The COVID-19 Virus and the modRNA COVID-19 “Vaccines” Induce Accelerated Aging

https://i.postimg.cc/gch5SRRq/Ponce-de-Leon-and-the-mythical-Fountain-of-Youth.jpg

Prefatory Note: This series of pieces on the ongoing disaster of COVID-19 and the COVID-19 “vaccines” is dedicated to my late cousin Bill, who “died suddenly and unexpectedly” in September, 2023. He was a quiet-spoken man, studied philosophy at Notre Dame, owned and ran his own companies. He was, as Yours Truly is, the child of a pharmacist — his father, my late uncle William, went to pharmacy school with my late father on the GI Bill after they served in World War II. Cousin Bill was a hearty man who enjoyed life. He was diagnosed with two heart ailments in the spring of 2022, and was doing well with treatment — until September, 2023. May he rest in eternal Peace.

What Yours Truly will present today regards how the COVID-19 virus itself, let alone the modRNA COVID-19 “vaccines”, can apparently induce a form of “accelerated aging” that Yours Truly will call “quasi-progeria.” This topic was presented and discussed on the board here some months ago. There is more information now about how this induced “accelerated aging” occurs.

The following is “not to weary by recitals”, in the words of the Duc de Saint-Simon, the memoirist, but some basic background information is useful.

There are several important “mechanical” body elements that are involved in the aging process: the mitochondria; the telomeres; and the endothelium, among others. Mitochondria are things called organelles and are found in cells. They have a kind of double “membrane” and perform a type of “breathing” called aerobic respiration. This respiration is then used by the cell as a chemical energy source. Telomeres are tiny areas on the ends of chromosomes that have nuclear sequences. When these sequences begin die off, they aren’t replaced; the telomeres simply “shorten” themselves. Cell death occurs when the telomeres become too short to “keep going.” The endothelium is the layer of cells that line the inner surface of the body’s blood vessels. Dysfunction of, or damage to, any or all of these organisms can have a negative effect on the aging process of the body. In the case of HGPS (Hutchinson-Gilford Progeria Syndrome, or, simply, progeria), these elements and more are involved in a body-wide rapid and progressive “early aging” condition that begins in early childhood and which is invariably fatal to the patient. Most people who have HGPS die before the age of 20, with severe heart complications leading to death as the cause. (Remember the item about heart complications for later on in this piece.)

It appears that there are elements within the SARS-CoV-2 virus (the COVID-19 virus) itself that damage or cause dysfunction to the mitochondria, the telomeres, and the endothelium of the body of someone who contracts an infection of the virus. Since the SARS-CoV-2 virus itself is the foundation of the COVID-19 “vaccines”, it is reasonable to assume, and arguable, that the elements that damage or cause dysfunction as described above will also be present in said “vaccines.” Without getting extremely technical, Yours Truly believes that a great deal of detailed investigation — and, possibly, experimentation — took place while the SARS-CoV-2 virus was in lab development in order for certain exact elements to be inserted into the virus which would specifically target certain exact mechanisms and elements of the mitochondria, the telomeres, and the endothelium of the body. One certain exact element, for example, could be the MCLK1 enzyme of the mitochondria, a reduced level of which causes dysfunction, oxidative distress, and ultimately cell death. “Mitochondria and Reactive Oxygen Species in Aging and Age-Related Diseases”, Carlotta Giorgi, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC8127332/

One now turns to the research of Walter M Chesnut on the topic of “accelerated aging” caused by the COVID-19 virus (and, by extension, the COVID-19 “vaccines.”) Mr. Chesnut has been writing on his blog (see below) about this “accelerated aging”, and what it does to the body, for over a year; for example, this blog post of January, 2023: https://wmcresearch.substack.com/p/urgentbreaking-updated-summation. The pull quote from this post: “The Wizard is indeed behind the curtain. We are seeing a 26-year-old die. But that 26-year-old has the organs of a 96-year-old. No surprise in rapid cancers, neurodegeneration, or sudden cardiac death — for a 96-year-old.”

Mr. Chesnut is writing about what the COVID-19 virus itself can do to “prematurely age” the body of a person who contracts a COVID-19 infection. Yours Truly will return to the charge regarding the modRNA COVID-19 “vaccines.”

The COVID-19 virus itself can be detected by the body of the infected person as an “enemy”, then destroyed and eliminated from the body by the natural immune system. Is it possible for the virus itself to damage the body of the infected person? Absolutely. Can this damage include negative effects to the mitochrondria, the telomeres, and the endothelium, among other areas of the body? It can. Can the damage impact what is now known as “Long COVID?” It can. Can a COVID-19 virus infection itself cause the death of the infected person? It can. However, if a person is “vaccinated” with modRNA COVID-19 “vaccines”, whether or not the “vaccinated” person also comes down with a COVID-19 infection, the situation is different, since these “vaccines” contain items that create more problems for the body: pseudouridine; lipid nanoparticles; the SV40 cancer gene promoter, and the presence of the PRRARSV “backdoor key”, among other things. The “vaccine” itself will induce a kind of continuous “fake COVID-19 infection” in the “vaccine” recipient, so the body will have to continually fight this off. The pseudouridine assists the “vaccine” to evade the body’s “are you an enemy” immune system detection defenses. The lipid nanoparticles (in and of themselves, dangerous) help to quickly spread the “vaccines” throughout the recipient’s body. The SV40 cancer promoter now has the door wide open to go to work. The PRRARSV “backdoor key” assists the “vaccine” elements to enter all the cells of the recipient’s body. The result, in Yours Truly’s opinion, is that the “vaccinated” person’s body is now much more vulnerable to all kinds of medical issues, from stroke to heart disease to “turbo cancer” to “accelerated aging”, among many others.

The Giorgi, et al., paper mentions several things that can mitigate the aging effects on the body caused by mitochondrial dysfunction: resveratrol; vitamin C; vitamin E; CoQ10; flavenoids; carotenoids; glutathione; melatonin; and exercise. Can these same things mitigate the “accelerated aging” that can happen in a COVID-19 “vaccinated” person? Possibly; along with following a spike protein detox / mitigate protocol such as found at the FLCCC website. Yours Truly will caution that people need to talk with their healthcare practitioner before adding a new element to their diet, vitamins or supplements, or changing the amount taken of an already-existing element.

What follows is a graphic of COVID-19 spike protein damage to the mitochondria, and links to papers, WMC Research, and to FLCCC.

Peace, Good Energy, Respect, PAVACA

https://i.postimg.cc/SQ6cRNCf/COVID-19-spike-protein-and-mitochondrial-damage.jpg

“The Hallmarks of Aging”, Carlos Lopez-Otin, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC3836174/pdf/emss-55354.pdf

https://wmcresearch.substack.com/p/confirmation-of-my-2021-hypothesis

https://wmcresearch.substack.com/p/mitochondrial-carpet-bombing-the

“Mitochondrial oxidative stress in aging and health span”, Peter S Rabinovitch, et al. www.ncbi.nlm.nih.gov/pmc/articles/PMC4013820/

https://covid19criticalcare.com/

Dear KMAG: 20231016 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

Pfizer-affirming care

noun

  • mRNA-based coronavirus vaccines manufactured by Pfizer
  • the dual-component COVID drug paxlovid
  • any drug or vaccine made by Pfizer or a subsidiary thereof.
  • prescription or administration of any of the above
  • legislation supporting any of the above
  • mandating any of the above

Shown in a picture

Shown in another picture


Assorted Tweets

On oldie but goody.

