Health Friday 9.5.2025 Open Thread: Human LINE-1, Chromosomes, and the modRNA COVID-19 “Vaccines”: Part One

The header image for today’s offering is courtesy of https://genesdev.cshlp.org/content/37/21-24/948.full, “LINE-1 retrotransposition and its regulation in cancers: implications for therapeutic opportunities”, Carlos Mendez-Dorantes, and Kathleen H. Burns, 13 December 2023.

Health Friday is a series devoted to information about Big Pharma, vaccines, general health, and associated topics. As today’s offering speaks of the disaster of COVID-19 (the COVID-19 virus itself, and the COVID-19 “vaccines”), Yours Truly dedicates it to all persons, of whatever age or location: who have contracted a COVID-19 infection and recovered from it, but who also have residual complications from the infection; who have suffered COVID-19 “vaccine”-induced injury, illness, disability, or “Long COVID”; or, who have passed away, either from complications from an infection of the COVID-19 virus itself, or from COVID-19 “vaccine”-induced issues caused by these “vaccines” they had in their body.

There are Important Notifications from our host, Wolf Moon; the Rules of our late, good Wheatie; and, certain caveats from Yours Truly, of which readers should be aware. They are linked here. Note: Yours Truly has checked today’s offering for any AI-generated content. To the best of her knowledge and belief, there is none, except for perhaps some AI-generated images embedded in links cited in today’s offering. If readers wish to include any AI-generated content in today’s discussion thread, they must cite their source. Thank you.

Today’s offering is Part One of two. It is not a lesson on human anatomy or on human genetics: it is a presentation of some of the most-recent information regarding the dangers and deadliness of the COVID-19 “vaccines” (Bioweapon Toxin Injections.) Yours Truly will emphasize at the start that more and more information that exposes these dangers and deadliness is coming out by the week — the “information trickle” of previous years regarding this situation is becoming a torrent. There is also information that potentially links some of the deleterious effects of the COVID- 19 “vaccines” back to the original Wuhan Hu1 SARS-CoV-2 (COVID-19) virus itself. Please bear with me: what may look like “diffuse parts” are all important pieces of the whole.

There is some “background information” that is necessary to “lay the groundwork” for the rest of today’s offering. Yours Truly begins here, with a paper by Ralph Baric, PhD, of the University of North Carolina, Chapel Hill, from 2006. The paper is found here: https://www.jcvi.org/sites/default/assets/projects/synthetic-genomics-options-for-governance/Baric-Synthetic-Viral-Genomics.pdf, “Synthetic Viral Genomics: Risks and Benefits for Science and Society”, Ralph S. Baric, PhD. In Yours Truly’s opinion, this paper can be viewed as a “blueprint” for the future Gain-of-Function (GoF) lab-experimentation with, and the lab-creation of, viruses such as the Wuhan Hu1 SARS-CoV-2 (COVID-19) virus; and the more-recent GoF experiments with strains of the H5N1 (Avian Influenza) virus. Please see the screenshots from Dr. Baric’s 2006 paper, below:

YT: Note the mentions, right at the start in the paper, about “biological warfare” and “biodefense.”

YT: The above images are from the Baric 2206 paper. Figure 4b appears to “outline” how to lab-create (Gain-of-Function work) of “synthetic coronavirus” genome codes.

Yours Truly will specially point out the passage above, “…data will provide detailed predictions regarding easy approaches to humanize zoonotic strains by retargeting the attachment proteins to recognize human, not the animal receptors (43-45).” This, in my opinion, is a direct “tie-in” to the gene code pieces from the Pangolin MP789 coronavirus that were used in the lab-creation of the original Wuhan Hu1 SARS-CoV-2 virus (COVID-19 virus) itself — the same virus that is the foundation of all the modRNA COVID-19 “vaccines”, including the “booster shots” and the “latest formula vaccines.” The MP789 coronavirus gene code has multiple “areas” that the human body can be receptive to — including the PRRAR / PRRARSV “backdoor key” to nucleus of every cell. Please see the following for more information about MP789 and its connection to the PRRARSV “backdoor key” that both the modRNA COVID-19 “vaccines” by Pfizer-BioNTech and by Moderna contain: https://www.theqtree.com/2023/05/01/pfizer-and-moderna-vaccines-both-contain-the-prrarsv-key-to-the-cell-nucleus/; https://www.theqtree.com/2024/11/22/health-friday-11-22-2024-open-thread-lets-talk-about-prrarsv-the-backdoor-key/; and, https://www.theqtree.com/2024/11/27/placeholder-open-thread-11-27-2024-prrarsv-part-2-pangolin-edition/.

