60 (buckminsterfullerene). The linked article accurately describes the initial skepticism that people had for “soccer ball carbon” or “bucky balls”.

The Nature letter describing C60 was attractive and logical, but seeing a line in a mass spectrum did not convince all scientists of the discovery of a new allotrope of carbon. During the period 1985-1990, the Curl/Smalley team at Rice and Kroto at Sussex managed to amass a wide range of circumstantial evidence to support the fullerene structure proposal. Full acceptance came when Wolfgang Krätschmer of the Max Planck Institute for Nuclear Physics in Heidelberg, Germany, and Donald Huffman of the University of Arizona, with their students Konstantinos Fostiropoulos and Lowell Lamb, succeeded in synthesizing C60 in sufficient quantities to allow structural characterization.

I personally remember colleagues assuring me that Smalley was loony, demented, senile, past his prime, or at best something along the lines of “a nice guy, but clearly deluded and obsessed with an error.” The doubt about C60 as reality – particularly as a stable reality – ran thick. And that doubt was WRONG from the very beginning.


Scientists right now are NOT THINKING, and they’re letting the MEDIA push them around.

Scientists are also letting guys like Anthony FAUCI push them around, mainly by the horrible federal grant system, and by the psychology of woke universities, both designed to control science.

And that doesn’t even begin to address other malign interests altering science and medicine in dishonest ways.


Some Actual Speculation – Why Would They Push These Clearly Defective Shots So Hard?

You want some actual “conspiracy theorizing”? Here it is.

Let me go back to my “TLDR” again…..

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.

There are reasons to suspect depopulation as a motive for these vaccines, and both Gail Combs and I have written extensively about this. I continue to believe that this is part of the motivation of the “complex event” we have been undergoing, between virus and vaccine.

Depopulation is very important to these people.

MALTHUSIANS AND EUGENISTS MAKE A CASE FOR POPULATION CONTROL

DEPOPULATION – NEVER LET A CRISIS GO TO WASTE

The Population Control Shot – Introduction

The Population Control Shot – Understanding the Peoples Climate Temple

Likewise, there are many other motives, ranging from mercenary profits, to promoting gene therapy, to “Covid communism”, and beyond. Many of these roads lead back to WEF – the World Economic Forum. One of those roads may be an actual attempt to commit humanity to a future of genetic engineering as a kind of fait accompli.

Just listen to Yuval Noah Harari talk about changing humanity. A few times he talks about “we”, “I”, “me”, “my”, and “our” programs of genetic engineering of humanity. It’s not just creepy and megalomaniacal – it seems quite self-assured.

WEF’s interest in genetic transformation of humanity cannot be understated. You will note in the above video, the presence of Jennifer Doudna – the Nobel laureate who (IMO) was most responsible for pushing CRISPR gene editing technology forward. Here is the full video.

I have discussed the technology recently here:

Dear KMAG: 20230213 Joe Biden Didn’t Win ❀ Open Topic / Introduction to CRISPR/Cas9 Gene Editing Technology

This is a particularly good explanation for those who want to dig into the science a little.

So how does CRISPR-Cas9 connect to the spike protein?

I have mentioned that the spike not only is proven to have nucleus-opening properties and cell nuclear mRNA-trafficking properties, but it likely has reverse-transcribing properties as well. Thus, it may have utility in facilitating certain varieties of genomic incorporation of genetic material beyond its own spike mRNA. I’m leaving that open very broadly. We don’t really know how far the “nuclear translocation of mRNA” capabilities of the spike protein actually go.

But even just the incorporation of its own instructions into the cellular genome, makes the spike protein highly relevant to CRISPR-Cas9 gene editing technology.

We can’t REALLY be sure what happens if the spike protein code gets into egg or sperm DNA, and goes on to be a “feature” of every human cell of a “spike baby”, but I can say one thing – if that gene can be REMOVED during in vitro fertilization (IVF) by CRISPR-Cas9 technology, to the betterment of the child, then it’s very likely going to be demanded by elite parents, to assure a healthy baby.

So – I ask again – WHAT ARE THE CHANCES?

What are the chances, that people who are gung-ho on the “solution” of genetic modification of humanity – you know – like WEF – would have anything to do with releasing a virus and promoting a vaccine that would almost FORCE us into that future?

I think that this era is a lot like the chemical revolution of the late 1800s, precisely when Van ‘t Hoff was dealing with chemical theory. Figures like Malone and Doudna operate in the time of our own biological revolution. Remember Rockefeller, and what he did to science and medicine back during the chemical revolution. Well, now we have Gates and what HE did to science and medicine during the biological revolution.

Personally, I think it’s high time for us to stop taking shit from the corporate media – and particularly the “fact checkers” like Reuters and the AP – as they LIE to our faces about science – as they deny reality on behalf of the corporate titans behind them.

These mRNA vaccines are DEFECTIVE relative to how they were sold to us – very likely by intention – and the media and media organizations have LIED to us about those vaccines in the most scurrilous ways. The media has defended LIES and defrauded all of us.

You don’t have to be FOR or AGAINST gene editing per se, to be against LYING, DEFRAUDING, and FORCING IT ON THE WORLD by a criminal conspiracy.

We need to demand TRUTH about the vaccines, or the SHUTTERING of these “media” companies and organizations, which have cosigned onto crimes against humanity.

Demand no less. TRUTH or BREAK-UP. Media that lies and conceals is USELESS and a hindrance to REAL SCIENCE.

W

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you.


TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic incorporation found for both the virus and the vaccines. The special key and the mRNA shepherding can be considered to be defects in any spike vaccine that has them.

¡Muy explosivo!


Due to comments by WSB and Valerie Curren, I realized that I had to do this post.

Also, NONE of the “bigs” are talking about this, but it is HUGE, if only people will read the paper.

By sheer luck, I was alerted to this new development ASAP on Twitter.

A follower of mine, who I had followed back, posted on Twitter the link to a paper with this title:

Nuclear translocation of spike mRNA and protein is a novel feature of SARS-CoV-2

I immediately realized what this was about.

It’s about how the SARS-CoV-2 (COVID) virus spike protein and its mRNA get into the cell nucleus – an extremely important point which WSB has been hitting on over and over. It’s very important, because THAT is how “genomic incorporation” happens. And genomic incorporation is what HIV does – what retroviruses do. They “get into” the DNA and leave cookies, so to speak.

Sometimes, they leave enough cookies, that the whole virus comes back out, fully functional, and ready to infect. Sometimes, they only leave enough junk in the DNA to cause some damage. Sometimes, they leave enough to change us – and that is why human DNA is filled with “viral leftovers”.

In principle, mRNA technology should NOT do this. We were TOLD that mRNA technology could not do this. But somebody LIED TO US. And not only that – NOBODY – from Bill Gates on down – ever apologized to us about lying, or even about just “being mistaken”.

We’ll get to that later.

You will recall that there are two papers I love to mention.

One is the “Jaenisch paper”, which describes how the SARS-CoV-2 virus manages to get some of its genetic instructions for the spike protein into the DNA of cells.

LINK: https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1

ARCHIVE: https://archive.fo/XWC52


The other is the “De Marinis paper”, which describes how the Pfizer vaccine did the same thing to human liver cells in vitro – meaning that in an experiment using cells in culture, the Pfizer vaccine got its mRNA sequences into the DNA genetic material of human liver cells, and it did so in a matter of minutes.

McCullough got in a lot of trouble with Twitter for posting this, even though it was utterly true. Now we know that the government was trying to shut it down. They likely used the technicality of McCullough’s very VALID speculation (stated as speculation and concern), which turned out to be correct, IMSO.

LINK: https://www.mdpi.com/1467-3045/44/3/73

LINK: https://portal.research.lu.se/en/publications/intracellular-reverse-transcription-of-pfizer-biontech-covid-19-m


These papers explain ALMOST everything. When I saw the Jaenisch paper, I predicted that we would see the De Marinis paper. MEANING – when I saw that the virus could get mRNA into the DNA, I predicted that the vaccine might get its mRNA into the DNA, too. And yes, I was right. Clearly others thought the same thing, and decided to investigate.

Now, after the De Marinis paper, it seemed very obvious to me that one did not need any kind of special conditions or reverse transcription promoters to get the vaccine mRNA to incorporate.

That bothered me, and I suspected, at the time, that MAYBE – just maybe – the spike protein ITSELF was somehow causing genomic incorporation – that it functioned as a kind of reverse transcription promoter.

Well, it sure looks like that is the case.

According to the discoveries revealed in the new paper, which I have taken to calling the “Mehedi paper”, there is a special sequence in the spike protein that acts like a “key to the nucleus” – and this sequence is found in NO other coronavirus spike protein.

LINK: https://www.frontiersin.org/articles/10.3389/fmicb.2023.1073789/full

ARCHIVE: https://archive.fo/kW9Bd

Here is the abstract of the new paper.


Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes severe pathophysiology in vulnerable older populations and appears to be highly pathogenic and more transmissible than other coronaviruses. The spike (S) protein appears to be a major pathogenic factor that contributes to the unique pathogenesis of SARS-CoV-2. Although the S protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.


Let me put that in plainer English.


COVID-19 really hurts old people and seems to be both deadlier and easier to catch than other coronaviruses. The spike protein seems to be why. Although the spike protein is a surface protein that normally would not do this, it might be predicted to get into the cell nucleus because it has a special sequence “PRRARSV,” a known key to the nucleus which appears in no other coronavirus. Sure enough, the COVID spike protein gets into the nucleus of infected cells. What’s more, the mRNA for COVID spike protein also gets into the nucleus. What happens is that the spike mRNA collects near the spike protein, which helps it get in. While a different protein called the “nucleoprotein” of many coronaviruses is known to get into the nucleus of cells, the penetration of the cell nucleus by BOTH the spike protein AND the mRNA for it, seems to be a unique new feature of the SARS-CoV-2 virus.