This post just makes me smile, too.

New CDC Director in 3….2….1….

While I think Rochelle’s replacement is pretty clueless, I did find one of her college pictures, when she was, like, totally serious!

Looks like Elon has a new vintage toy!

Truly, it is nice having a Twitter X CEO (no, I don’t mean Dorsey) who gets it.

What the heck! This chick will NOT get out of my Twitter X feed!

Bay area. Well, THAT makes sense.

And then there’s this. An important point.

Amen.

No, not that plan. The other one. The one that includes this plan, all other plans, and itself.

So how does that work?

Sorry – it’s complicated. Maybe just Trust In God for now!

How did they put it?

ENJOY THE SHOW

W


Dear KMAG: 20230612 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

With Wheatie style!

With our wonderful REALPOTUS in the lead!

HANG ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Let’s start off in a “Wheatie way” with some epic orchestral violins!

OK – how about some country music? I just heard this one on the radio. Never heard it before.

Now this is just interesting. YouTube keeps trying to suggest Taylor Swift to me, but the first song it suggested was a duet with one of the [Dixie] Chicks, which shows you exactly where Menshevik YouTube was trying to send me – to MARXIST QUISLING CITY.

Well, I looked further down the list of treasonous suggestions, and the same guest vocalist Luke Bryan in the above video is in this one, but it’s six years earlier.

Remember – Taylor Swift started off in country / folk. Then Hollywood does its thing.

Useful strategic information in the culture wars.

But let’s finish off with a real treat.

Some country line dancers send off one of their friends with his favorite song.

OK – I’m not done. ONE. MORE. SONG!!!

Let’s finish off with something “fresh” in SuSE world!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Take this one from Wolf. Be UNPERTURBED by what they’re doing to Trump.

Water rolling off the back. LOVE TRUMP MORE.

And if you have to – COOL OFF.

https://twitter.com/buitengebieden/status/1667977143060422656

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Week:


Wolbachia

proper noun (how to pronounce)

Wolbachia is a genus of intracellular bacteria that infects mainly arthropod species, including a high proportion of insects, and also some nematodes. It is one of the most common parasitic microbes, and is possibly the most common reproductive parasite in the biosphere. Its interactions with its hosts are often complex, and in some cases have evolved to be mutualistic rather than parasitic. Some host species cannot reproduce, or even survive, without Wolbachia colonization. One study concluded that more than 16% of neotropical insect species carry bacteria of this genus, and as many as 25 to 70% of all insect species are estimated to be potential hosts.

History of Wolbachia:

The genus was first identified in 1924 by Marshall Hertig and Simeon Burt Wolbach in the common house mosquito. They described it as “a somewhat pleomorphic, rodlike, Gram-negative, intracellular organism [that] apparently infects only the ovaries and testes“. Hertig formally described the species in 1936, and proposed both the generic and specific names: Wolbachia pipientis. Research on Wolbachia intensified after 1971, when Janice Yen and A. Ralph Barr of UCLA discovered that Culex mosquito eggs were killed by a cytoplasmic incompatibility when the sperm of Wolbachia-infected males fertilized infection-free eggs. The genus Wolbachia is of considerable interest today due to its ubiquitous distribution, its many different evolutionary interactions, and its potential use as a biocontrol agent.

Why Bill Gates is probably interested in Wolbachia:

Note: This is just the beginning. Look HERE for more.

These bacteria can infect many different types of organs, but are most notable for the infections of the testes and ovaries of their hosts. Wolbachia species are ubiquitous in mature eggs, but not mature sperm. Only infected females, therefore, pass the infection on to their offspring. Wolbachia bacteria maximize their spread by significantly altering the reproductive capabilities of their hosts, with four different phenotypes:

  • Male killing occurs when infected males die during larval development, which increases the rate of born, infected females.
  • Feminization results in infected males that develop as females or infertile pseudofemales. This is especially prevalent in Lepidoptera species such as the adzuki bean borer (Ostrinia scapulalis).
  • Parthenogenesis is reproduction of infected females without males. Some scientists have suggested that parthenogenesis may always be attributable to the effects of Wolbachia. Though this is not the case for the marbled crayfish. An example of parthenogenesis induced by presence of Wolbachia are some species within the Trichogramma parasitoid wasp genus, which have evolved to procreate without males due to the presence of Wolbachia. Males are rare in this genus of wasp, possibly because many have been killed by that same strain of Wolbachia.
  • Cytoplasmic incompatibility is the inability of Wolbachia-infected males to successfully reproduce with uninfected females or females infected with another Wolbachia strain. This reduces the reproductive success of those uninfected females and therefore promotes the infecting strain. In the cytoplasmic incompatibility mechanism, Wolbachia interferes with the parental chromosomes during the first mitotic divisions to the extent that they can no longer divide in synchrony.

Several host species, such as those within the genus Trichogramma, are so dependent on sexual differentiation of Wolbachia that they are unable to reproduce effectively without the bacteria in their bodies, and some might even be unable to survive uninfected.

One study on infected woodlice showed the broods of infected organisms had a higher proportion of females than their uninfected counterparts.

Wolbachia, especially Wolbachia-caused cytoplasmic incompatibility, may be important in promoting speciation. Wolbachia strains that distort the sex ratio may alter their host’s pattern of sexual selection in nature, and also engender strong selection to prevent their action, leading to some of the fastest examples of natural selection in natural populations.

The male killing and feminization effects of Wolbachia infections can also lead to speciation in their hosts. For example, populations of the pill woodlouse, Armadillidium vulgare which are exposed to the feminizing effects of Wolbachia, have been known to lose their female-determining chromosome. In these cases, only the presence of Wolbachia can cause an individual to develop into a female. Cryptic species of ground wētā (Hemiandrus maculifrons complex) are host to different lineages of Wolbachia which might explain their speciation without ecological or geographical separation.

Wolbachia infection has been linked to viral resistance in Drosophila melanogaster, Drosophila simulans, and mosquito species. Flies, including mosquitoes, infected with the bacteria are more resistant to RNA viruses such as Drosophila C virus, norovirus, flock house virus, cricket paralysis virus, chikungunya virus, and West Nile virus.

In the common house mosquito, higher levels of Wolbachia were correlated with more insecticide resistance.

In leafminers of the species Phyllonorycter blancardella, Wolbachia bacteria help their hosts produce green islands on yellowing tree leaves, that is, small areas of leaf remaining fresh, allowing the hosts to continue feeding while growing to their adult forms. Larvae treated with tetracycline, which kills Wolbachia, lose this ability and subsequently only 13% emerge successfully as adult moths.

Muscidifurax uniraptor, a parasitoid wasp, also benefits from hosting Wolbachia bacteria.

In the parasitic filarial nematode species responsible for elephantiasis, such as Brugia malayi and Wuchereria bancrofti, Wolbachia has become an obligate endosymbiont and provides the host with chemicals necessary for its reproduction and survival. Elimination of the Wolbachia symbionts through antibiotic treatment therefore prevents reproduction of the nematode, and eventually results in its premature death.