There is also something else of interest to point out regarding one of the References in the 2006 Baric paper: Reference 45. The referenced paper is found here: https://www.embopress.org/doi/full/10.1038/sj.emboj.7600640, “Receptor and viral determinants of SARS- coronavirus adaptation to human ACE2.”, Li, W., et al., 24 March 2005. This paper discusses the GoF experiments performed to determine and then lab-create elements of various rat and palm civet coronaviruses to the ACE2 receptor cells of humans. Recall that rat and civet coronaviruses experiments were performed at the Wuhan Institute of Virology in the process of lab-creating the SARS-CoV-2 (COVID-19) virus itself. Please see the screenshots from the paper, below. The first is from the authors’ “summary” a the top of the paper; the second is the end of the Discussion section of the paper:

Ralph Baric, PhD, was also working on the “cross-species adaptation and transmission” aspects of SARS- coronaviruses. For example, this paper: https://pmc.ncbi.nlm.nih.gov/articles/PMC2838128/, “Recombination, Reservoirs, and the Modular Spike: Mechanisms of Coronavirus Cross-Species Transmission”, Rachel L Graham, Ralph S Baric, 11 November 2009. The paper specifically discusses Spike 1 residues and ACE2 receptor cells in coronaviruses found in Himalayan palm civets; bats; and raccoon dogs — and the possibility that these coronaviruses can “leap” to humans.

And now, with the above as part of the context, Yours Truly presents LINE-1. First, via Wikipedia (https://en.wikipedia.org/wiki/LINE1):

And, Second, from ActiveMotif (https://www.activemotif.com/blog-line-1, “LINE-1 Elements: Walk the LINE-1”, Michelle Tetrault Carlson, PhD, 13 September 2022):

LINE-1 cells are found throughout the human body. LINE-1 aberrations are involved in the following conditions: Genetic disease; cancers (lung; ovarian; bladder; colon; breast; brain [glioma]; and, liver.) LINE-1 aberrations / changes are also involved in aging and “aging related diseases” (per the article above, in the “LINE-1 and Aging” section.)

LINE-1 (also called L1) cells have been studied for some time; in particular, the association between L1 “retrotransposition” and disease. This is important in the context of what will be discussed next.

L1 cells can be “retrotransposed.” This will create “genetic instability.” Such retrotransposition can occur as an aberration resulting from genetic predisposition in the body. Please see: https://doi.org/10.1016/S0092-8674(02)00839-5, “Human L1 Retrotransposition Is Associated with Genetic Instability”, David E. Symer, et al., 9 August 2002. The Abstract from this paper is below:

This paper also discusses the role of SV40 in L1 retrotransposition. In addition, there is a section entitled, “L1 Is an Engine for Genetic Change.”

Transposed” L1 cells can be involved in the establishment of cancers: https://doi.org/10.1101/gad.351051.123, “LINE-1 retrotransposition and its deregulation in cancers: implications for therapeutic opportunities”, Carlos Mendez-Dorantes, Kathleen H. Burns, 13 December 2023. Please see the screenshot from this paper (a graphical “process image” of L1 being “retrotransposed”), below:

The alarm bells have been ringing regarding the dangers of LINE-1 (L1) retrotranposition (“reverse transcription”) effect of the modCOVID-19 “vaccines” for some time. Examples: the “Maurol, et al.” paper of March 2022: https://www.hilarispublisher.com/articles/intracellular-reverse-transcription-of-covid19-mrna-vaccine-eminvitroem-in-human-cell-87770.html, “Intracellular Reverse Transcription of COVID-19 mRNA Vaccine In-Vitro in Human Cell.”, Maurol, Luisette Mauro, Naseer Almukthar, Tarro Giulio, and Gamal abdul Hamid, et al., J Genet DNA Res6(2022):116. Please see the screenshot from this article, below:

YT: Note the mention of a timeframe of 5-10 years that is needed to study the effects of the “transcription activity.” Keep this in mind when reading the end of today’s offering.

Then, there is the “Alden, et al.” paper from April 2022: https://www.mdpi.com/1467-3045/44/3/73, “Intracellular Transcription of Pfizer BioNTech COVID-19 mRNA Vaccine BNT162b2 In Vitro in Human Liver Cell Line”, Markus Alden, Yang De Marinis, et al., 11 April 2022. Please see the screenshots from this paper, below. The first is from the paper itself; the second, an image of the Pfizer-BioNTech BNT162b2 reverse transcription of DNA, is Slide 14 from the Doctors for COVID Ethics article (https://doctors4covidethics.org/wp-content/uploads/2022/08/causality-article.pdf, “Vascular and organ damage induced by mRNA vaccines: irrefutable proof of causality”, Michael Palmer, MD, and Sucharit Bhakdi, MD, August 2022):

And, the “Acevedo-Whitehouse and Bruno” paper from February 2023: https://doi.org/10.1016/j.mehy.2023.111015, “Potential health risks of mRNA-based vaccine therapy: A hypothesis”, K. Acevedo-Whitehouse, R. Bruno, 6 February 2023. Please see the screenshots from this paper, below; the first is part of the Abstract; the second is the end of the Consequences and discussion section:

Which all lead to this, from Dr. Peter McCullough in May 2025: https://www.americaoutloud.news/genetic-bombshell-covid-19-vaccines-change-the-human-genome/, 24 May 2025. Please see the screenshots from this article, below. First, this one:

This harks back to the information that there are natural reasons for DNA alteration in a person’s body (for example, inherited genetic aberrations.) **** However, the issue here is the fact that the modRNA COVID-19 “vaccines” by Pfizer-BioNTech and by Moderna contain ingredients and mechanisms that deliberately and permanently alter the DNA of the human LINE-1 cell lines of any person who takes these “vaccines” — even one injection of them. This includes DNA alteration in the body of a fetus of an expectant mother who takes modCOVID-19 “vaccines”, due to the fact that these “vaccines” cross the placenta and into the body of the fetus. (And, by the way, those same ingredients and mechanisms are present in all “descendant clone” modRNA COVID-19 “vaccines” made by these companies, including the “booster shots” and the “latest version formula” injectables. This is because these are based on, and contain elements of, the original modRNA COVID-19 “vaccines” by these companies.)

Then, the second screenshot, below:

YT: **** Please read this phrase again, from Dr. McCullough, regarding the modRNA COVID-19 “vaccines” by Pfizer-BioNTech and by Moderna: “…sadly, both Pfizer and Moderna do permanently alter DNA via reverse transcription.It is the “permanently alter DNA via reverse transcription” effects from these injectables that the COVID-19 “vaccinated” in the United States and all over the world are starting to present. It is impossible that the FDA did not know about the potential DNA-altering effects of the modRNA COVID-19 “vaccines” — especially after scientific papers were published which demonstrated that this indeed is the case.

Another piece of the situation has just been published: According to the CDC, 76.4% of all American adults have at least one chronic disease (2023 figures), compared to baseline 2013 figures. The CDC paper is here: https://cdc.gov/pcd/issues/2025/04_0539.htm#ContribAff, “Trends in Multiple Chronic Conditions Among US Adults, By Life Stage, Behavioral Risk Factor Surveillance System, 2013 – 2023”, Kathleen B. Watson, MD, et al., 17 April 2025. All of the authors of this paper are either employees of the CDC; or, of the United States Uniformed Health Services. While it is true that chronic diseases, such as arthritis, can develop for many reasons during adult years, there is NOT ONE WORD in this paper regarding COVID-19 “vaccination” in this age group (18 years – 65+ years) being involved in the increase of any of the chronic diseases that are listed. In other words — the CDC still has its “head firmly in the sand” regarding the dangers and deadliness of the modRNA COVID-19 “vaccines”, and the role of these “vaccines” in inducing and/or aggravating multiple types of chronic conditions.

**** What are “COVID-19 “vaccinated” Joe or Jane Average American” going to do when they find out and understand (which they will, eventually) that the most fundamental “building block” of their body — their DNA — was deliberately and permanently altered without their knowledge or consent, if they took any injection of a Pfizer-BioNTech or a Moderna modRNA COVID-19 “vaccine”? That it doesn’t matter when the “vaccine” injection was put into their body, or how many injections? That their modRNA COVID-19 “vaccinated” children ALSO had their DNA deliberately and permanently altered without their parents’ or guardian’s knowledge or consent? That the state and local governments who “mandated” or legislated that the modRNA COVID-19 “vaccines” be taken by their children in order for them to attend school were complicit in the DNA alteration in their children?

**** What will “COVID-19 “vaccinated” Joe or Jane Average American” do when they find out and understand (which they will, eventually) that the altered DNA in their “vaccinated” body will “lurk” in the body and brain, creating permanent dysfunction of multiple organs of said body, until a modRNA COVID-19 “vaccine”-induced injury, illness, or disability presents later on? That is very likely no “cure” or “turning the clock back” for this altered DNA in the “vaccinated” body?

**** What will “COVID-19 “vaccinated” Joe or Jane Average American” do when they find out and understand (which they will, eventually) that the medical professionals they trusted when they took the modRNA COVID-19 “vaccines” have betrayed them at the most basic level —“Do No Harm”— by not doing the investigation which would have alerted them to this danger — but, which medical professionals, instead, followed the CDC / FDA / AMA mantras of, “The COVID-19 vaccines are safe and effective”, and “The known and potential benefits of the COVID-19 vaccines outweigh the known and potential risks”?

The people who included the elements and mechanisms in the Pfizer-BioNTech and Moderna modRNA COVID-19 “vaccines” that guarantee the deliberate and permanent reverse-transcription of the LINE-1 DNA of every COVID-19 “vaccinated” person; the people who knew about these reverse-transcription elements and mechanisms, but still allowed EUAs and “FDA full approval” of these “vaccines” to proceed; the people who intentionally withheld vital information regarding the real dangers and deadliness of the modRNA COVID-19 “vaccines” from President Trump45 during “Operation Warp Speed”; the people who, even today, are still “recommending” COVID-19 “vaccination” for anyone of any age (paging Dr. Martin Makary, current FDA Commissioner) — all must answer for their actions. All modRNA COVID-19 “vaccines” must be removed from use and pulled off the market — now.