Once you read it in plain English, it’s much more mind-blowing.

Now – I really recommend that you read the rest of the paper, but it’s really just technical details about what was mentioned in the abstract. Those details can help you gauge the expectedness or unexpectedness of things, but I have tried to do that as best as I could in the translation.

At this point, you should have all kinds of questions.

  • could this defect of the vaccines have been predicted?
  • should it have been predicted?
  • did the Chinese know this when they sent us the sequence?
  • did we know it when we got the sequence?
  • would NOT using the full spike protein have prevented this?
  • if so, why did we use the full spike protein anyway?
  • would the “forbidden” Winfried Stöcker RBD vaccine have avoided this?
  • if so, why was his vaccine suppressed by the German government?
  • does this affect the Peter Hotez vaccine, Corbevax?
  • if not, why didn’t his vaccine get promoted through the process quicker?
  • is nuclear penetration a common problem with mRNA technology?
  • how did this “key” get into the sequence? Naturally or not?
  • could “directed evolution” of the spike have yielded this?
  • why wasn’t this clear from the moment we got the sequence?
  • did people know this and hide the information?
  • were key people like Bill Gates (their side) and Robert Malone (our side) aware of this possibility?

The last question is a gift to WSB and her virologist friend. I am by default a defender of Dr. Malone, but WSB and her friend are long-time skeptics of the technology, and thus of Dr. Malone. In all fairness, I think we have to ask EVERYBODY the same questions.

  • Did people KNOW that mRNA technology had this vulnerability?
  • Does this look any more like an engineered bioweapon, designed to get into the nucleus?
  • Was this thing made by nature, by people, or by somebody with more advanced technology?
  • What is the purpose of getting into the nucleus, if it is designed to do that?

That should be enough. I will leave some links to prior comments I have made, in an appendix, hopefully added later.

Thank you.

W

John Fink and James Coburn discuss case in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

PS – A great interview of our site mascot!

https://thehollywoodinterview.blogspot.com/2008/02/james-coburn-hollywood-interview.html

DIED SUDDENLY & WAKING THE SHEEPLE

Some people wouldn’t know Tyranny

if it covered their faces,

Locked them in their homes,

Enacted the biggest wealth transfer in History

Censored them

made them show papers

and forcibly injected them

with a slow ‘poison’….

RDS in the following comment points out one of the problems we have in waking up the Sheeple. There are highly ‘respected’ doctors and PhDs, who write papers in prestigious journals backing the mRNA vaccines even though they KNOW they are unsafe.

RDS:

Wolf Moon
OMG, this article below is a must-read. Linked from an AMA EdHub email one received today. It’s a JAMA piece written by Dr. Peter Marks — he’s the head of the CBER department of the FDA (Center for Biologics Evaluation and Research). Dr. Marks was in on the ground floor of Operation Warp Speed. Dr. Marks KNOWS EVERY DATA PIECE SUBMITTED TO THE FDA FROM PFIZER-BIONTECH ABOUT THE CLINICAL TRIALS FOR BNT162b2 BACK IN 2020 — AND EVERY DATA PIECE SINCE THEN ALSO.
Dr. Marks was in on recommending that the FDA authorize the UNPROVEN, ONLY TESTED ON 8 MICE new “COVID-19 + Omicron BA.4 + Omicron BA.5 booster shot.”
His linked article below is a screed for the development of “new” and “different types” of COVID-19 “vaccines” — including ones that specifically target the T-cell response in the body.
Dr. Marks KNEW that the “vaccines” developed during Operation Warp Speed and given quick EUAs by the FDA WOULDN’T DO THE JOB:
From his article:
“One potential model for approaching such development [of a COVID-19 vaccine] was used successfully at the beginning of the pandemic when Operation Warp Speed evaluated numerous global vaccine types and focused on advancing several promising candidates, knowing full well that most would ultimately not be found to meet the criteria set forth for a safe vaccine with adequate efficacy. (bolding and Italics mine)
Dr. Marks represents the “medical establishment” and DeepState.
IMO, the “medical establishment” and the DeepState have it as their business to continue to put these dangerous COVID-19 “vaccines” into people — and develop new “vaccines” to keep damaging / destroying the immune systems of those who take them.
His article:
https://jamanetwork.com/journals/jama/fullarticle/2799600
December 9, 2022
“Urgent Need for Next-Generation COVID-19 Vaccines”
Peter Marks, MD, PhD
https://www.youtube.com/watch?v=Nat1za4sKjA
As an additional note. For those who might wish to watch the documentary it is available to watch free until the end of January. All that is required is your email I think. The link follows.
https://therealanthonyfaucimovie.com/trailer/

In addition to censorship and smearing of dissenting voices, hospitals and doctors were getting the carrot and stick treatment – Lose your license OR get big bucks for pushing bogus PCR tests, ventilators, Remdesivir and killing patients. – For example “A COVID-19 diagnosis provides extra payments to coroners!”

To make sure the Sheeple could not make a solid connection between the Covid Vaccine and death, the shot is a slow ‘poison’ with a variety of adverse reactions.

Steve Kirsch: Vaccines are taking an average of 5 months to kill people

The CDC has been hiding the Social Security Administration death master file. I got it from a whistleblower. This shows deaths are taking 5 months from the jab to happen. This is why it’s hard to see.

Remember this time factor as we look at the data I found.

Finally we have the DELIBERATELY compromised VAERS system that is SUPPOSED to alert the CDC and FDA to harmful drugs.

Why Did the CDC Silence the Million Dollar Harvard Project Charged With Upgrading Our Vaccine Safety Surveillance System?  BY TRUTH SNITCH

NOTE THE DATE! → OCTOBER 24 2017

There are major problems with the vaccine adverse event reporting system (known as VAERS) which the CDC considers the “front line” of vaccine safety. VAERS was created in 1990 by the CDC and FDA as a means to collect and analyze adverse effects that are associated with vaccines. Unfortunately, the failings of VAERS are “kept from the consciousness” not only of the public, but also from the doctors, pediatricians, and nurses that the public rely on to provide reliable information as to the safety of vaccines. I say “kept from the consciousness” rather than “kept secret” because while these failings are publicly disclosed for all the world to see, they are for all intents and purposes BURIED in documents seldom searched out by the average member of the medical community, much less by the average individual. You could say that the information has been very effectively hidden in plain sight…

In 2000, the 6th Report by the Committee on Government Reform addressed the failings of VAERS in its address of the Vaccine Injury Compensation Program…. [The] Congressional report notes (on page 15), “Former FDA commissioner David A. Kessler has estimated that VAERS reports currently represent only a fraction of the serious adverse events.” (emphasis by author)… That leads us to the interesting case of the CDC and Harvard Pilgrim Healthcare Inc.

The Department of Health and Human Services (HHS) gave Harvard Medical School a $1 million dollar grant to track VAERS reporting at Harvard Pilgrim Healthcare for 3 years and to create an automated reporting system which would revolutionize the VAERS reporting system- transforming it from “passive” to “active.”…

I’ll quote the findings directly from the report,

“Adverse events from drugs and vaccines are common, but underreported. […] Likewise, fewer than 1% of vaccine adverse events are reported. Low reporting rates preclude or slow the identification of ‘problem’ drugs and vaccines that endanger public health. New surveillance methods for drug and vaccine adverse effects are needed.”

Again, let’s stop and think about this revelation for a moment: fewer than 1% of vaccine adverse events are reported. The CDC’s entire vaccination propaganda campaign rests on their claim that side effects from vaccination are exceedingly rare (and predominantly minor). According to the CDC, in 2016 alone, VAERS received 59,117 vaccine adverse event reports. Among those reports were 432 deaths, 1,091 permanent disabilities, 4,132 hospitalizations, and 10,274 emergency room visits. What if these numbers actually represent less than 1% of the total as this report asserts? Simple multiplication would yield vaccine adverse events reports numbering 5,911,700!…

the United States of America Centers for Disease Control ghosted Harvard Pilgrim Healthcare, Inc.

For those who are unaware, Google dictionary defines ghosting as,

“the practice of ending a personal relationship by suddenly and without explanation withdrawing from all communication.”

Personally, I would hope that I could hold an organization like the CDC to a higher standard, but… After a one million dollar grant was paid and three years of research conducted on what appeared to be a very successful upgrade to the passive VAERS system, the team’s CDC contacts went MIA

. The ESP:VAERS final report states, “Unfortunately, there was never an opportunity to perform system performance assessments because the necessary CDC contacts were no longer available and the CDC consultants responsible for receiving data were no longer responsive to our multiple requests to proceed with testing and evaluation.”

So in 2017, the CDC DELIBERATELY left a useless reporting system in place when they had the opportunity to upgrade it.

Since the VAERS data set is compromised as well as next to useless, I decided to see if we could find another way to connect the mRNA vaccines to deaths. There is a nifty site called Dead or Kicking.

If you go to https://deadorkicking.com/death-statistics/us/2020/ (Towards the bottom)

there is the graphUnited States death comparison by age in 2020

By changing the date in the URL you get the different years AND if you place your mouse over the graph, it will give you Deaths, Death Rate and Population for each age group.

You can save the graphs for any year – or all of them – as examples, as Wolf did below. Right-clicking on a graph lets you “save image as” or “copy image”.


2019

2020

2021

2022

Note Added By Wolf – CHECK THIS ONE OUT!!!