Some Wolbachia species that infect arthropods also provide some metabolic provisioning to their hosts. In Drosophila melanogaster, Wolbachia is found to mediate iron metabolism under nutritional stress and in Cimex lectularius, the Wolbachia strain cCle helps the host to synthesize B vitamins.

Some Wolbachia strains have increased their prevalence by increasing their hosts’ fecundity. Wolbachia strains captured from 1988 in southern California still induce a fecundity deficit, but nowadays the fecundity deficit is replaced with a fecundity advantage such that infected Drosophila simulans produces more offspring than the uninfected ones.

Wolbachia often manipulates host reproduction and life-history in a way that favours its own propagation. In the Pharaoh ant, Wolbachia infection correlates with increased colony-level production of reproductives (i.e., greater reproductive investment), and earlier onset of reproductive production (i.e., shorter life-cycle). Infected colonies also seem to grow more rapidly. There is substantial evidence that the presence of Wolbachia that induce parthenogenesis have put pressure on species to reproduce primarily or entirely this way.

Additionally, Wolbachia has been seen to decrease the lifespan of Aedes aegypti, carriers of mosquito-borne diseases, and it decreases their efficacy of pathogen transmission because older mosquitoes are more likely to have become carriers of one of those diseases. This has been exploited as a method for pest control.

The first Wolbachia genome to be determined was that of one that infects D. melanogaster fruit flies. This genome was sequenced at The Institute for Genomic Research in a collaboration between Jonathan Eisen and Scott O’Neill. The second Wolbachia genome to be determined was one that infects Brugia malayi nematodes. Genome sequencing projects for several other Wolbachia strains are in progress. A nearly complete copy of the Wolbachia genome sequence was found within the genome sequence of the fruit fly Drosophila ananassae and large segments were found in seven other Drosophila species.

In an application of DNA barcoding to the identification of species of Protocalliphora flies, several distinct morphospecies had identical cytochrome c oxidase I gene sequences, most likely through horizontal gene transfer (HGT) by Wolbachia species as they jump across host species. As a result, Wolbachia can cause misleading results in molecular cladistical analyses. It is estimated that between 20 and 50 percent of insect species have evidence of HGT from Wolbachia—passing from microbes to animal (i.e. insects).

Wolbachia species also harbor a bacteriophage called bacteriophage WO or phage WO. Comparative sequence analyses of bacteriophage WO offer some of the most compelling examples of large-scale horizontal gene transfer between Wolbachia coinfections in the same host. It is the first bacteriophage implicated in frequent lateral transfer between the genomes of bacterial endosymbionts. Gene transfer by bacteriophages could drive significant evolutionary change in the genomes of intracellular bacteria that were previously considered highly stable or prone to loss of genes over time.

The small non-coding RNAs WsnRNA-46 and WsnRNA-59 in Wolbachia were detected in Aedes aegypti mosquitoes and Drosophila melanogaster. The small RNAs (sRNAs) may regulate bacterial and host genes. Highly conserved intragenic region sRNA called ncrwmel02 was also identified in Wolbachia pipientis. It is expressed in four different strains in a regulated pattern that differs according to the sex of the host and the tissue localisation. This suggested that the sRNA may play important roles in the biology of Wolbachia.

Outside of insects, Wolbachia infects a variety of isopod species, spiders, mites, and many species of filarial nematodes (a type of parasitic worm), including those causing onchocerciasis (river blindness) and elephantiasis in humans, as well as heartworms in dogs. Not only are these disease-causing filarial worms infected with Wolbachia, but Wolbachia also seems to play an inordinate role in these diseases.

A large part of the pathogenicity of filarial nematodes is due to host immune response toward their Wolbachia. Elimination of Wolbachia from filarial nematodes generally results in either death or sterility of the nematode. Consequently, current strategies for control of filarial nematode diseases include elimination of their symbiotic Wolbachia via the simple doxycycline antibiotic, rather than directly killing the nematode with often more toxic antinematode medications.

For more, see Wikipedia: https://en.wikipedia.org/wiki/Wolbachia


ENJOY THE SHOW

Have a great week!

W

Dear KMAG: 20230605 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.

(with her beautiful engagement ring!)


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With our dignity intact!

With our dancing shoes on!

And with some LAUGHTER!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

OK

Sorry people, but I heard this here country song today, booming out of a bar, after walking out of a diner, having just eaten the best breakfast in years, and you’re gonna hear this song until you’re sick of it!

DRINKABY

(this version’s for Kalbo!)

WHAT? This song has lyrics? Well, I’ll be! I never noticed! Let’s look at them lyrics!

So how about the official video? Heck – let’s listen to it again!

What the heck! Where’s the beef? DANG! That’s not a video. That a picture!

We’ll have to look at another line dance to make up for the disappointment!

Apparently Korean chicks LOVE this song. There are TONS of videos of Korean gals dancing to “Drinkaby”. So, given that I love ALL CHICKS, and KOREAN CHICKS are a valid subset of ALL CHICKS, we’re gonna watch another one, just to prove I wasn’t lyin’ about it!

Well, shucks. If we can’t find a REAL VIDEO for THAT song, we’ll just grab another Cole Swindell drinking song, and call it good!

Pour another round for the boys, and let’s have a toast to DOUBLE-X, my friends!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wool-Fee’s Weediest Words of the Weak:


malapropism, eggcorn, and mondegreen

nouns

These are very similar and overlapping, and closely related to puns, spoonerisms, Freudian slips, and other linguistic errors, sometimes the source of humor when the error makes sense or pokes fun at an embarrassing truth.

  • malapropism: the act of using an incorrect word in place of one that is similar in pronunciation.
  • eggcorn: a mis-heard word that is not nonsensical, but remains sensible and even same-meaning in context.
  • mondegreen: a mis-heard phrase, in song lyrics or poetry, which is typically nonsensical.

Examples of malapropism (courtesy of Archie Bunker)

  • “Last will and tentacle…”
  • “Patience is a virgin.” (virtue)
  • “A menstrual show.” (minstrel)
  • “Buy one of them battery operated transvestite radios.”
  • “A woman doctor is only good for women’s problems…like your groinocology.”
  • “I ain’t a man of carnival instinctuals like you.”
  • “Irene Lorenzo, Queen of the Women’s Lubrication Movement.”
  • “In her elastic stockings, next to her very close veins.”
  • “In closing, I’d like to say Molotov!” (Mazel Tov)