THERE. MUST. BE. ACCOUNTABILITY.

THERE. MUST. BE. JUSTICE.

THERE. MUST. BE. TRUTH.

Peace, Good Energy, Respect: PAVACA


Dear KMAG: 20250818 Trump Won Three Times ❀ Open Topic


Joe Biden never won. This is our Real President – 45, 46, 47.

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.

Hey – we actually got him out! *salutes Wheatie*


Wolfie’s Wheatie’s Word of the Week:

pantochronometer

noun

  • combined sundial and compass

Used in a sentence

pantochronometer is a Horizontal Magnetic Dial, i.e. a floating sundial on a compass card. The rotating card automatically aligns itself along a north-south axis.

Shown in a picture

Shown in a video


MUSIC!

Another Sydney Sweeney AI parody for your inspection!


THE STUFF

Finnish genetics – evidence of more cross-pole traffic, headed the other way from the ancestors of the American Indians!

Complicated business.

Just sayin’!

And remember…….

Until victory, have faith!

And trust the big plan, too!

And as always….

ENJOY THE SHOW

W



DEAR MAGA: Open Thread 20250225 ❀ Tuesday Placeholder ❀ Get Smart – Buy a Globe!

We continue to mourn the untimely passing of our beloved compatriot DePat, known in real life as Susie Sampson, and also as author Patricia Holden.

Until we have a dedicated author for the Tuesday daily open thread, I will be posting “placeholders” like this one, which may or may not be spiced up with additional content.

Gudthots will take DePat’s old Thursday daily open thread.

Please notify me in advance if you would like to post anything in lieu of the Tuesday placeholder. We welcome all content – the topic doesn’t matter.

W



Get Smart – Buy a Globe!

When I was trying to get somebody to take DePat’s Tuesday open thread – meaning THIS thread – and there were no takers, I toyed with the idea of turning this open into a kind of comedy hour. The satire would be brutal – brutal enough that somebody would quickly decide to shut me up by volunteering to take the open. OR SO I HOPED!

I was going to call myself Flat Earth Wolf, and I planned to ferociously but facetiously advocate everything that most people here disagreed with, if not depise. Flat earth, no virus, deep state Trump, woke right – the worse, the better!

Yeah, at first it sounded kinda fun, but then I realized that it would just drive people away. And even I wouldn’t enjoy it.

SIGH.

Eventually, I just decided to use this open to post my own honest opinions about things. The beauty of that is, if somebody disagrees with me, they only have to volunteer to take the open to shut me up – but I don’t have to be funny or interesting, which is work.

I can just spout off and state my piece – and that is exactly what I’m going to do!

Now, as you have seen, I’ve spent a lot of time being “fair” to flat earth, by making sure people who want to post any side of any debate can do so here – and that is still happening. Most of the time, I’m encouraging people to post views that may oppose not only my own views, but everybody else’s, too.

But it’s time to be more….. how shall I say….. “complete” about things.

I try to be “nice” about a lot of “science” that “has issues”. I just try to smile and not pull out any deadly weapons of argumentation.

No serrated blades. No 100-round clips. No razor-studded baseball bats. Maybe a hanky. Yes. A perfumed hanky. Cough. Cough. Pardon me!

WELL – NOT TODAY, AND NOT RIGHT HERE, AND NOT RIGHT NOW.

¿Comprende?

Pardon me for just one moment. I’m gonna be tougher about science. Because we have to be tough. We are up against a very organized force.


The Yellow Berets, also known as Public Health Service trainees, were a group of physicians who participated in the National Institutes of Health (NIH) Associate Training Program during the Vietnam War era. They were often derogatorily referred to as “Yellow Berets” by supporters of the war who viewed them as avoiding military service.

LINK: https://www.malone.news/p/deconstructing-nih-cdc-and-fda-culture


We are up against some really bad people, who are fully prepared to tell any lie for their purposes. So this opposing army – OUR army – can’t tolerate weak, wrong, and misled science in the forward combat positions. SURE – if you want to work on the base back in safe territory, you can believe all the bad and broken science you want. But if you want to get out in front, you have to subject your own biases to the relentless sharpening forces of TRUTH – and in particular EVIDENCE.

Some things are very certain out in the front lines. One of them is that this planet is a sphere, roughly.

NOW – like most other professional scientists, I haz science skilz in a lot of different areas, because most true scientists are like that. We don’t turn off the science when we walk out of school or job – and our opinions can be particularly relevant in looking at other people’s “expert” stuff, and asking terrible, sharp, venomous questions that the “experts” in those areas are hiding from, or pretending don’t exist.

Much “organization” in current, problematic, sick, “mainstream” science is done to insulate compromised insiders from pesky intelligent outsiders.