I originally thought I would see a major drop in the population over 75 but that did not happen since the Baby Boomer cohort is filling the 65+ age groups faster than the orchestrated depopulation can kill them. Notice there are less people in the 45 to 54 age group than in the 55-64 age group. That is a REAL PROBLEM for the Cabal.

Social Security Scam: Where Did the $2.5 Trillion Surplus Go?

July 19 2011

The Social Security Trust Fund should currently have $2.5 trillion in surplus. So how is it that these checks could stop being issued if the debt ceiling isn’t raised? Economics professor Dr. Allen Smith, author of The Looting of Social Security: How The Government is Draining America’s Retirement Account, has been reporting on the theft of Social Security funds for years….

Age / Date2019202020212022
85+6,604,9586,628,0136,673,1756,715,875
75-8415,969,87216,022,41016,139,65116,250,631
65-7431,483,43331,571,20731,773,61031,970,852
55-6442,448,53742,643,57942,929,85043,208,648
45-5440,874,90241,050,40441,371,45241,683,591

So I created another table this time of USA Death Rates by age group by year. I included 6 years before covid as a baseline. Then the two years, 2019 & 2020, when Covid hit the USA plus the two years, 2021 and 2022 when the mRNA vaccine was progressively rolled out, starting with adults, then school age children and finally babies.


Age/Date2013201420152016201720182019202020212022
85+136.60134.08136.74133.92135.74134.51132.29162.24138.49120.22
75-8446.4845.6445.7944.7544.7343.8643.0852.1650.3349.00
65-7418.0217.8617.9717.8917.9117.8317.6520.9222.2523.96
55-648.608.708.758.848.868.878.839.8610.8512.05
45-544.064.054.044.064.023.963.924.235.086.12
35-441.721.751.801.921.951.951.992.122.883.92
25-341.061.081.171.291.331.291.291.371.762.24
15-240.650.650.700.750.740.700.700.720.861.05
5-140.130.130.130.130.140.130.130.130.140.14
1-40.260.240.250.250.240.230.230.230.220.25
<15.955.885.905.835.675.585.535.564.884.39

The following groupings are interesting…..


RETIREES 75+

We know 5 democrat governors forced people with ACTIVE COVID INFECTIONS into nursing homes, killing a lot of the elderly and they were not the only ones. 45% of all US coronavirus deaths occurred in nursing homes.

Also there was the DELIBERATE mis-diagnosis of flu and pneumonia followed by refusal to treat until the person was so sick they needed to be put on a ventilator & remdesivir thus killing up to 88% of those patients.

There was also deferred health care. Study: 4 in 10 U.S. adults deferred medical care due to COVID-19

The result of all of this, is the most vulnerable elderly had already been killed off in 2020 as the much higher death rates for 2020 shows, but by 2021 and 2022 the death rates decrease from that high. Although the elderly were vaccinated, unlike athletes and younger, physically active people, the elderly are going to be a lot more sensitive to what their bodies are telling them and NOT pushing it. They are also more likely to have doctors checking their heart health and be on heart and circulatory medications.

March 2020 Myocarditis in athletes: A clinical perspective

Abstract

Myocarditis is an important cause of arrhythmias and sudden cardiac death (SCD) in both physically active individuals and athletes.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

RETIREES 65 to 74

The 65 to 74 group is going to be a mixed bag. Compared to the 75+ group they are less likely to be in a nursing home or to have gotten deathly ill in 2020, although a certain percentage will have died. However they are likely to get the vaccine. Thanks to Medicare, they are more likely to be in contact with medical professionals who would try to talk them into the jab. They are also going to be a lot more physically active than older retirees and therefore stressing their hearts more after getting the mRNA vaccine.

You can see the combination of poor health care in 2020 followed by the vaccines and then boosters as the death rate increases year by year from 2019 through 2022.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

FORCED RETIREMENT/SMALL BUSINESS WORKERS 45 to 64

The 45 to 64 are an interesting group. Corporations force retirements and actively discriminate against those 45 years and up because age discrimination laws have no real teeth. Therefore the people 45 and up are most likely NOT working for ‘Corporate America’ and are either small business people or hired by small business people. (BTDT) This group is the most likely to have had a ‘rude awaking’ about the world we live in and are NOT going to be as trusting. Older people are also more likely to tell their boss to go F..K themselves with the darn needle. Like the 65 to 75 group you can see the increase in death rate year to year but it is not as sharp an increase. They are also more likely to be in better health than retirees.
If You’re Over 50, Chances Are the Decision to Leave a Job Won’t be Yours
Age discrimination in the workplace happening to people as young as 45: study

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

WORKING AGE CORPORATE AMERICA 15 TO 44

The age group 15 to 44 is the group most likely to show PURE UNADULTRATED DATA about Mortality & the mRNA vaccine although there may be some confounding from drug use increasing over the years. Covid-19 virus has little effect on the death rate in 2020. However as the boosters and the 5 month time delay kicks in you can see the death rate almost doubled in 2022 compared to 2019 and earlier.

THIS IS THE GROUP TO WATCH.

JANUARY 3, 2022 Insurance executive says death rates among working-age people up 40 percent

….Scott Davison, the CEO of OneAmerica, a $100 billion life insurance and retirement company headquartered in Indianapolis.

“The data is consistent across every player in the business.”

Davison said death rates among working age people –

those 18 to 64-years-old – are up 40 percent in the third and fourth quarter of 2021 over pre-pandemic levels.

“Just to give you an idea of how bad that is, a three sigma or 200-year catastrophe would be a 10 percent increase over pre-pandemic levels,” Davison said. “So, 40 percent is just unheard of.”

He blames it on Covid instead of the mRNA vaccine of course. “…the third and fourth quarter of 2021…” would be after Steve Kirsch’s 5 month window. So far I can not find any 2022 insurance data. HMMMmmmm

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

CONTROL GROUP 1 TO 14

The 1 year to 14 can be considered the ‘Control Group’ Covid has little if any effect on the death rate in 2020. They were not vaxed until quite recently (November 2021) and boosters were not approved until May 19, 2022. The death rate so far has been flat but I would expect an uptick after the first of this year as the effects of the boosters kick in.

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

BABIES UNDER 1 YEAR

The Under one year of age is interesting since there is actually a slight dip in mortality. Are weaker babies more subject to spontaneous aborting after Mom is vaxed?

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

TIMELINE of Emergency Use Authorization of mRNA VACCINES

The FDA makes it VERY HARD to figure out just when they authorized the use of the mRNA vaccine in youngsters. I gleaned out the following dates. Starting from the FDA Covid Vaccine site.

Turns out it is the CDC who has the final say on vaccination of children so I have also included the CDC news releases.

12/18/2020 EUA issued for the Moderna COVID-19 Vaccine, December 18, 2020.
Emergency Use Authorization (EUA) of the Moderna Inc. COVID-19 Vaccine for the prevention of COVID-19 in individuals 18 years and older.

YEAR 2021

06/10/2021 — Vaccines and Related Biological Products Advisory Committee will meet in open session to discuss, in general, data needed to support authorization and/or licensure of COVID-19 vaccines for use in pediatric populations.

FDA DEFINES:
Pediatric use. (A) Pediatric population(s)/pediatric patient(s): For the purposes of paragraphs (c)(9)(iv)(B) through (c)(9)(iv)(H) of this section, the terms pediatric population(s) and pediatric patient(s) are defined as the pediatric age group, from birth to 16 years, including age groups often called neonates, infants, children, and adolescents.

.
09/17/2021 — Application for administration of a third (“booster”) dose of Comirnaty (COVID-19 Vaccine, mRNA) in individuals 16 years of age and older.

10/26/2021 — Vaccines and Related Biological Products Advisory Committee Meeting
The committee will discuss a request to amend Pfizer-BioNTech’s Emergency Use Authorization (EUA) for administration of their COVID-19 mRNA vaccine to children 5 through 11 years of age.

10/14/2021 – Vaccines and Related Biological Products Advisory Committee Meeting
The committee will discuss the Emergency Use Authorization (EUA) of the ModernaTX Inc. COVID-19 vaccine and the Janssen Biotech Inc. COVID-19 vaccine for the administration of an additional dose, or “booster” dose, following completion of the primary series, to individuals 18 years of age and older.

 November 2, 2021 – CDC Recommends Pediatric COVID-19 Vaccine for Children 5 to 11 Years


Today, CDC Director Rochelle P. Walensky, M.D., M.P.H., endorsed the CDC Advisory Committee on Immunization Practices’ (ACIP) recommendation that children 5 to 11 years old be vaccinated against COVID-19 with the Pfizer-BioNTech pediatric vaccine. CDC now expands vaccine recommendations to about 28 million children in the United States in this age group and allows providers to begin vaccinating them as soon as possible. 

YEAR 2022

Jun 17, 2022 FDA authorizes COVID-19 vaccines for children age 6 months and older

The Food and Drug Administration today authorized Moderna’s COVID-19 vaccine for children aged 6 months through 17 years old and Pfizer’s COVID-19 vaccine for children aged 6 months through 4 years old, as recommended this week by its vaccine advisory committee. The vaccines previously were authorized for older children.

Before vaccinations can begin, the Centers for Disease Control and Prevention must recommend the vaccines for these age groups. CDC’s Advisory Committee on Immunization Practices is scheduled to vote tomorrow on whether to authorize the vaccines for children age 5 and under.

December 08, 2022 Today, the U.S. Food and Drug Administration amended the emergency use authorizations (EUAs) of the updated (bivalent) Moderna and Pfizer-BioNTech COVID-19 vaccines to include use in children down to 6 months of age.