Examples of eggcorns

  • afeared (afraid)
  • agreeance (in agreement; accept the terms; could be a combination of agreement and acceptance)
  • centerpede (centipede)
  • conscious (conscience)
  • eardrop (eavesdrop)
  • eavesdripping (eavesdropping)
  • eggcorn (acorn)
  • expresso (espresso)
  • ex-patriot (expatriate)
  • gambit (gamut)
  • leper (leopard)
  • nougat (nugget)
  • overhauls (overalls)
  • parody (parity)
  • prospective (perspective)
  • pylon (pile on)
  • relative (relevant)
  • spur (spurt)
  • saleing (selling)
  • tellyphone (telephone)
  • tellyprompter (teleprompter)
  • tellyvision (television)
  • topsy (top seed)
  • upmost (utmost)
  • wonderlust (wanderlust)
  • ringer (wringer)
  • ad homonym (ad hominem)
  • bad wrap (bad rap)
  • ban together (band together)
  • bare witness (bear witness)
  • bean stock (beanstalk)
  • beckon call (beck and call)
  • Cadillac converter (catalytic converter)
  • chester drawers (chest of drawers)
  • collaborating evidence (corroborating evidence)
  • could of (could have)
  • dead wringer (dead ringer)
  • deep seeded (deep-seated)
  • doggy dog (dog eat dog)
  • feeble position (fetal position)
  • flesh out (flesh out)
  • free rain (free rein)
  • hysterical society (historical society)
  • ice team (iced tea)
  • jerry rig (jury rig)
  • junk start (jumpstart)
  • laughing stalk (laughingstock)
  • must of (must have)
  • mute point (moot point)
  • nerve wrecking (nerve-racking)
  • pass mustard (pass muster)
  • all for not (all for naught)
  • all intensive purposes (all intents and purposes)
  • can’t make heads or tales of it (can’t make heads or tails of it)
  • cease and decease (cease and desist)
  • chock it up (chalk it up)
  • coming down the pipe (coming down the pike)
  • curve my appetite (curb my appetite)
  • cut to the cheese (cut to the chase)
  • don’t get your dandruff up (don’t get your dander up)
  • fair to midland (fair to middling)
  • far be it to me (far be it from me)
  • flaw in the ointment (fly in the ointment)
  • from here on end (from here on in)
  • get it down packed (get it down pat)
  • give up the goat (give up the ghost)
  • Holland day sauce (hollandaise sauce)
  • in cohorts with (in cahoots with)
  • in one fowl swoop (in one fell swoop)
  • much to do about nothing (much ado about nothing)
  • old wise tale (old wives’ tale)
  • peaked my interest (piqued my interest)
  • put the pedal to the medal (put the pedal to the metal)
  • rot iron fence (wrought iron fence)
  • safety deposit box (safe deposit box)
  • straight and arrow (straight and narrow)

Examples of mondegreen:

  • Africa – When Toto’s lead singer croons, “bless the rains down in Africa,” some listeners mistake the first few words for left my brains.
  • Away in a Manger – Even Christmas songs aren’t immune to mondegreen. Instead of hearing “the cattle are lowing,” some people incorrectly understand the lyric to say that they’re lonely.
  • Blowin’ in the Wind  Bob Dylan advises listeners, “the answer my friends, is blowin’ in the wind,” but not everyone hears it that way. Some perceive the first part of that line as saying the ants are my friends.
  • Bohemian Rhapsody – While this Queen song does have some nonsense words, the tune doesn’t actually reference saving someone from warm sausage tea. Instead, Freddie Mercury sings “… spare him his life from this monstrosity,” with a strong emphasis on each syllable.
  • Brass in Pocket – The Pretenders tell listeners, “I’m gonna use my sidestep,” but not everyone hears the last word correctly. Some think they’re saying sausage instead of sidestep.
  • Dancing Queen – Abba says to “feel the beat from the tambourine,” though some listeners insist the singer croons the word tangerine instead.
  • Every Time You Go Away – People who hear meat instead of me when Paul Young sings “you take away a piece of me with you” must think the singer’s freezer is being robbed.
  • Happy – When Pharell sings “happiness is the truth,” some people think he’s actually saying that “happiness is the zoo.”
  • High on You – The words of this Survivor song reference “piercin’ eyes like a raven,” though listeners often mishear the song as saying glistening eyes.
  • I‘m a Believer – After the Monkees croon, “then I saw her face, now” some think they follow up with “I’m gonna leave her.” What they really say, though, is “I’m a believer.”
  • Livin on a Prayer – Contrary to popular belief, Bon Jovi doesn’t suggest nudity in this song. Some mishear the last part of “it doesn’t really matter if we make it or not” as saying naked or not.
  • Losing My Religion – R.E.M. croons, “That’s me in the corner. That’s me in the spotlight.” Many listeners mistake the word “me” for pee in both of these sentences.
  • Money for Nothing – Listeners often think this Dire Straits song references free chips, when the lyrics actually reference “money for nothing and your chicks for free.”
  • Our Lips are Sealed – The Go-Gos sing about “the jealous games people play,” but some people hear Dallas instead of jealous.
  • Smells Like Teen Spirit – In this Nirvana song, Kurt Cobain sings, “here we are now, entertain us,” though some people interpret the last two words as in containers.
  • Suspicious Minds – Elvis Presly croons, “we’re caught in a trap,” but some listeners seem to think the last word is actually trout.
  • Drift Away – When Uncle Kracker sings, “Give me the beat boys and free my soul,” it sounds a bit like he’s saying Beach Boys.
  • Waterfalls – In this song, TLC advises readers, “don’t go chasing waterfalls.” though some readers think they’re trying to keep someone named Jason Waterfalls from leaving.
  • We Found Love – When Rhianna sings “what it takes to come alive,” some listeners mishear the end of the line as form a line instead of “come alive.”
  • Rocket Man – The Elton John line “burning out his fuse up here alone” has been misheard many ways, including running out of fuel and heading home and burning up the trees on every lawn. Volkswagen even used this mondegreen in a commercial.

Mondegreen in a video

Malapropism via Text-to-Speech or Auto-Correct Eggcorn

“I had no idea what the butchers do to the trance people.”


ENJOY THE SHOW

Have a great week!

W

Dear KMAG: 20230529 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With or without zombies!

Get your dancing shoes on!

And hang on for some TRUMP GRAVITY!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – a quick, 3-minute version of the end theme from Gladiator, including dialog. I posted this earlier in a reply to Tradebait on his latest BMID. I consider Gladiator a very symbolic movie, which has a lot to say about Christianity, but very subtly, and mixed well into everything else.

If you liked that, an extended version, starting earlier, with the movie showing in the background!

How about something YouTube suggested? From the EP “Luna”, by Tony Anderson, a title called “Eternal Spring”. The visuals are really something!

And now – some fine country music just for today!

Finally, some music to go with our featured image “fantasy tree”!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

WARNING – many of you need to skip this.

But no child should be condemned to this.

TWEET: https://twitter.com/MalesInDisguise/status/1662935393338118150

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


equity

noun

  • the state or quality of being just and fair.
  • something that is just and fair.
  • sustice achieved not simply according to the strict letter of the law but in accordance with principles of substantial justice and the unique facts of the case.
  • the amount of money that would be returned to a company’s shareholders if all of the assets were liquidated and all of the company’s debt was paid off in the case of liquidation.
  • the value of company sales minus any liabilities owed by the company not transferred with the sale.
  • the book value of a company.
  • payment-in-kind.
  • the pro-rata ownership of a company’s shares.

Wolf’s additional definitions:

  • how tyrants and criminals violate both the letter and spirit of the law, in the name of “fairness” and “justice”, while tipping the scales to favor themselves, their friends, and their fellow criminals.
  • injustice under the color of justice, ironically often done for the sake of “color”.
  • a redundancy, in that “equitable justice” really means “just justice”, meaning je ne sais quoi justice, or seat-of-the-robe justice.
  • justice by feeling and not by law.
  • an admission that the law is not working, so “fuck the law – we’ll just do what we like.”
  • a legal kludge, which is easily abused, where judicial algorithms break down, and people resort to flimsy neural net solutions, typically with strongly biased inputs.