Decorum, you know. That’s it. Decorum.

Well, too bad.

BUT we have to hold ourselves to the same revolutionary standards.

Yadig? Of course! What’s good for vaccines, is good for “no virus”, “flat earth”, and many other things.

Globe Earth Wolf has a recommendation that will ultimately test your faith in God, by beating on it. He’s gonna BEAT your armor until it is HARDER, and the first beat-down is that you need to buy an actual globe and STUDY IT.

They’re CHEAP AS DIRT. Most are made in CHYYYNA. But you still have to buy one. I don’t care where it’s made. BUY A GLOBE. And if you already have one, pull it out of the closet, attic or basement.

Buy one at a garage sale, if you have to.

I recommend buying a globe that is at least 12 inches in diameter, and is mounted so that the tilt of Earth’s axis relative to the sun is clearly demonstrable.

Blue oceans which are highly differentiated in color from the land masses are very helpful. Political boundaries are somewhat immaterial, although they do help you LOCATE things more quickly and precisely, and if they are current, the globe can be used to increase your current geopolitical understanding. On the other hand, a vintage globe can be useful for more historical understanding. In either case, I recommend blue oceans, because some vintage globes hide this physically useful truth, by making everything somewhat off-white, sepia and tan, simply to look good on furniture, as opposed to BEATING ON YOUR BRAIN, which is my purpose.

What I am doing is actually a stupid trick from science – a silly secret among the “top men”. And top women, but let’s not get TOO bogged down in DEI.

You see, MODELS – simple physical models – are behind so much of the best science and so many of the best scientists. I have watched this throughout my entire life, and it’s hilarious. Good models are what won Watson and Crick the Nobel Dynamite & Bankster Prize for DNA, and Doudna and Charpentier the same for CRISPR-Cas9. Good models are how all the best work on C60/Buckyballs/Fullerenes was done.

Good models are how stereochemistry was explained in the late 19th century. Good models are – over and over – how organic chemistry and then biochemistry were worked out in the 19th and 20th centuries.

When I went to school with a bunch of scary smart people, I quickly realized that I could use my cheap plastic molecular model set, which I was ironically forced to buy, but wisely chose to actually use, to find all sorts of science which had apparently evaded older students and even our professors for years. Simple, stupid, cheap, plastic and aluminum, “straws and jacks” (not even balls and sticks) was all it took to figure out realities that would ALWAYS show up in chemical behavior, spectroscopy, and quantum mechanical calculations.

I would SHOW PEOPLE this stuff with models – and you could always tell the winners from the losers by how fast they would start using their own “required but never used” model set to figure things out – by how carefully (or stupidly and carelessly) they would cut their little bonds – by how carefully or carelessly they would grab the right “jack” to get the right angles at the atoms – by how strongly they would reason past the limitations of the cheap models – and by how quickly they would spend some of their hard-earned but very limited cash to buy a SECOND or THIRD model set, to make even bigger and better models possible.

I am doing the exact same thing here, to make you smarter – to make YOU a winner.

Because we can’t have too much winning if you aren’t on the same page as Trump, as well as the historical patriots who really did walk this SPHERICAL planet and built this great civilization – and GOD – who made this WORKING BALL on which WORKING LIFE not only EXISTS but THRIVES and then hopefully carries on His PRO-LIFE MISSION of creating and persisting a life-filled and God-loving universe, which is something GOD WANTS BECAUSE IT’S GOOD.

Just my opinion?

Yeah. But still – buy a globe. You will learn so much from it.

I recommend keeping your globe in some place you visit regularly. I stand in front of my globe generally 2-4 times a day, and I probably toy with it at least daily. When we’re having science discussions here, especially after one of Steve’s science posts, I may spend a half hour with that globe.

What am I looking at?

I am looking at seasons. I’m looking at angles of the sun. I’m looking at hours of daylight, twilight, and darkness. But that’s just the beginning.

Most importantly, I’m looking at thousands of tiny details and saying “OH, THAT MAKES SENSE”. Airplane flights. Jet lag. Shipping routes. Planetary distances. Phone conversations. Satellites. “4 AM”. Russia, CHYYYNA, Japan. Burma Shave. TAIWAN. Why Hawaii has always been filled with trouble and bullshit. Look at your globe and every little thing starts to make sense.

This is very critical. When you have a real, true, winning solution in science, like a spherical planet, it just makes all the little stuff WORK. All the thousands of minor details WORK for any scientist who looks at the model, and kicks the tires. This is why Newton is not “replaced” by Einstein – he’s just being helped out around the edges where things get weird.

The problem with “Flat Earth” (and other things I’ll talk about later) is that one big mistake made from an emotionally attractive bias to the past tries (and fails) to upset all the little yet critical stuff other people are doing or have done – meaning millions of honest, good-faith observations. THEN, the same people who break all the little yet critical stuff for everybody else, when confronted, just throw back some non-working, “causes even more trouble”, evasion of an answer, and pretend that they answered the problem, when they didn’t. And that is exactly why nobody takes them seriously, and most people ignore them.