Children 6 months through 5 years of age who received the original (monovalent) Moderna COVID-19 Vaccine are now eligible to receive a single booster of the updated (bivalent) Moderna COVID-19 Vaccine two months after completing a primary series with the monovalent Moderna COVID-19 Vaccine.

Dec 9, 2022 CDC Expands Updated COVID-19 Vaccines to Include Children Ages 6 Months

Following FDA action, today CDC expanded the use of updated (bivalent) COVID-19 vaccines for children ages 6 months through 5 years.

May 19, 2022 – CDC Strengthens Recommendations and Expands Eligibility for COVID-19 Booster Shots

Following today’s meeting of the Advisory Committee on Immunization Practices’ (ACIP), CDC is expanding eligibility of COVID-19 vaccine booster doses to everyone 5 years of age and older. CDC now recommends that children ages 5 through 11 years should receive a booster shot 5 months after their initial Pfizer-BioNTech vaccination series.

GC/wm

Jab Club


Are YOU a Member of JAB CLUB?

Well, if you are, then start ACTING LIKE IT!

If you are saying BAD THINGS about the wonderful coronavirus vaccines with safe and effective mRNA technology, which have never killed or harmed anybody, then you need a REFRESHER COURSE in the RULES OF JAB CLUB.


#1 – The first rule of Jab Club is, you do not talk about Jab Club.

#2 – The second rule of Jab Club is, you DO NOT talk about Jab Club.

#3 – If someone dies or gets injured, it wasn’t the jab.

#4 – Two jabs to a vaccination.

#5 – One jab to a booster.

#6 – No admission of harm, no metrics except antibodies.

#7 – Jabs will go on as long as they have to.

#8 – If this is your first night in Jab Club, you have to get jabbed.


Now, we have a problem, people.

Not everybody is following the rules of JAB CLUB.

https://twitter.com/UsBurning/status/1562115729784127488

LINK: https://www.thegatewaypundit.com/2022/08/dan-bongino-reveals-getting-covid-vaccinated-greatest-regret-life/

LINK: https://www.bitchute.com/video/D60zcuock4Hk/

This kind of mistake is completely unacceptable. Although Mr. Bongino did not violate the first rule of Jab Club, which is to talk about Jab Club, he came very close. It’s clear that people are not following the rules of Jab Club, hence the need for this refresher.

We are providing the following examples for your education and sense of well-being.


EXAMPLES:

Example 1

This is a CLEAR violation of Rule #6.

#6 – No admission of harm, no metrics except antibodies.

You can’t say things that give people ideas.

The disease can’t hurt rabbits, because the jabs can’t hurt humans. Get it? Understand spike protein political vulnerability! Loose lips cause slips! Corona viruses are potentially bad diseases, that limit human life, but if we talk about any specifics, people will figure out that the jabs do the same thing, only worse, and that we’re making money on THEIR DEATHS.

Why, people might even figure out that we made the damn virus more deadly on purpose, to help depopulate the planet of all these annoying plebes!

Enough already! Wise up!


Example 2

This is a blatant violation of Rule #3.

#3 – If someone dies or gets injured, it wasn’t the jab.

It wasn’t the jabs. EVER.

The FAUCI WALL admits no blame. SUCK IT UP, PEOPLE!

Strike back against this one with “correlation does not prove causation”, said with a tone of certainty and finality. Remember: Follow the science means don’t question the jabs!


Example 3

LINK: https://www.theepochtimes.com/us-life-expectancy-falls-again-in-historic-decline_4732330.html?utm_source=partner&utm_campaign=TheLibertyDaily

This one violates rules 1, 2, 3 and 6!

Unacceptable!

This one is a complete travesty, from talking about “sudden death” and individual athletes, to talking about things like overall mortality rates AT ALL. But it gets worse.

“Denial” is actually mentioned!

“DENIAL” is a code word for JAB CLUB!

REMEMBER!

#1 – The first rule of Jab Club is, you do not talk about Jab Club.

#2 – The second rule of Jab Club is, you DO NOT talk about Jab Club.

NOW – let’s look at somebody who knows the rules!


Example 4

(Hat Tip RDS, The Burning Platform, and Summit News)

https://summit.news/2022/09/16/video-hospital-runs-myocarditis-in-kids-awareness-commercial-as-if-its-a-common-illness/

This, my friends, is how you do Jab Club right!

Every single rule obeyed!

Check out the video – it’s a superb Jab Club TRAINING VIDEO!

https://youtu.be/61hmUuSewSY

See how that works? Just like back in Germany during the 1940s. People knew everything was OK for the Jews. Hitler was taking care of them, just as he promised. All those stories about maltreatment were misinformation – just like the misinformation we are experiencing now about the vaccines.

Yes, children are experiencing slightly more myocarditis these days, and government scientists are hard at work, figuring out why this might be. There are many possible candidates, including anxiety about gender, concern about insurrectionists, air pollution, and especially climate change. But children should not worry about disease – myocarditis is easily treated.

You may see graphs like this one.

If you see something, say something. This graph and others like it are likely to be misinformation, and should be reported to authorities, just like Jewish propaganda was successfully reported to the appropriate authorities around 80 years ago, in a similar fashion.

There are NO WORRIES when you follow the rules of Jab Club!


We hope that you fully understand the rules of our wonderful JAB CLUB that make sure we’re all safe, happy, and in excellent health.

Now – is your FIGHT CARD – whoops – I mean your VACCINE PASSPORT current?

If not, GET A BOOSTER! But just one! Remember Rule #5:

#5 – One jab to a booster.

The reason for Rule #4 (two jabs to a vaccination) is that it takes two shots of the deadlier Wuhan variant spike protein to seriously injure most people, and in particular for the second shot to create a bad reaction to the first shot.

The reason for Rule #5 (one jab to a booster) is to let each booster have enough time to kill people. Most people who are going to die, die about five months after the shots. Start bunching up the boosters, and it’s likely that people will die shortly after a booster, which makes Rules #1 and #2 more difficult to enforce.

And THOSE TWO are the most important rules!

#1 – The first rule of Jab Club is, you do not talk about Jab Club.

#2 – The second rule of Jab Club is, you DO NOT talk about Jab Club.

KNOW THE RULES, PEOPLE!

Science

Dr. Anthony Fauci

W

“What are you doing out of bed? I think you need some more REMDESIVIR.”


PS…..

Hat Tip slowcreekno for coming up with the concept of “Jab Club” while answering my question about breaking through the “we can’t talk about the evil jab” wall of denial.

LINK: https://www.theqtree.com/2022/09/07/dear-kag-20220907-open-thread/comment-page-1/#comment-958117

Wolf Moon | Threat to Demonocracy

Wolf Moon | Threat to Demonocracy

Online

Admin

Wolf

 Reply to  TheseTruths

 September 7, 2022 08:25

We have to make it a cultural joke that “they” won’t mention their evil jab.

11

 Reply

slowcreekno

slowcreekno

Offline

Wolverine

 Reply to  Wolf Moon | Threat to Demonocracy

 September 7, 2022 11:02

Something along the lines of the Fight Club perhaps…

The first rule of the Jab Club is: DO NOT TALK ABOUT THE JAB CLUB!

Last edited 9 days ago by slowcreekno

11

 Reply

Aubergine

Aubergine

Offline

Coyote

 Reply to  slowcreekno

 September 7, 2022 11:52

PERFECTION!

7

 Reply

Wolf Moon | Threat to Demonocracy

Wolf Moon | Threat to Demonocracy

Online

Admin

Wolf

 Reply to  slowcreekno

 September 7, 2022 18:36

OMG that’s absolutely hilarious! PLEASE feel honored that I’m stealing the hell out of that!

5

 Reply

scott467

scott467

Offline

Coyote

 Reply to  Wolf Moon | Threat to Demonocracy

 September 7, 2022 19:11

“We have to make it a cultural joke that “they” won’t mention their evil jab.”

_____________

Like “Ⅎ˥ƎSWIH ˥˥I⋊ ⊥,NᗡIᗡ NIƎ⊥SԀƎ”

This would be more like “100,000 vaxx takers didn’t kill themselves.”

Just need the data to prove it, which most of the so-called ‘authorities’ won’t acknowledge or reveal.

2

 Reply


Three Little Graphs That Say It’s All One Big Lie


TL;DR – This post explains three graphs which all gave me “AHA” moments when I saw them. They all reveal lies in public science, which are used to manipulate humanity. Strategic and fundamental lies in climate science and planetary history are used to justify more tactical lies in energy and medicine. Together, these three graphs indict the sabotaged and weaponized public science which is being used against humanity.

All of this conforms to a concise and remarkably prescient warning by President (and former General) Dwight D. Eisenhower.

While there is much deep science in each graph, certain basic principles are easily seen without a technical background. Those ideas provide the “wait a second” thought needed for proper scientific skepticism.

If you want to get the “executive tour” and finish this in under 5 minutes, just read through anything that says TL;DR in bold, and the images next to the headline text. If you have 30 minutes, watch the videos next to TL;DR. If you have an hour or two, read everything.


If you read THIS paragraph, then consider the slow route. Or consider doing the TL;DR fast track first, and then coming back for the full ride.


Mood Music


Introduction

I wanted to keep this short, but I know that’s almost impossible. I’ve put off this post until I was ready, but I wasn’t ready until I heard this music (see above), while reading over an older post that aged well in a variety of ways.