Wikipedia definition (financial):

In finance, equity is an ownership interest in property that may be offset by debts or other liabilities. Equity is measured for accounting purposes by subtracting liabilities from the value of the assets owned. For example, if someone owns a car worth $24,000 and owes $10,000 on the loan used to buy the car, the difference of $14,000 is equity. Equity can apply to a single asset, such as a car or house, or to an entire business. A business that needs to start up or expand its operations can sell its equity in order to raise cash that does not have to be repaid on a set schedule.

When liabilities attached to an asset exceed its value, the difference is called a deficit and the asset is informally said to be “underwater” or “upside-down”. In government finance or other non-profit settings, equity is known as “net position” or “net assets”.

Investopedia definition:

Wikipedia definition (legal):

Equity is a particular body of law that was developed in the English Court of Chancery.[1] Its general purpose is to provide a remedy for situations where the law is not flexible enough for the usual court system to deliver a fair resolution to a case.[2] The concept of equity is deeply intertwined with its historical origins in the common law system used in England.[2] However, equity is in some ways a separate system from common law: it has its own established rules and principles, and was historically administered by separate courts, called “courts of equity” or “courts of chancery”.[2]

Equity exists in domestic law, both in civil law and in common law systems, and in international law.[1] The tradition of equity begins in antiquity with the writings of Aristotle (epieikeia) and with Roman law (aequitas).[1][3] Later, in civil law systems, equity was integrated in the legal rules, while in common law systems it became an independent body of law.[1]

Used in a Sentence:

“Climate equity is the goal of recognizing and addressing the unequal burdens made worse by climate change, while ensuring that all people share the benefits of climate protection efforts. Achieving equity means that all people—regardless of their race, color, gender, age, sexuality, national origin, ability, or income—live in safe, healthy, fair communities.” -US EPA


ENJOY THE SHOW

Have a great week!

W

Dear KMAG: 20230522 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

NO problem! Errrr. Problems. Whatevah!

We’re gonna have a GOOD time!

But ya bettah HOLD ON!!!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

For an updated version…..

And for a version that includes your having righteously defended yourself…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won TWO elections.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – some epic piano….. dubstep?

OK – I’m feeling something, and I need some Tom Petty. This one!

Now, in honor of the BRANCH COVIDIANS just waiting to come back with their mandates…..

And finally – what the heck – ONE MORE TIME! (*wink*)


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Community Notes FOR THE WIN!!!

https://twitter.com/StilettoDave/status/1659722374105927680

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


supermajority

noun

  • a majority (such as two-thirds or three-fifths) greater than a simple majority.
  • a majority that must represent some percentage more than a simple majority.
  • a requirement for a proposal to gain a specified level or type of support which exceeds a simple majority in order to have effect.
  • a vote that must exceed the number of votes comprising a simple majority.
  • also called a qualified majority

Wikipedia definition:

A supermajority, is a requirement for a proposal to gain a specified level of support which is greater than the threshold of more than one-half used for a simple majority. Supermajority rules in a democracy can help to prevent a majority from eroding fundamental rights of a minority, but they can also hamper efforts to respond to problems and encourage corrupt compromises at times when action is taken.

Used in a Sentence:

  • Representative Tricia Cotham switched parties, giving NC Republicans the supermajority they need to override any veto by Gov. Roy Cooper.
  • Tennessee is one of an increasing number of states (19 Republican, nine Democratic) where one party has a “supermajority,” such a lopsided advantage that it can override a governor’s veto without relying on votes from the other party.
  • For the first time in nearly a half century, there is a six-justice conservative supermajority on the U.S. Supreme Court — six justices with clearly expressed views against abortion rights.

An Upcoming Vote for Supermajority Protection of the Ohio Constitution From George Soros and his Minions:


ENJOY THE SHOW

Have another great week!

W

Dear KMAG: 20230515 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

So shine your light for all to see (or feel, as appropriate)…..

Put on your dancing shoes…..

And prepare for the ride of your life!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

FIRST – in “epic music”……

Now – remember my favorite country mash-up?

Well, the author did his own composition from the mashup. Enjoy!

And what the heck – YouTube suggested my last song again!


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

https://twitter.com/Lupublicoutcry/status/1657891066161537025

We can give in to despair…or we can be defiant and fight back in any way that we can.

https://twitter.com/KarliBonnita/status/1657795648924647425

And this is the best bust of the phony phed Patriot Front yet, as an Alinsky operation which even has globalist and Demmunist backing.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


thine

pronoun or adjective

  • yours (old fashioned and literary)
  • used to indicate the one or ones belonging to thee.
  • singular second person possessive pronoun.
  • the possessive case of thou1 used as a predicate adjective, after a noun or without a noun.
  • the possessive case of thou1 used as an attributive adjective before a noun beginning with a vowel or vowel sound: thine eyes; thine honor. Compare thy.
  • that which belongs to thee.

Used in a Sentence:

  • Thine is the power and the glory.
  • May God’s blessings be thine.
  • “Give every man thine ear, but few thy voice…” [Shakespeare, Hamlet (1600)]

Used in a Star Trek NG Episode Title:


ENJOY THE SHOW

Have another great week!

W

Dear KMAG: 20230508 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

Dealing with any obstacles in an appropriate manner…..

Enjoying the benefits of the occasional Trump rally…..

And experiencing some amazing “Trump Gravity”!


Dedication

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Now shortened.

Give them nothing.

Play smart. Every minute, the COUPISTS who stole the election – who lied – who deserve to be at the business end of the very same laws they are using so wrongly against the January Sixth defendants – are trying to set you up. Don’t be a chump. Turn everything back against THEM. Every day, every hour, every minute, every second.

LIKE SUNDANCE DID HERE.

AND HERE…..

Occam’s Razor – Fed Entrapment

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

First, an old Wheatie favorite as you’ve never seen it before!

Aw, heck – let’s have some more of that stuff!

OK, but now you’re getting more country. Specifically, stuff I never heard before.

The WHY on that comes later.

And now I get you in the mood for our next section.


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Wolfie’s Wheatie’s Word of the Day Year Week:


rhochrematics

extremely obscure noun

  • science of inventory management and the movement of products
  • science of how materials and information flow from the raw state though manufacturing, inventory management, marketing, and distribution

Used in a Sentence:

  • It’s hard to believe that genocide through rhochrematics is possible, but yet here we are.
  • Satan weaponizes everything – even rhochrematics.

Featured in a picture:


ENJOY THE SHOW

Have another great week!

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do?


TL;DR –

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.


The central dogma of molecular biology. They shilled the blue arrows to the masses as lies about safety, while hiding the special red arrow and actually working to open it up for business.


Show-Time (Introduction)

I have finally realized that I need to spell out, in as many ways as needed, what is really going on with SARS-CoV-2 and these derived mRNA vaccines.

I had hoped that people would see the implications of the science which is now open to us, with the publication of first the Jaenish paper, then the De Marinis paper, and finally the Mehedi paper. I have commented extensively on each one of these papers, including very recently on the Mehedi paper, which really makes things obvious. I had thought that somebody more notable than me would try to make the point I am about to make. Sadly, nobody has, so it looks like I’m going to have to do it.