In science, you have to make something that lets OTHER PEOPLE explain or predict stuff on their own, successfully, nearly every time, to actually have a product that sells AND GETS RE-SOLD. Newton did that. Chemistry did that. Electromagnetism did that. Relativity did that. Quantum mechanics did that. Particle physics did that.

When you look at the globe, try to predict how long automobile trips and plane flights take. Look at where islands are. Look at where history happened. Look at where mankind started, wandered, and settled. Look at climate. Look at weather. Look at temperatures. Look at where those temperatures are on the globe.

Right there, the semi-frozen pizza stumbles hard, but the globe, with two poles on one axis, just works like crazy. Everything is nicely – no – perfectly explained – and it’s explained all together at the same time, by a very simple model.

Your actual globe will make you a solid and strong glober. And scientist. And lover of truth.

And then you will become even stronger, because – believe it or not – you will become stronger in FAITH. You will start to see how God makes stuff WORK – and I mean REALLY WORK – simply, powerfully, independently – and that pattern is something you can predict will show up again, and again, and again.

God makes stuff that WORKS. And KEEPS WORKING.

But I’m getting ahead of things.

So buy that globe, or get the old one out, and let’s talk about it. Make that globe WORK for you. Let it help you see the TRUTH.

And as it brings you closer to TRUTH, it will bring you closer to GOD.

W

“Is there anything as great as a Trump rally?”

TOPSHOT – US President Donald Trump holds a Make America Great Again rally as he campaigns at Orlando Sanford International Airport in Sanford, Florida, October 12, 2020. (Photo by SAUL LOEB / AFP) (Photo by SAUL LOEB/AFP via Getty Images)

Dear KMAG: 20231218 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

G-quadruplex

and related terms such as

G4 knot and G-tetrad

nouns

In molecular biology, G-quadruplex secondary structures (G4) are formed in nucleic acids by sequences that are rich in guanine.[2] They are helical in shape and contain guanine tetrads that can form from one,[3] two[4] or four strands.[5] The unimolecular forms often occur naturally near the ends of the chromosomes, better known as the telomeric regions, and in transcriptional regulatory regions of multiple genes, both in microbes[6][7] and across vertebrates [8][7] including oncogenes in humans.[9] Four guanine bases can associate through Hoogsteen hydrogen bonding to form a square planar structure called a guanine tetrad (G-tetrad or G-quartet), and two or more guanine tetrads (from G-tracts, continuous runs of guanine) can stack on top of each other to form a G-quadruplex.

The placement and bonding to form G-quadruplexes is not random and serve very unusual functional purposes. The quadruplex structure is further stabilized by the presence of a cation, especially potassium, which sits in a central channel between each pair of tetrads.[3] They can be formed of DNARNALNA, and PNA, and may be intramolecularbimolecular, or tetramolecular.[10] Depending on the direction of the strands or parts of a strand that form the tetrads, structures may be described as parallel or antiparallel. G-quadruplex structures can be computationally predicted from DNA or RNA sequence motifs,[11][12] but their actual structures can be quite varied within and between the motifs, which can number over 100,000 per genome. Their activities in basic genetic processes are an active area of research in telomere, gene regulation, and functional genomics research.[13][14]

LINK: https://en.wikipedia.org/wiki/G-quadruplex

Shown in a picture

Wolf’s easy description

Those genetic bases (the little flat molecules with one or two rings and lots of “N” and “O” in them) can not only bond to each other in PAIRS between different bases – the base guanine (G) can bond to itself if it makes a circle big enough for FOUR of them instead of just a pair (see left picture above). Sometimes a metal ion in the center can help this happen.

This competing form of binding disrupts the nice, neat, normal “double helix” binding, but not permanently.

When G4 binding happens, there are many working ways that the little squares can form. These squares tend to STACK just like in normal DNA, and so sequences that are rich in guanine can build these stacks easily, if the guanines are in the right places. Alternatively, two or more strands of DNA or RNA can join in these knots, but at a minimum, a single strand can do it, as shown on the right of the graphic above, where the sequence knots up against itself.

Note that this is more like “knots in velcro”, and not like various circling knots we are familiar with.

Used in a sentence

“For over two decades, the prime objective of the chemical biology community studying G-quadruplexes (G4s) has been to use chemicals to interact with and stabilize G4s in cells to obtain mechanistic interpretations.”

LINK: https://www.sciencedirect.com/science/article/pii/S2451945621000416

Why it’s important for COVID vaccines

The COVID vaccine mRNA is not natural – and not only in that normal bases are substituted with modified bases. It also has been “codon optimized”, meaning the very sequence of bases was changed from the viral sequence, by substituting base triplets with synonymous ones, that are known to process faster in humans. But the problem is that these changes are rich in guanine, making the knotting more likely. This not-fully-equivalent substitution has potential pharmacological consequences. In a sense, viral evolutionary intelligence was ignored (a beautiful point made by Kevin McKernan).