The Molnupiravir Contradiction

Why would we mass treat a virus with a drug which forces the virus to mutate, when mutation is how the virus creates new variants that reinfect the vaccinated? Before I explain the title contradiction, let me start with an admission. Most of my life, I have been very friendly with the pharmaceutical industry. I …


The point I saw was that mass formation psychosis has been used at all levels of science, and the only way for us to fix science now is

MASS FORMATION AWARENESS.

Be part of it. NOW.

Q = MFA

(The equation is a bit of a joke – but you are welcome to elaborate it humorously, fellow nerds.)

I had thought that maybe I was putting off this post until the last post was done, but the next post was always the last one, and I knew that I would always find just one more post to do first.

Nope. Now is the time. The last “Wheatie” post is in the can, strengthening my soul, and in hearing this song that I used for it, while knowing that we are on the right path, I’m suddenly ready.

There is a certain beautiful sadness in knowing that I’ve remained silent about even ONE lie for far too long. And now, with THREE beautiful lies – three FURIES against mankind – it’s time to take them all on.


More Mood Music

(A song literally about mass formation psychosis.)


It’s The Jabs

TL;DR – The Ethical Skeptic analyzed CDC data for causes of death in the US. By looking at deaths caused by blood and immune disorders, but not by COVID itself, vs. projections from pre-COVID data, two things show up – more “late” deaths related to COVID, and a MUCH BIGGER group of similar deaths that started precisely with the jabs.

You can see this in the graph as space between the two curves, widening first in Spring 2020 (twice), and much more in April 2021, coincident with the biggest deployment of the jabs.

I’m pretty sure Ethical Skeptic doesn’t believe in God, but that does nothing to keep me from saying “Thank God for Ethical Skeptic”. When Truth is an unyielding goal of individuals, they don’t need to agree on what Truth is, to create a world of good faith.

It was gil00 who brought me this tweet, wondering if it was important. I told her at the time that I needed to do a post on it, but that is just the beginning of its importance. Tradebait, Gail Combs, and the rest of the gang, also saw that this was a biggie.

The fact that it contains one of three graphs that “change everything”, should give you an idea of exactly how important I think it is.

ALL Americans need to understand this graph.

No – I take that back. All intelligent life within the sphere of influence of this planet and this moment need to understand this graph. THEY THE PEOPLE need to understand exactly who they’re dealing with.

Let’s blow that up a bit…..

Before telling you WHY, let me assure you that there are MANY more graphs like this, which will all say roughly the same thing – IF one is honest enough to let the data talk. I choose this graph because it’s probably the clearest and simplest that I’ve seen so far – due in large part to its creator, The Ethical Skeptic, or “TES” as I will refer to him now.

We have talked about TES’s work before, since he emerged as one of the most skillful and impossible-to-censor critics of what might be called “Fauci science”. I may quibble with minor points on his more far-reaching hypotheses and theories, but I always find that his general and bigger principles “age spectacularly well”, and are best taken very seriously at the earliest possible moment.

Again, hence the need for this post.

Here is what I said originally – it was my “initial reaction”. You don’t have to follow it too closely, unless you find it all obvious. I’m going to explain this in detail.

By looking just at blood and immune disorders, and comparing mortality of 2018-2019 (pre-COVID) as a baseline (which was then extended by seasonal extrapolation into 2020, 2021 and 2022, with normal population increase meaning a slight increase in deaths), and then looking at 2018-2022 actual for all years, using the actual figures, but removing COVID, one can see the population reduction effect of the jabs, as the excess cardio and immune mortality, which just keeps increasing with time.

It’s clear as a bell in the data, when one compares to the “expected deaths based on the last two years of pre-COVID times”.

The striking thing is how STRONGLY the sum which includes 2020 and 2021 deviates away from the prior years, starting exactly with the jabs.

2020 includes TESTING of jabs.
2021 includes DEPLOYMENT of jabs.
2022 includes BOOSTING of jabs.

It’s a depop shot. And it works. All they would have had to do is dial up the dose just enough, while normalizing the deaths with the media, and it’s totally tunable to the rate of depop that one desires.

OK – so what does all that mean?

Let’s take it slower.

First of all, at any time, you can go to theethicalskeptic.com and check out his article on this topic, which does not YET have THIS particular graph (except in the comments), but which will likely have said graph in the next two parts of the article.

LINK: https://theethicalskeptic.com/2022/08/20/houston-we-have-a-problem-part-1-of-3/

I also call your attention to this highlighted point made near the beginning of the article.

Nonetheless, by the end of 2021 it had become abundantly clear that US citizens were not just dying of Covid-19 to the excess, they were also now dying of something else, and at a rate which eventually became higher than that of Covid itself.

The Ethical Skeptic, Houston, We Have a Problem (Part 1 of 3)

If you just read that, where TES couches his words VERY carefully, and you know what he’s hinting at, then you know why I said this is one of the three big graphs you need to understand. He ain’t lyin’. My only quibble is that I suspect that his estimate of “decades” of damage to health policy may be conservative, and “centuries” is a horrifying possibility.

Are you ready to dig into the graph?

GOOD. Here we go.

Let’s start with some ACRONYMS.

  • NHCS = National Center for Health Statistics
  • MCD = MCoD = Multiple Cause of Death
  • UCoD = Underlying Cause of Death
  • ICD-10 = International Classification of Diseases, Tenth Revision
  • MMWR = Morbidity and Mortality Weekly Report
  • wk = week
  • M-Avg = moving average (see: https://en.wikipedia.org/wiki/Moving_average)
  • Dnm (n = 5-8, m = 0-9) = Death codes

This is enough to understand it fully.

The basic graph is DEATHS going up on the left, and TIME going across from left to right, over a period of YEARS.

The DEATHS on the left are showing from 350 per week (at the bottom left) to 950 per week (at the top left). That means that we are not seeing the 0-350 region, which is featureless and below the portion of the graph that we can see. It’s a legitimate suppression – it’s not hiding anything except relative magnitudes of the changes to a SMALL extent, and it helps us see the differences in those changes better. It’s a magnifier – just remember that it’s there.

The title says that this is US-NCHS data for Multiple Cause of Death, meaning it’s looking at all causes of death listed on death certificates in the US and then databased by the National Center for Health Statistics, which is part of the CDC. This database is then searchable online.

The title also says that this data is for SELECTED cause-of-death codes listed in the ICD-10 system. The data runs up to week 29 of 2022, and is adjusted for the lag in reporting to CDC at the end (see right-hand side).

Let’s jump briefly to the topic of those codes.

Using the drop-down buttons you can see in the image, TES has chosen death codes 50-89, but has excluded COVID-19. Those codes are briefly described as “diseases of the blood and blood-forming organs” (but excluding COVID-19). TES has also selected ALL ages.

In the lower left you can see several descriptions of that different groups of the D-codes mean. Generally speaking, these are related to blood, blood-forming organs, and some immune problems. We will quote from TES himself about these later.

This does NOT include cardiac arrests, strokes, and certain other “stereotypical” clot-shot diseases, but it DOES include more “obscure” diseases that we can intuitively expect would be affected by both COVID and the CLOT SHOT. Thus, it serves as a kind of sensitive test for “something bad in the blood”.

A critical point for understanding is in the subtitle below the title.

2020/21/22 Compared to Baseline 2018/19

What this means is that what we are really doing OVERALL is looking at the 3 years of data “from and after Wuhan COVID”, 2020-2022, and comparing those numbers to “before Wuhan COVID”, 2018-2019. This explains why there are TWO curves on the graph. But in order to do this VALIDLY, we have to PROJECT the numbers from 2018-2019 FORWARD into the next three years, since the baseline would automatically increase on its own. Thus, we have TWO CURVES that run for all 5 years.

It helps to look at the red dashed curve first. This is listed as 2018-2019 Baseline 5 week moving average. Don’t worry about the “moving average” stuff. What this does is to take a bunch of scattered points and smooths them into closer points that can be used to draw a curve through them. It’s a neat trick to create the “best curve through scattered points”.

You can see that this is a bumpy “sawtooth” curve, higher in the winter, lower in the summer, and slowly rising over time. Typically, over time, this is what you see. Every year can be predicted largely from one or more prior years. You just take the past, find all the patterns you can, and project them all into the future.

There is a related red note in the lower left corner of the graph that says “1.4% baseline growth rate”. This is the annual growth in the baseline numbers from 2018-2019. The numbers vary rather strongly from month to month, but not much year from year, meaning that it’s easy to predict what they SHOULD look like in future years, such as 2020, 2021, and 2022. Each year will look pretty much like the last, months and weeks will go up and down, but day to day it will be 1.4% higher than the previous year, following the patterns of previous years.

This idea works remarkably well.

OK – so what is the pink solid line? THAT is the ACTUAL NUMBERS, for all five years, from week to week, using a 7-week moving average, and reporting it as the LAST week of the seven weeks. This is where we’re going to find any interesting phenomena.

The use of a DIFFERENT number of weeks for the multi-week moving average serves as a kind of sanity check in the region where both curves derive from the same ACTUAL data (2018-2019). The curves will not be much different, and the differences are just an artifact of the methodology, but if you see a big difference in that region of the same actual data in both curves, it’s probably meaningful, and probably something WRONG in your processing of the data.

Any minor differences you DO see in the region of actual data vs. itself (2018-2019), serve as a nice comparison of SCALE to any systematic differences you see in the 2020-2022 region, which is the region of ACTUAL DATA (pink solid) versus PROJECTED DATA (red dashed).

For example, if TES has a similar graph for some code like automobile accidents or choking on food, you can confidently predict that ACTUAL data for 2020-2022 should match the curve for PROJECTED DATA from 2018-2019 fairly closely – apart from any unexpected societal effects of COVID such as lockdowns, but those would then appear rationally in the data.