These vaccines are designed to BEGIN to change us on a fundamental level which is not exactly the same as the “transhumanism” that constitutes most of the “clickbait” against the vaccines. It’s similar, but it’s not the same. What we see in the clickbait is a distraction from the actual danger, which is not strange and distant and unbelievable, but is in fact right here, and right now, and very believable, once you understand it.

The truth is a lot more like GATTACA, and a lot less like Transcendence.

It’s already starting, and the infrastructure is being set up. The first step has actually been accomplished, and it was in many ways a HUGE success.

Humans ARE being engineered right in front of our eyes. I hope that you can see this point by the end of this article.

They (meaning WEF and its backers) hacked the human cell nucleus on a population genome level. They created a “Trojan” virus that appears to have “zero-dayed” the human cell nucleus. Artfully, the hack is a lot like state-level “APT” (advanced persistent threat) computer hacks, in that it gets in and holds the door open. Of course, better models can be created, but the self-replicating crowbar for the cell nucleus has obviously arrived, and its imperial version of SPQR is PRRARSV.

THAT is the fundamental advance that was achieved here.

I have to say, it was ingenious and “admirable”, in several senses – scientific, military, and criminal. Of course, your mileage may vary on “admirable”. Many will consider it “diabolical”.

What we are facing is the immediate REAL danger of biological engineering and eugenics, which was employed in a fantasy way, as a technical MacGuffin, in various episodes and productions in the Star Trek universe.

This is a scene from Star Trek II: The Wrath of Khan. These two people are “superhumans” who (according to the story) proved to be disastrous for Earth, during our current century (more or less). The one on the right is “Khan” – obviously in homage to Genghis Khan and his relatives, who ruled much of Asia for centuries.

Don’t get lost in the fantasy stuff. THAT is not the big danger. Stick around for an explanation of the reality which is actually upon us.

Here is how Wikipedia describes Khan, but more importantly, where he CAME FROM.


Khan Noonien Singh is a fictional character in the Star Trek science fiction franchise, who first appeared as the main antagonist in the Star Trek: The Original Series episode “Space Seed” (1967), and was portrayed by Ricardo Montalbán, who reprised his role in the 1982 film Star Trek II: The Wrath of Khan. In the 2013 film Star Trek Into Darkness, he is portrayed by Benedict Cumberbatch.

Khan had controlled more than a quarter of the Earth during the Eugenics Wars of the 1990s.[1] After being revived from suspended animation in 2267 by the crew of the Starship Enterprise, Khan attempts to capture the starship but is thwarted by James T. Kirk and exiled to Ceti Alpha V, where he has the chance to create a new society with his people. In Star Trek II: The Wrath of Khan, set fifteen years after “Space Seed”, Khan escapes his exile and sets out to exact revenge upon Kirk.

In Star Trek Into Darkness, set in the alternate continuity established in Star Trek (2009), Khan is awakened almost a decade before the events of “Space Seed“. Khan is given the false identity John Harrison and coerced by Admiral Marcus into building weapons for Section 31 and Starfleet in exchange for the lives of Khan’s crew. He ultimately rebels and comes into conflict with the crew of Enterprise.


OK – so what are the “Eugenics Wars”?

Back to Wikipedia…..


When the original series of Star Trek was produced, the 1990s were several decades away, and so various elements of the backstory to Star Trek are set in that era, particularly the Eugenics Wars. The references to the Eugenics Wars and to a nuclear war in the 21st century are somewhat contradictory.

The episode “Space Seed” establishes the Eugenics Wars, and has them lasting from 1992 to 1996. The Eugenics Wars are described as a global conflict in which the progeny of a human genetic engineering project, most notably Khan Noonien Singh, established themselves as supermen and attempted world domination. Spock calls them “the last of your so-called World Wars”, and McCoy identifies this with the Eugenics Wars.


OK – don’t get me wrong. I’m not saying it’s EXACTLY like Star Trek, although I do subscribe to the folk notion that Star Trek is a VERY good predictor of things that are likely to happen.

What I AM saying is that genetic engineering of humanity has already started, and now I’m going to explain why this is so.

We will take a brief tour into the PAST, before we return to the future. If a light bulb comes on, keep it lit!


You cannot uninvent the genetic Tommy-gun, nor the gun moll who knows how to code.

Bonnie & Clyde of the Nucleus

BANKS make a really great analogy of the cell nucleus.

  • they’re common and everywhere
  • they contain valuable stuff that needs to be protected yet dispersed
  • they have high security
  • things need to traffic securely in and out of them

Breaking into a bank with very high security is a lot like what the spike protein does. But the spike protein doesn’t do it alone. THAT is an important point from the three papers I keep mentioning. The spike protein has a PARTNER who has all the plans.

OK – just for the record – this is going to deviate a little bit from the ACTUAL story of Bonnie and Clyde. Just warning you – it will get weird.

The spike protein and the spike protein mRNA are a PAIR, and together, they are able to not only break into the bank, but to totally take it over, and keep it taken over. And then to take over more banks.

Here is how it works.

The spike protein is Clyde. He’s got a gun, and he causes all kinds of trouble with it. He’s the “action” guy. He knows how to break into banks, mostly because he has a phony ID that always gets him in. The phony ID says PRRARSV in big letters on it, which makes all the bank guards at Cell Nucleus Bank and Trust say “Why, welcome, Mr. Barrow! We’re pleased to see you at the bank today! Come right on in!”

Or, to use a different analogy…..

These bank guards are such chumps, but it works every time.

Well, here is the problem for the bank. When Clyde goes in, he always brings his partner Bonnie. And SHE is trouble. She’s not so good with a gun or a fake ID, but she is a real scam artist, who knows how to get into the bank and embezzle the hell out of it.

Bonnie gets into the cell nucleus bank, and with some help from Clyde, she gets a permanent job there. Bonnie and Clyde are set for life. None of this “grab the cash, run out, get caught, and die in a hail of bullets” shit. No sir! THIS Bonnie and Clyde are smart.

Bonnie trains many of the new girls at the bank – and like the pod people in “Invasion of the Body Snatchers”, she turns every last one of them into exact copies of HERSELF. NASTY! So all these fresh Bonnies are trained by the bank and sent out to get into new banks.

But wait! Bonnie can’t get into banks. Bonnie doesn’t have a gun or a fake ID! How can she get into more banks?

Easy! Bonnie and all her Bonnie clones have the power of multiplication – not just to make more copies of each one herself, but to make more Clydes. Bonnie makes more copies of herself while she’s IN the bank, and she makes copies of Clyde while she’s OUT of the bank.

So every Bonnie that leaves the bank, creates hundreds of new Clydes on the outside. The next time Bonnie wanders near a bank, there are bound to be dozens of Clydes just hanging around, ready to escort her, and maybe even other gals [important], into the bank. If no Bonnie is already working there, she gets a job, and the process starts over.

The KEY POINT is that BONNIE makes the CLYDES who can get her, or women like her, into the next bank.

Bonnie can’t get into the bank, and Clyde can’t get a job in the bank, but together, they can make a living by embezzling banks.

Side Note: This is a beautiful example of a contradiction in the Marxist sense. Proteins and nucleic acids can’t do certain things alone, and thus NEED EACH OTHER.

Once Bonnie is on the payroll, this fact introduces a permanent security problem in the bank, and for all other banks.

And why is that?

Once Bonnie is on the payroll, you can’t get rid of her.