Music

Let’s start off with some LIVE DRINKABY

Sadly, DRINKABY line dancing hasn’t just infected the other side of the Pacific – it has become a destructive influence in Spongebob’s hometown of Bikini Bottom.

https://youtu.be/xGTdVy7t1K8

This led to me watching (please skip, unless you desire to prove the full effect that follows) a video compilation of the times the town of Bikini Bottom was destroyed in the cartoon “Spongebob Squarepants”.

When that destructive propaganda of mayhem was over (yes, even Spongebob is one of their tentacles), I needed the following.

This is only 18 minutes – and worth every one of them.

But here is the one you need right now!


You know, maybe we’ll just leave it right there and skip the usual worldly “stuff”!

Although I did promise PAVACA that I would explain something, so we’ll try that.


MOAR DNA and RNA STUFF

Check out this video, which shows TRANSCRIPTION – the normal, natural way that DNA is turned into RNA in living organisms on this planet.

What you are seeing here is “good”!

https://twitter.com/Levandov_2/status/1735919142086041794

NEXT – Somebody else posted this under their own timeline on X.

NOW – the molecular biologist who found the DNA contamination problem in the mRNA vaccines – Kevin McKernan – reposted the latter video with a comment about something which is NOT in the video, but which would change it. Here is his comment.

Let me explain what Kevin is saying.

Kevin is not commenting about the transcription process shown here. He is NOT talking about the red DNA strand, either. He is commenting about the yellow strand of mRNA which is being produced.

“Now add N1 methyl Pseudouridine and watch that yellow strand turn into quadruplex G knot.”

He is saying that if you change the uridines in that molecule to N1-methyl-pseudouridine, as was done in the Pfizer vaccine, the yellow strand of mRNA will “kink up” with G-quadruplex knots.

He explains that further, when somebody wrongly claims the video is showing translation (creation of proteins) and not transcription (creation of mRNA). Observe.

So to sum up, he is saying that the “good” “yellow” mRNA produced in the video was corrupted by the modifications that were made to it by Pfizer.

He says the following things:

  • it’s transcription, not translation, that is being shown
  • the “pseudo-uridine” changes done to the viral mRNA sequence make the mod-RNA dissociate more easily
  • the same changes make the mod-RNA form G4-quadruplexes easier
  • Pfizer also changed the code to include more guanines (G), which means more quadruplexes
  • all the G4-based KNOTS that are present in the mod-RNA cause the subsequent TRANSLATION step (looks similar to the video, but it’s PROTEIN being formed) to suddenly PAUSE, just like a KNOT in a climbing rope will lock up against a device until it is untangled. This is the “ribosomal pausing” he’s talking about.

So how does the DeMarinis paper figure into this?

The DeMarinis paper showed that the Pfizer vaccine can be reverse-transcribed from mod-RNA back into DNA by human liver cells. Reverse transcription would look pretty much like the video of transcription, except that RNA would be read, and DNA would spit out.

Whether that DNA is incorporated into the genome or not is unknown, but it is a huge concern, because another group (Jaenisch paper) showed that the COVID virus SARS-CoV-2 can and does incorporate its spike into the genome of some patients, AND yet another group (Mehedi paper) showed that the viral spike shepherds its own mRNA into the nucleus of human cells, where reverse transcription could happen.

I wanted people to see a bigger point – that this repeated and coincidentally connected “bungling” by Pfizer and its allies, which weirdly matches WEF’s dream of “hacking humanity”, is worthy of a bit of suspicion.

When a trail of disconnected yet matching footprints goes in some direction, it’s rather logical that somebody was purposefully passing that way.

It sure looks to me like the various “negligent” yet clearly convenient aspects of this whole exercise, add up to an attempt to gain a population-wide hack into the human cell nucleus.

Just sayin’!

That’s all for now.

Until victory, have faith!

And trust the big plan, too!

And as always….

ENJOY THE SHOW

W


Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do?


TL;DR –

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.


The central dogma of molecular biology. They shilled the blue arrows to the masses as lies about safety, while hiding the special red arrow and actually working to open it up for business.


Show-Time (Introduction)

I have finally realized that I need to spell out, in as many ways as needed, what is really going on with SARS-CoV-2 and these derived mRNA vaccines.

I had hoped that people would see the implications of the science which is now open to us, with the publication of first the Jaenish paper, then the De Marinis paper, and finally the Mehedi paper. I have commented extensively on each one of these papers, including very recently on the Mehedi paper, which really makes things obvious. I had thought that somebody more notable than me would try to make the point I am about to make. Sadly, nobody has, so it looks like I’m going to have to do it.

These vaccines are designed to BEGIN to change us on a fundamental level which is not exactly the same as the “transhumanism” that constitutes most of the “clickbait” against the vaccines. It’s similar, but it’s not the same. What we see in the clickbait is a distraction from the actual danger, which is not strange and distant and unbelievable, but is in fact right here, and right now, and very believable, once you understand it.