SO WHAT DO WE SEE?


TL;DR – the actual deaths begin to exceed the projected deaths in stages, with a lesser jump happening due to COVID itself, but a far bigger jump (over 2.5 times as big) happening after people began taking the jabs in a big way in April of 2021.


Looking at the two curves with the innocence of a child, we see them separating in stages. We see them separate a certain amount (call it 1X) during spring and early summer of 2020 (call this region 1), then separating about twice as much (2-3X) during summer, fall and winter of 2020, and early spring of 2021 (region 2). Then, in late spring of 2021, the separation grows suddenly and substantially (7-10X) (region 3), and it just keeps growing into 2022 (15X+).

This is NOT an accident. TES knew that the vaccines began being given in a big way around week 14 of 2021 (early mid-April), as shown by this graph.

TL;DR – this additional graph shows how the slope (derivative) of total jab doses given is used to see when most of the jabs were administered. This is near the beginning of dosing, and explains the sudden rapid widening between the two curves in the primary graph. It’s a “pandemic of vaccination” much like COVID itself.

Based on this date, TES looked for ICD codes which show a dramatic WIDENING at “Critical Inflection 1” – meaning when the jabs were introduced (what I called the beginning of region 3), VERSUS any prior widening in spring of 2020, when COVID-19 of the Wuhan strain was introduced (what I called the beginning of “region 1”).

Stated differently, TES is only counting things which appeared dramatically MORE for the jabs, than they did for COVID itself.

Basically, TES is being “too fair” to the jabs. We know that there are many causes of death by both COVID and the JABS, “because spike protein”, but if it’s not overwhelmingly obvious IN THE DATA that they’re significantly and primarily due to the jabs, he’s not counting them.

He’s letting a bunch of jab deaths “get away”, to make sure that he’s indicting only real jab deaths.

As a side-note, this is what Gregg Phillips did with True The Vote’s geospatial data, by only counting the most blatant and obviously organized mule data (10 drop boxes and 5 stash houses). It becomes almost impossible to criticize the science, when data is winnowed down to exclude even the most marginally debatable data.

Deny the unethical skeptics even a foothold, and they cannot even begin to raise an unethical argument.

Pretty BOSS LEVEL if you ask me.

Here is what TES has to say about the ICD codes that he used.

With regard to these select ICD-10 codes, I have endeavored to highlight only those which have exhibited a stark difference between their arrival patterns during the 2020 pandemic period, and that period after MMWR Week 14 2021. While there are indeed increases in deaths incumbent inside the other ICD-10 codes, those increases appeared to plausibly conform to their same arrival patterns for 2020 as well. In other words, they appeared to be heavily Covid-related in their dynamics, both before and after the Week 14 2021 inflection.

Of particular concern, are those deaths which relate to body-wide regulatory systems as opposed to specific organs or causes. In other words, cancer and lymphomas, heart, autonomous myocarditis/pericarditis/conductive disorders, injuries to the liver and kidneys, etc. These are not only the canaries in the coal mine in terms of pathology, but may serve to indicate as well that a pervasive systemic disruption is at play inside the average US citizen human physiology, especially over the last 71 weeks. These are the death groups which exhibit the most stark trend of increase post MMWR Week 14 2021.

There have nevertheless been some attempts to “take down” TES’s analysis, but after two of them were burnt to a crisp on Twitter, it’s pretty clear that these attacks were not “ethical skepticism”, but in fact beautiful examples of what has happened to science in the wake of politicization and corruption. One academic was even outed by a sharp Twitter user as a practiced shill for the Faucism narrative, referred to humorously as “a regular on the fact-check circuit”.

NOW, knowing what the graph means – that the cure turned out to be worse than the disease (something which Trump said could not happen, thus forcing a coup to maintain the plot) – it is really worth it to go back and read TES’s article, if you have not already.

LINK: https://theethicalskeptic.com/2022/08/20/houston-we-have-a-problem-part-1-of-3/

It’s tough science, but even if you just “kinda get it”, it’s WORTH IT.

It is important to read the comments at the end, too. Not only does TES have links to his Twitter defenses, and the graph highlighted in this article appears – there is comment by somebody who did a rough calculation based on mRNA therapies that have failed human trials in the past. Based on his calculations…. well, let me just quote.

Great work. I did a small quick model using a Gaussian Distribution over 9 years to see what the numbers would be each year for “events” given 80% of the total population vaccinated had active ingredients and would develop events similar to past other mRNA failed trials. 7,887 deaths per week is about 179% above my model for 2022. If the past is indeed playing out here, this excess deaths per week will increase by a factor of 9 over the next year. Most adverse events in past similar trials did not take place until year three. By year six, 84% of the cohort was positive for adverse events.

https://theethicalskeptic.com/2022/08/20/houston-we-have-a-problem-part-1-of-3/#comment-12577

TL;DR – It’s now very likely that these late jab deaths will increase dramatically during the next few years, based on mRNA therapy trial information which was available but seemingly ignored.

Watch this video if you have 3 minutes.

I would even go so far as to say that this highly censored video of an alleged mRNA trial participant from several years ago (see above), breaking his NDA and claiming serious cardiac problems affecting almost all of the people in his trial, may not be a fraud.

If that video is entirely true, then based on his numbers, my assessment is that his trial was very likely a secret depopulation trial flying under the false flag of a secret mRNA therapy trial. Which may then make COVID-19 and the jabs, the mother of all false flags.

In my opinion it is important to force the finding and recognition of the truth, so that we can begin saving the people who are not lucky.

Any effort to work toward #TeamHeadsOnPikes to prevent the next one of these incidents from happening, is a separate problem I leave for others. I’m a bit too good at forgiving.

TL;DR – There has been plenty of data telling us that the jabs are problematic, but now we are faced with very clear proof that CDC must easily see in their own data, yet pretends not to see. Combine these two memes.

The illogical arguments conceal real goals and tactics.

Buckle up. They know we know, and they have a plan for it.


Even More Mood Music

(Because you must FEAR CARBZILLA!)

https://youtu.be/BJHuX_jeSf4

Carbon Dioxide Is Life’s Friend and Savior

TL;DR – This graph shows terrestrial life’s remarkably high tolerance for carbon dioxide (which is basically recirculating plant life), but poor tolerance of meteoric impacts during times of low CO2 and preliminary glaciation. We are being severely gaslit, to see climate science backwards, and to operate from reflexive fears which prevent full, true and larger understanding.

The graph you see above is NOT the first one that I saw, which blew my mind, but it’s very similar. The one I saw was basically the orange line, and may have been GEOCARB III or a comparable study. It had the exact same principle features, which told me the same things.

Apparently I missed the “mass formation psychosis” in climate science, and just happened to walk in with my “They Live” glasses on.

Let me state for the record that “I am neither a professional geologist nor an earth scientist, but I have loved the subjects my whole life, and I can read a graph.”

More crucially, I have always been an “allied science fan” of geology and earth science – in part because earth chemistry and earth biology happen on this wonderful planet called Earth. Follow either of these sciences back to the basics, and earth science matters.

Back to the graph.

It’s worth explaining the basics of the scale across the bottom, which is time.

We are at the very end of the graph – a slice so thin that our lives will not show up even under a magnifier. Bring out a microscope and see a tiny hair’s breadth under it. That’s us.

We are at the most recent edge of the Neogene – which is the N on the bottom of the graph. That N is 23 million years. The “preparatory ancestry” of anything strongly resembling our kind easily fits into that, as best as we can tell. You might call it “the age of man“, where man includes pre-men and barely men.

Probably even these guys and gals.

Humans trying to understand climate science.

Next to the left is the Paleogene, abbreviated Pg. This is the “age of mammals“. You will note that while it is much bigger than the Neogene, it is still a VERY SMALL fraction of the history of life on the planet.

Let’s blow it up a bit, using a DIFFERENT type of graph, which is more of a timeline. More recent is at the top.

The three most significant climate events of that time period are on the right. They all bear explanation.

First, Antarctica got its first RECENT permanent ice sheets only a bit over 50 million years ago, near the END of this prior period, and the start of the “age of man”. When you see NOVA specials about Antarctic dinosaurs, or read about fossil specimens from Antarctica, this is why you see them. Antarctica used to be WARM, and gradually cooled down.

Interestingly, Antarctica has never* (*not settled) strayed far from the South Pole. It has not wandered “north-south” as much as many other land masses.

LIFE has at most times covered the entire globe. Life had not RETREATED from the poles to the extent that is has now. Indeed, polar life may have assisted in recovery from some mass extinctions, where prompt damage occurred primarily at the middle latitudes due to normal circulation patterns.

Next, look at the event called “PETM”, which stands for Paleocene–Eocene Thermal Maximum. It’s actually a SPIKE that looks like the thin spike in THIS graph.

This graph is looking at global temperatures (green curve) as determined from oxygen isotopes, VERSUS time, across the “age of mammals”. Recent is on the right.

WOW. Will you look at how much temperatures have fallen. And look at that crazy chaotic glaciation in the lower right, flirting repeatedly with the snowball Earth of the Permian Extinction (to be discussed in a bit).

I don’t know about y’all, but if I had to be concerned about something, it might be that.

TL;DR – it is impossible to look a graphs which show life bottoming hard against planetary freeze, in the big picture of carbon dioxide (recirculating plant life) bottoming hard in conjunction, and walk away with any true sympathy for worries about increasing CO2 and warming. CO2 in times of its relative absence is either not a problem, or a “good problem”. It appears to me that a cultivated science error has been used to create a social hysteria and then a mass formation psychosis.