She will just create more Bonnies and more Clydes, and they will scam more banks.

In terms of banks, banks can resist just Clyde or just Bonnie, but they can’t resist the pair.

In terms of the cell nucleus, it can resist the spike protein or the spike mRNA, but it cannot resist both of them together.

Which pair, oddly, is exactly what the vaccines create.

WHAT ARE THE CHANCES?


We can use other analogies, using banks, which emphasize the spike protein more.

Imagine a bank that was convinced to crank out KEYS TO THE BANK, and to send out these keys. Imagine thousands of keys to the bank being sent out by the bank into the community, perhaps in a really stupid PR stunt.

God knows WHO is going to get into the bank now.

God knows WHAT is going to get into the genome now.

Are you starting to see what they did?


Fact Checking the Fact Checkers on DNA Change

The absolute best way for me to convince you that they really said these vaccines could not do what they are now proven to be doing, is to simply play back the words of the “fact checkers”.

See if you can spot how many LIES are told in this video.

If you’re not spotting the lies, read THIS ARTICLE.

AND – by the way – this video is a GREAT explanation of the way things NORMALLY work. It’s totally out to lunch on the way things ACTUALLY work.

Did you spot the lies? Tell me what you found in the comments.

This video is not alone – there are HUNDREDS OF THEM.

There are also hundreds if not thousands of articles of a similar nature. I’m just going to pick one of them – the one that happened to have the graphic I used above. That article is dated from MARCH of 2021 – right when the authorities were hard-selling the “vaccines”.


mRNA Covid-19 vaccines: Facts vs Fiction

MARCH 10, 2021

By: Maria Elisa Almeida Goes
Editing: Offspring Magazine Editorial Team
Images: Nina Lautenschläger.

LINK: https://www.phdnet.mpg.de/offspring/Covid-19_vaccines

ARCHIVE: https://archive.fo/irZec


Interestingly, this archive was made only 5 months ago. It was very likely archived by Wikipedia or somebody else who is shilling the false explanation, when faced with the emerging science showing nuclear translocation and genomic incorporation. But it’s perfect for me to preserve evidence.

As an aside, I find it terribly sad that this particular lover of “Max Planck” era scientific history, lived to see one of Planck’s namesake organizations lying about science on a grand scale, but yet here we are.

Let me just pull out the most relevant section. I was planning on highlighting ALL of the lies, fibs, evasions, etc., but there are so many, I decided to only highlight or [comment on] the most horrible and ironic.


mRNA vaccines will not alter your DNA, this is why:

Concerns about the effects mRNA vaccines over the integrity of our DNA also exist. Thankfully, you do not need to worry about this. Such an event would challenge everything scientists know about basic cell biology, and is so improbable, that one can actually call it impossible.

The main reason for that is that, besides being chemically and structurally different from DNA, mRNA is located in a different cellular compartment. While DNA is enclosed in the nucleus, mRNA is produced in the nucleus, but is quickly exported to the cytoplasm with a one-way ticket: it does not come back. In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction. Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.  Additionally, the RNA molecule is charged and carries the same charge as the nucleus, so as our 6th grade physics taught us, like charges repel, and hence the RNA molecule is physically repelled by the nucleus. [Note added by Wolf – WHAT THE HELL???]

One might also argue [HA! You TOADS! Yes, one “might”!] that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example. The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines. [OH, THE IRONY]

For the same reasons, mRNA vaccines cannot affect your unborn children. This would require genomic mutations [oh, really!] in the reproductive cells – sperm and egg – since only these could potentially be transmitted to the next generation. [AND???!!!]

Speaking of children, you might have heard that Covid-19 vaccines would cause infertility in women [why don’t you just stop there, and not go on to one bad hypothesis?] because antibodies against the spike protein could mistakenly attack placenta cells, due to an alleged similarity with a placental protein called syncytin-1. There is no scientific evidence supporting this claim – and, in fact, the two proteins are barely similar, sharing only 4 sequential amino acids out of 538. [This did seem to be a bit of a miss. Nevertheless, what new hypothesis explains all the pregnancy problems?]

Still, you might want to ask why pregnant women are excluded from the vaccination campaigns [wait a minute….not in the US], and why, during clinical trials, women are asked to use contraceptive methods that will avoid pregnancy [because there might be a problem?]. Again, this is not a red flag. Any clinical trial for a potential vaccine or drug will exclude children, pregnant women, old people and people with specific underlying conditions. Initially, trials are designed to obtain major insights whether the developed pharmaceutical product works at all, in healthy adults. Once safety and efficacy are determined [read what you just said before that, where you excluded safety as a motive], tests are expanded to smaller groups that at first were set aside. Excluding pregnant women from trials only shows that trials are being done systematically and following standard protocols. [I’m sorry, but this sounds like happy horseshit, lady.]


Let’s concentrate on the lies most relevant to this discussion. I’ll isolate them and respond to each one.


In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction.

This is EXACTLY what was found with the spike protein that was produced by the full spike mRNA. What a coincidence! See De Marinis for proof that it happens, and Mehedi for WHY. OH – because there’s a nuclear location signal! Was it a “known” one, and if so, who knew it and who didn’t? If some people knew, and others didn’t, wouldn’t that make it like a “zero day” on the nucleus?

Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.

OH! But isn’t that SO STRANGE that the Mehedi work shows that the spike protein LITERALLY “traffics” the spike protein mRNA into the nucleus? WELL AHHHHH’LLLLL BE! So maybe this explains the nuclear DNA modification that is seen in the De Marinis results. Yes? Maybe? Come on, girl – you’re a scientist at a prestigious institute. Put on your big girl pants and hypothesize with me! You can do it! This is undergraduate, “smart-alec guy in the back of introductory class raises his hand” stuff! And when you were in that class, you thought the same sorts of things but didn’t raise your hand. Maybe it’s time to be brave!

One might also argue that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example.

This should have been your really big hint, girl. Our local accountant named cthulhu realized that Fauci’s HIV interests and his bat virus interests had remarkable similarities, both in what he himself did, and in what he was studying. “This isn’t Fauci’s first rodeo.” Ask yourself – why was Fauci interested in this? Could it have been the same reason that Doudna was so interested in CRISPR-Cas9? The desire for WRITE PERMISSIONS on the genome?

The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines.

Thank you, my lying lady. You have just provided me with a huge clue, by the process of “liar subtraction” – a form of deductive reasoning. We know from De Marinis that genomic incorporation and modification is a fact. We know from Mehedi that “nuclear trafficking” (your point 2) is a fact. This means that it is almost certain that the spike protein ALSO acts as a promoter of reverse transcription (your point 1). You said it – not me. That sure seems convenient, doesn’t it? My question is now – DID YOU KNOW THIS? Were you part of the plot? Or was the person who reminded you of these things part of the plot? Or were we all part of the plot, when I, too, mindlessly parroted the “central dogma” as a defense of mRNA vaccines?

I’m willing to confess that I was wrong. I will admit to my part in promoting the conspiracy. Will you?


But their defenses get worse.

There are now MSM “fact checks” which specifically try to walk back the implications of both the Jaenisch and De Marinis papers, and you can bet there will be similar fact checks on Mehedi’s paper. There has likewise been pressure on those authors to DOWNPLAY the significance of their own works. To me, this is the height of bullshit.


Jaenisch Paper Downplay

Fact Check-Controversial MIT study does not show that mRNA vaccines alter DNA

LINK: https://www.reuters.com/article/factcheck-coronavirus-vaccines-idUSL1N2PK1DC

ARCHIVE: https://archive.fo/vJwBk


De Marinis Paper Downplay:

Swedish study on COVID vaccines and DNA misinterpreted

LINK: https://apnews.com/article/Fact-Check-COVID-Vaccine-Sweden-Study-986569377766

ARCHIVE: https://archive.fo/vJwBk


Rather than take these arguments apart myself, I ask you all to take a first crack at the different techniques used, by clicking the links and observing the UNETHICAL SKEPTICISM. Much of this does not require a science background.

In particular, knowing what we know now, after the Mehedi work, I think it should be very clear how much the media went to bat for the vaccines without honestly questioning the “authorities”.

I will confirm your findings in the comments, and catch any straggler sins of science.

To me, this media mendacity is all simple, stupid, and predictable.

“Nothing to see here!”

Frankly, it changes nothing for me, if any of these authors get talked into walking back their own work, because push-back on critical work is a common phenomenon in the history of science. Not all scientists are capable of weathering the storm. Here are TWO that did. Both got Nobel prizes, by the way.


A classic case, emphasizing a field aversion among an establishment group to a field solution emerging from deductive reasoning, was Van’t Hoff and tetrahedral carbon. Basically, a doctoral candidate in an applied science school had the temerity to take an old hypothesis and revive it as the solution to a very significant current problem. The guy was good – he went on to win a Nobel prize for other work. However, many chemists, especially older ones, rejected the idea, in my opinion by not prioritizing explanatory power over their own abstract philosophical preconceptions. The fact that important people rejected an elegant solution of remarkable utility and truth shows how bad group-think problems can be in science.

Another case was Rick Smalley and C60 (buckminsterfullerene). The linked article accurately describes the initial skepticism that people had for “soccer ball carbon” or “bucky balls”.

The Nature letter describing C60 was attractive and logical, but seeing a line in a mass spectrum did not convince all scientists of the discovery of a new allotrope of carbon. During the period 1985-1990, the Curl/Smalley team at Rice and Kroto at Sussex managed to amass a wide range of circumstantial evidence to support the fullerene structure proposal. Full acceptance came when Wolfgang Krätschmer of the Max Planck Institute for Nuclear Physics in Heidelberg, Germany, and Donald Huffman of the University of Arizona, with their students Konstantinos Fostiropoulos and Lowell Lamb, succeeded in synthesizing C60 in sufficient quantities to allow structural characterization.

I personally remember colleagues assuring me that Smalley was loony, demented, senile, past his prime, or at best something along the lines of “a nice guy, but clearly deluded and obsessed with an error.” The doubt about C60 as reality – particularly as a stable reality – ran thick. And that doubt was WRONG from the very beginning.


Scientists right now are NOT THINKING, and they’re letting the MEDIA push them around.

Scientists are also letting guys like Anthony FAUCI push them around, mainly by the horrible federal grant system, and by the psychology of woke universities, both designed to control science.

And that doesn’t even begin to address other malign interests altering science and medicine in dishonest ways.


Some Actual Speculation – Why Would They Push These Clearly Defective Shots So Hard?

You want some actual “conspiracy theorizing”? Here it is.

Let me go back to my “TLDR” again…..

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.

There are reasons to suspect depopulation as a motive for these vaccines, and both Gail Combs and I have written extensively about this. I continue to believe that this is part of the motivation of the “complex event” we have been undergoing, between virus and vaccine.

Depopulation is very important to these people.

MALTHUSIANS AND EUGENISTS MAKE A CASE FOR POPULATION CONTROL

DEPOPULATION – NEVER LET A CRISIS GO TO WASTE

The Population Control Shot – Introduction

The Population Control Shot – Understanding the Peoples Climate Temple

Likewise, there are many other motives, ranging from mercenary profits, to promoting gene therapy, to “Covid communism”, and beyond. Many of these roads lead back to WEF – the World Economic Forum. One of those roads may be an actual attempt to commit humanity to a future of genetic engineering as a kind of fait accompli.

Just listen to Yuval Noah Harari talk about changing humanity. A few times he talks about “we”, “I”, “me”, “my”, and “our” programs of genetic engineering of humanity. It’s not just creepy and megalomaniacal – it seems quite self-assured.

WEF’s interest in genetic transformation of humanity cannot be understated. You will note in the above video, the presence of Jennifer Doudna – the Nobel laureate who (IMO) was most responsible for pushing CRISPR gene editing technology forward. Here is the full video.

I have discussed the technology recently here:

Dear KMAG: 20230213 Joe Biden Didn’t Win ❀ Open Topic / Introduction to CRISPR/Cas9 Gene Editing Technology

This is a particularly good explanation for those who want to dig into the science a little.

So how does CRISPR-Cas9 connect to the spike protein?

I have mentioned that the spike not only is proven to have nucleus-opening properties and cell nuclear mRNA-trafficking properties, but it likely has reverse-transcribing properties as well. Thus, it may have utility in facilitating certain varieties of genomic incorporation of genetic material beyond its own spike mRNA. I’m leaving that open very broadly. We don’t really know how far the “nuclear translocation of mRNA” capabilities of the spike protein actually go.

But even just the incorporation of its own instructions into the cellular genome, makes the spike protein highly relevant to CRISPR-Cas9 gene editing technology.

We can’t REALLY be sure what happens if the spike protein code gets into egg or sperm DNA, and goes on to be a “feature” of every human cell of a “spike baby”, but I can say one thing – if that gene can be REMOVED during in vitro fertilization (IVF) by CRISPR-Cas9 technology, to the betterment of the child, then it’s very likely going to be demanded by elite parents, to assure a healthy baby.

So – I ask again – WHAT ARE THE CHANCES?

What are the chances, that people who are gung-ho on the “solution” of genetic modification of humanity – you know – like WEF – would have anything to do with releasing a virus and promoting a vaccine that would almost FORCE us into that future?

I think that this era is a lot like the chemical revolution of the late 1800s, precisely when Van ‘t Hoff was dealing with chemical theory. Figures like Malone and Doudna operate in the time of our own biological revolution. Remember Rockefeller, and what he did to science and medicine back during the chemical revolution. Well, now we have Gates and what HE did to science and medicine during the biological revolution.

Personally, I think it’s high time for us to stop taking shit from the corporate media – and particularly the “fact checkers” like Reuters and the AP – as they LIE to our faces about science – as they deny reality on behalf of the corporate titans behind them.

These mRNA vaccines are DEFECTIVE relative to how they were sold to us – very likely by intention – and the media and media organizations have LIED to us about those vaccines in the most scurrilous ways. The media has defended LIES and defrauded all of us.

You don’t have to be FOR or AGAINST gene editing per se, to be against LYING, DEFRAUDING, and FORCING IT ON THE WORLD by a criminal conspiracy.

We need to demand TRUTH about the vaccines, or the SHUTTERING of these “media” companies and organizations, which have cosigned onto crimes against humanity.

Demand no less. TRUTH or BREAK-UP. Media that lies and conceals is USELESS and a hindrance to REAL SCIENCE.

W