In a sense, we are ALL the “polar bears of the dinosaurs”. Is that a good thing? I think it’s worth asking, even just theoretically, never implying the need to “do something” about it.

Anyway, that little SPIKE you see in the spiky curve to the left, is an actual example of a “climate change crisis”. It was probably due to sudden period of massive volcanic activity throwing a bunch of CO2 into the air, although that’s not “settled science”. If there was a weird “solar excursion”, or undersea heating of the oceans (see extremely useful “non-eruptive volcanism” proposals by TES for part of recent global warming), then it could have been something else. Whatever it was, it seems to have been sharp enough to have probably been a single thing.

Note also that Earth got to the same point some years later, anyway.

Don’t fear the seasons. They’re not the reaper.

Lastly, we see in the timeline, at the beginning of the Paleogene, the K-Pg mass extinction, (also called, in its evidentiary form, the K-T boundary) which was almost certainly due to an asteroid impact, but possibly also reinforced by subsequent volcanism.

You may recall Steve’s post about this, but if you don’t, then take a quick detour and refresh your memory on the details.


Iridium: The Smoke From The Smoking Gun

4.567 billion years ago, our solar system began to “condense” from the nebula. Clumps of dust particles began to come together, part of a poorly-understood process that eventually led to the planets. The nebula had a potpourri of “stuff” in it. Mostly elements up to iron, with a heavy leavening of ones after iron, created in supernovas or even neutron star collisions. (Most gold is believed to have come out of neutron star collisions…next time you admire that gold coin or your wedding band…think about where that stuff has been! Any of it not from a collision got blasted out of a supernova at 70,000,000 miles per hour.)……

https://www.theqtree.com/2021/04/03/2021%c2%b704%c2%b703-joe-biden-didnt-win-daily-thread/

Steve explained that while most of paleontology favors the “impact theory”, there has been a long-standing volcanic theory of the extinction, and even a group who believes that BOTH theories are not only correct, but connected.

With my taste for “AND logic”, you can predict where I would most likely fall in that debate – in the “it’s both of them, and they’re connected” camp.

Does that sound sketchy? Maybe a little too much of a coincidence? Is Wolf going out on a limb here?

Notice that by mentioning that Steve had mentioned this “theory of both”, I used PEER INFLUENCE to change your minds. Now I will use MSM acceptance to further change your minds.

TL;DR – Theories about impacts leading to increased volcanism also implicated in extinctions, are quite appealing to me, personally, as a kind of “general volcanism” (impact + rebound), but the whole thing is NOT settled science by any means. Just remember what I always say about “AND logic”. It solves scientific divisions, too.

But wait – I want to make a point about the Fake News in action, spinning science to keep it divided.

Yes, you see the “AND” logic right in the title. And if you read the article, the whole point is that there is increasing evidence of a causal connection between the impact and the volcanism.

But notice the wording in the title versus the subtitle. The title tells you, but does not emphasize, that the conjoint, causatively connected, unified theory brings two scientific camps together, both being correct. Then the subtitle tries to shift things over to one of the explanations, and to minimize the role of the impact.

The 160 million-year reign of the ‘terrible lizards’ may actually have ended due to events in India rather than an asteroid crashing into the sea off the coast of Mexico as previously thought

“RATHER THAN”?

“Rather than” an asteroid the size of Mount Everest?

It’s very clear folks – THEY WANT YOU DIVIDED.

By now you know, it’s just what they do. DIVIDE AND CONQUER. Indeed, I tend to think it’s what they’re TRAINED to do.

The FAKE NEWS controls science FAR MORE than most scientists are willing to admit.

But let’s get back to our story of the unified theory of impact AND rebound volcanism.

The primary CLIMATIC effects of the asteroid impact are believed to have been blast heating, followed by an “impact winter”, followed by chaotic climate, possibly including a greenhouse due to vaporized CO2 and SO2, followed by the same thing from further classic volcanism. The whole planet was definitely MESSED UP.

TL;DR –

HOT (impact). COLD (darkness). HOT AGAIN (greenhouse).

Then repeat the latter two for post-impact volcanism.

A constant, unified pattern of impact extinctions, layered on the preexisting, livable climate, at a surprisingly wide range of levels of carbon dioxide.


So what was there before that?

THE DINOSAURS. That is “K”, the Cretaceous Period (in English).

You will notice that T (or Tr), J and K are the three big periods of the dinosaurs with which most of us are familiar – the Triassic, Jurassic, and Cretaceous.

Let’s look at our graph again.

Yes. This “age of dinosaurs” was a period of warm temperatures and high carbon dioxide. Both much higher than what we have now, but – bear with me – there was a lot of LIFE, too – am I not right?

Well, what’s that stuff to the LEFT of the “age of dinosaurs” – around the end of “C” (Carboniferous) and the beginning of “P” (Permian – the “age of reptiles”)?

Why, it looks like low carbon dioxide, almost as low as we have now. In FACT, if you look even further back in time to the left – at the ages of sea organisms (Cm, O, S), fishes (D), and amphibians (C), what you’re basically seeing is a CRASH of carbon dioxide, ending in LOW CO2 around C and P.

And interesting that this slide had already resulted in massive glaciation of the planet, which existed at the beginning of the Permian.

Interesting that there were THREE BIG EXTINCTIONS along that slide, at O, D, and finally at P.

There is a LOT of debate about these extinctions, and particularly the near-total Permian (P) Extinction, also sometimes known as the P-T extinction event, because it occurred at the END of the Permian and the beginning of the Triassic.

Of course, global warming explanations of this event are favored by the single-minded corporate media, but IMO some of the best theories of the P-T extinction are actually based on an “iceball Earth” scenario, for which there is some interesting geological evidence.

The idea that an already glaciated Earth (Permian) was sent into deep freeze by an impact and response volcanism makes sense, and we would expect the extinctions to be more extensive than with the less glaciated or non-glaciated Cretaceous extinction of the dinosaurs, which happened to a generally warmer planet, thus sparing mammals and birds.

TL;DR – As the most significant extinctions have occurred at times of low CO2 and high glaciation, the main danger to life on Earth seems not to be global warming from CO2, which protects life from near-total extinctions. The main threat is solar blocking (see Bill Gates) and deep cooling, caused by meteoric impacts and rebound volcanism, which is more dangerous during times of low CO2 and high glaciation, like now or during the Permian Extinction.

In fact, I find the idea that we can use a single extinction mechanism repeatedly – a mechanism of “impact plus response volcanism, leading to plant death and further crises”, with the differences in outcome depending upon the size and location of the impact, plus the prior state of the climate, to be very satisfying – particularly in explaining why we find evidence for ALL of the various divided theories.

Furthermore, if response volcanism is a correct theory, then the general warmth and higher carbon dioxide of the “age of dinosaurs” may be explained by a truly massive impact being not only the cause of the P-T extinction, but also creating hundreds of millions of years of increased volcanism in its wake.

But all of that is debatable.

The big picture is this. Look at the graph again.

TL;DR – The Earth has supported life easily for eons because of MORE carbon dioxide, not less. There is no “climate emergency”, and certainly not one related to increasing carbon dioxide for ANY reason at this point. If anything, incipient normal solar cooling and periodic ice age glaciation are actual climate concerns for society. But that is another story for another time.


One More Bit of Mood Music

(Real World by Matchbox 20)


Green Energy Is Pol Pot Madness

TL;DR – Even if there was a “climate emergency” (which there is not, see above), and even if “green energy” worked (which it does not, see graph), and even if green energy could “save the environment” (which it absolutely does the opposite, due to energy density fundamentals), what we are doing by forcing a sudden transition to a non-working energy infrastructure, is so utterly preposterous, wrong, and irrational, that it must be stopped.

This graph is the smoking gun of an intentional civilizational crash. It is our duty to grab the steering wheel and stop it.

This graph is probably the simplest to explain because it does not depend on the truth or falsehood of the underlying bad science that has been used to justify what is being done now.

There are some things you just don’t do.

It’s like an insane person coming into your house screaming “DANGER, DANGER” and pointing a gun at you. Even if there is some reason, it doesn’t matter – an insane person is pointing a gun at you, and THAT is the immediate danger. The evil person or people who SENT the insane person to your house must be dealt with, too, or this will keep happening. But that can happen after we survive the insane attack.

Humanity is being “swatted” by people made insane by – you guessed it – mass formation psychosis.

TL;DR – One cannot move humanity from the top curve in red, to the bottom curve in yellow, without killing most of them. It’s impossible. It means poverty, chaos, and destruction. The closest thing to what “somebody” is forcing on the West, is what China and the CIA did the the people of Cambodia, using the highly deluded Khmer Rouge, who insisted that all Cambodians had to leave cities and become agrarian.

Khmer Rouge Flag (Pol Pot)

Forcing humanity to “quit realistic energy now” is perfectly analogous to Pol Pot saying “We all have to become farmers now” at gunpoint, which killed millions of Cambodians in a horror of totalitarian brutality and systematic societal error.

If you don’t think we have a deluded set of Americans who could carry this out, just look at Antifa, filled with mentally ill “trans” males, all of them “politically fluid” and ready to serve the craziest causes, and then politically reverse on orders, the very next day. Antifa is being protected by the DOJ and FBI, which are also ready to stop or hinder any groups which oppose Antifa.

Now you can understand why Antifa and FBI helped each other on January Sixth.

They’re both on the same side – the side of the genocide.

And now Biden wants 87,000 federal “IRS Police”?

What this graph shows is the equivalent of telling a patient addicted to barbiturates that they must quit cold turkey, which is always fatal.

It’s like telling a lifelong juvenile diabetic that they must quit insulin NOW because insulin didn’t come from their own pancreas, and so it’s “foreign”, and no good. They must transition to “mRNA injections in the pancreas” right now! RIGHT NOW!!!

Yup. It is THAT insane – that malevolent – to say “quit all non-green energy now”. To even say “do it in the next century” is foolishness of historic proportions.

We are already seeing the effects of the insanity in the beginning energy problems we are having now. But we have seen NOTHING yet.

Add to THAT insanity, what amounts to yet another foolish collectivization of agriculture, which “error” of communism has repeatedly killed millions, in the Soviet Union and China, as well as in Cambodia, and you can see that the errors of a misled scientific elite are always catastrophic, whether intentional or accidental.

TL;DR – Eisenhower predicted that, in addition to the military industrial complex (MIC), a scientific and technological elite (STE) would become a danger to America and the world, and he even understood and predicted that this very moment might arrive.

If you have time (16 minutes), this presentation is critical to understanding the moment. Every second is worth hearing.

If you get the sense that somebody of malevolent intent was listening to Eisenhower’s speech, and began figuring out how to sabotage his vision of balance and sense, by pursuing a course to enhance and take advantage of precisely the dangers that Eisenhower warned about, then you are not alone.

W

Text of the Eisenhower Farewell Speech

LINK: https://www.archives.gov/milestone-documents/president-dwight-d-eisenhowers-farewell-address#transcript


My fellow Americans:

Three days from now, after half a century in the service of our country, I shall lay down the responsibilities of office as, in traditional and solemn ceremony, the authority of the Presidency is vested in my successor.

This evening I come to you with a message of leave-taking and farewell, and to share a few final thoughts with you, my countrymen.

Like every other citizen, I wish the new President, and all who will labor with him, Godspeed. I pray that the coming years will be blessed with peace and prosperity for all.

Our people expect their President and the Congress to find essential agreement on issues of great moment, the wise resolution of which will better shape the future of the Nation.

My own relations with the Congress, which began on a remote and tenuous basis when, long ago, a member of the Senate appointed me to West Point, have since ranged to the intimate during the war and immediate post-war period, and, finally, to the mutually interdependent during these past eight years.

In this final relationship, the Congress and the Administration have, on most vital issues, cooperated well, to serve the national good rather than mere partisanship, and so have assured that the business of the Nation should go forward. So, my official relationship with the Congress ends in a feeling, on my part, of gratitude that we have been able to do so much together.

******

We now stand ten years past the midpoint of a century that has witnessed four major wars among great nations. Three of these involved our own country. Despite these holocausts America is today the strongest, the most influential and most productive nation in the world. Understandably proud of this pre-eminence, we yet realize that America’s leadership and prestige depend, not merely upon our unmatched material progress, riches and military strength, but on how we use our power in the interests of world peace and human betterment.

******

Throughout America’s adventure in free government, our basic purposes have been to keep the peace; to foster progress in human achievement, and to enhance liberty, dignity and integrity among people and among nations. To strive for less would be unworthy of a free and religious people. Any failure traceable to arrogance, or our lack of comprehension or readiness to sacrifice would inflict upon us grievous hurt both at home and abroad.

Progress toward these noble goals is persistently threatened by the conflict now engulfing the world. It commands our whole attention, absorbs our very beings. We face a hostile ideology-global in scope, atheistic in character, ruthless in purpose, and insidious in method. Unhappily the danger it poses promises to be of indefinite duration. To meet it successfully, there is called for, not so much the emotional and transitory sacrifices of crisis, but rather those which enable us to carry forward steadily, surely, and without complaint the burdens of a prolonged and complex struggle-with liberty at stake. Only thus shall we remain, despite every provocation, on our charted course toward permanent peace and human betterment.

Crises there will continue to be. In meeting them, whether foreign or domestic, great or small, there is a recurring temptation to feel that some spectacular and costly action could become the miraculous solution to all current difficulties. A huge increase in newer elements of our defense; development of unrealistic programs to cure every ill in agriculture; a dramatic expansion in basic and applied research-these and many other possibilities, each possibly promising in itself, may be suggested as the only way to the road we which to travel.

But each proposal must be weighed in the light of a broader consideration: the need to maintain balance in and among national programs-balance between the private and the public economy, balance between cost and hoped for advantage-balance between the clearly necessary and the comfortably desirable; balance between our essential requirements as a nation and the duties imposed by the nation upon the individual; balance between action of the moment and the national welfare of the future. Good judgment seeks balance and progress; lack of it eventually finds imbalance and frustration.

The record of many decades stands as proof that our people and their government have, in the main, understood these truths and have responded to them well, in the face of stress and threat. But threats, new in kind or degree, constantly arise. I mention two only.

******

A vital element in keeping the peace is our military establishment. Our arms must be mighty, ready for instant action, so that no potential aggressor may be tempted to risk his own destruction.

Our military organization today bears little relation to that known by any of my predecessors in peace time, or indeed by the fighting men of World War II or Korea.

Until the latest of our world conflicts, the United States had no armaments industry. American makers of plowshares could, with time and as required, make swords as well. But now we can no longer risk emergency improvisation of national defense; we have been compelled to create a permanent armaments industry of vast proportions. Added to this, three and a half million men and women are directly engaged in the defense establishment. We annually spend on military security more than the net income of all United State corporations.

This conjunction of an immense military establishment and a large arms industry is new in the American experience. The total influence-economic, political, even spiritual-is felt in every city, every state house, every office of the Federal government. We recognize the imperative need for this development. Yet we must not fail to comprehend its grave implications. Our toil, resources and livelihood are all involved; so is the very structure of our society.

In the councils of government, we must guard against the acquisition of unwarranted influence, whether sought or unsought, by the military-industrial complex. The potential for the disastrous rise of misplaced power exists and will persist.

We must never let the weight of this combination endanger our liberties or democratic processes. We should take nothing for granted only an alert and knowledgeable citizenry can compel the proper meshing of huge industrial and military machinery of defense with our peaceful methods and goals, so that security and liberty may prosper together.

Akin to, and largely responsible for the sweeping changes in our industrial-military posture, has been the technological revolution during recent decades.

In this revolution, research has become central; it also becomes more formalized, complex, and costly. A steadily increasing share is conducted for, by, or at the direction of, the Federal government.

Today, the solitary inventor, tinkering in his shop, has been over shadowed by task forces of scientists in laboratories and testing fields. In the same fashion, the free university, historically the fountainhead of free ideas and scientific discovery, has experienced a revolution in the conduct of research. Partly because of the huge costs involved, a government contract becomes virtually a substitute for intellectual curiosity. For every old blackboard there are now hundreds of new electronic computers.

The prospect of domination of the nation’s scholars by Federal employment, project allocations, and the power of money is ever present and is gravely to be regarded.

Yet, in holding scientific research and discovery in respect, as we should, we must also be alert to the equal and opposite danger that public policy could itself become the captive of a scientific-technological elite.

It is the task of statesmanship to mold, to balance, and to integrate these and other forces, new and old, within the principles of our democratic system-ever aiming toward the supreme goals of our free society.

******

Another factor in maintaining balance involves the element of time. As we peer into society’s future, we-you and I, and our government-must avoid the impulse to live only for today, plundering, for our own ease and convenience, the precious resources of tomorrow. We cannot mortgage the material assets of our grandchildren without risking the loss also of their political and spiritual heritage. We want democracy to survive for all generations to come, not to become the insolvent phantom of tomorrow.

******

Down the long lane of the history yet to be written America knows that this world of ours, ever growing smaller, must avoid becoming a community of dreadful fear and hate, and be, instead, a proud confederation of mutual trust and respect.

Such a confederation must be one of equals. The weakest must come to the conference table with the same confidence as do we, protected as we are by our moral, economic, and military strength. That table, though scarred by many past frustrations, cannot be abandoned for the certain agony of the battlefield.

Disarmament, with mutual honor and confidence, is a continuing imperative. Together we must learn how to compose difference, not with arms, but with intellect and decent purpose. Because this need is so sharp and apparent I confess that I lay down my official responsibilities in this field with a definite sense of disappointment. As one who has witnessed the horror and the lingering sadness of war-as one who knows that another war could utterly destroy this civilization which has been so slowly and painfully built over thousands of years-I wish I could say tonight that a lasting peace is in sight.

Happily, I can say that war has been avoided. Steady progress toward our ultimate goal has been made. But, so much remains to be done. As a private citizen, I shall never cease to do what little I can to help the world advance along that road.

******

So-in this my last good night to you as your President-I thank you for the many opportunities you have given me for public service in war and peace. I trust that in that service you find somethings worthy; as for the rest of it, I know you will find ways to improve performance in the future.

You and I-my fellow citizens-need to be strong in our faith that all nations, under God, will reach the goal of peace with justice. May we be ever unswerving in devotion to principle, confident but humble with power, diligent in pursuit of the Nation’s great goals.

To all the peoples of the world, I once more give expression to America’s prayerful and continuing inspiration:

We pray that peoples of all faiths, all races, all nations, may have their great human needs satisfied; that those now denied opportunity shall come to enjoy it to the full; that all who yearn for freedom may experience its spiritual blessings; that those who have freedom will understand, also, its heavy responsibilities; that all who are insensitive to the needs of others will learn charity; that the scourges of poverty, disease and ignorance will be made to disappear from the earth, and that, in the goodness of time, all peoples will come to live together in a peace guaranteed by the binding force of mutual respect and love.


Final Musical Selection

(Dedicated to Trump’s friend Shinzo Abe.)

President Trump & Melania share traditional Japanese dinner with Prime Minister Abe & wife.