The truth is a lot more like GATTACA, and a lot less like Transcendence.

It’s already starting, and the infrastructure is being set up. The first step has actually been accomplished, and it was in many ways a HUGE success.

Humans ARE being engineered right in front of our eyes. I hope that you can see this point by the end of this article.

They (meaning WEF and its backers) hacked the human cell nucleus on a population genome level. They created a “Trojan” virus that appears to have “zero-dayed” the human cell nucleus. Artfully, the hack is a lot like state-level “APT” (advanced persistent threat) computer hacks, in that it gets in and holds the door open. Of course, better models can be created, but the self-replicating crowbar for the cell nucleus has obviously arrived, and its imperial version of SPQR is PRRARSV.

THAT is the fundamental advance that was achieved here.

I have to say, it was ingenious and “admirable”, in several senses – scientific, military, and criminal. Of course, your mileage may vary on “admirable”. Many will consider it “diabolical”.

What we are facing is the immediate REAL danger of biological engineering and eugenics, which was employed in a fantasy way, as a technical MacGuffin, in various episodes and productions in the Star Trek universe.

This is a scene from Star Trek II: The Wrath of Khan. These two people are “superhumans” who (according to the story) proved to be disastrous for Earth, during our current century (more or less). The one on the right is “Khan” – obviously in homage to Genghis Khan and his relatives, who ruled much of Asia for centuries.

Don’t get lost in the fantasy stuff. THAT is not the big danger. Stick around for an explanation of the reality which is actually upon us.

Here is how Wikipedia describes Khan, but more importantly, where he CAME FROM.


Khan Noonien Singh is a fictional character in the Star Trek science fiction franchise, who first appeared as the main antagonist in the Star Trek: The Original Series episode “Space Seed” (1967), and was portrayed by Ricardo Montalbán, who reprised his role in the 1982 film Star Trek II: The Wrath of Khan. In the 2013 film Star Trek Into Darkness, he is portrayed by Benedict Cumberbatch.

Khan had controlled more than a quarter of the Earth during the Eugenics Wars of the 1990s.[1] After being revived from suspended animation in 2267 by the crew of the Starship Enterprise, Khan attempts to capture the starship but is thwarted by James T. Kirk and exiled to Ceti Alpha V, where he has the chance to create a new society with his people. In Star Trek II: The Wrath of Khan, set fifteen years after “Space Seed”, Khan escapes his exile and sets out to exact revenge upon Kirk.

In Star Trek Into Darkness, set in the alternate continuity established in Star Trek (2009), Khan is awakened almost a decade before the events of “Space Seed“. Khan is given the false identity John Harrison and coerced by Admiral Marcus into building weapons for Section 31 and Starfleet in exchange for the lives of Khan’s crew. He ultimately rebels and comes into conflict with the crew of Enterprise.


OK – so what are the “Eugenics Wars”?

Back to Wikipedia…..


When the original series of Star Trek was produced, the 1990s were several decades away, and so various elements of the backstory to Star Trek are set in that era, particularly the Eugenics Wars. The references to the Eugenics Wars and to a nuclear war in the 21st century are somewhat contradictory.

The episode “Space Seed” establishes the Eugenics Wars, and has them lasting from 1992 to 1996. The Eugenics Wars are described as a global conflict in which the progeny of a human genetic engineering project, most notably Khan Noonien Singh, established themselves as supermen and attempted world domination. Spock calls them “the last of your so-called World Wars”, and McCoy identifies this with the Eugenics Wars.


OK – don’t get me wrong. I’m not saying it’s EXACTLY like Star Trek, although I do subscribe to the folk notion that Star Trek is a VERY good predictor of things that are likely to happen.

What I AM saying is that genetic engineering of humanity has already started, and now I’m going to explain why this is so.

We will take a brief tour into the PAST, before we return to the future. If a light bulb comes on, keep it lit!


You cannot uninvent the genetic Tommy-gun, nor the gun moll who knows how to code.

Bonnie & Clyde of the Nucleus

BANKS make a really great analogy of the cell nucleus.

  • they’re common and everywhere
  • they contain valuable stuff that needs to be protected yet dispersed
  • they have high security
  • things need to traffic securely in and out of them

Breaking into a bank with very high security is a lot like what the spike protein does. But the spike protein doesn’t do it alone. THAT is an important point from the three papers I keep mentioning. The spike protein has a PARTNER who has all the plans.

OK – just for the record – this is going to deviate a little bit from the ACTUAL story of Bonnie and Clyde. Just warning you – it will get weird.

The spike protein and the spike protein mRNA are a PAIR, and together, they are able to not only break into the bank, but to totally take it over, and keep it taken over. And then to take over more banks.

Here is how it works.

The spike protein is Clyde. He’s got a gun, and he causes all kinds of trouble with it. He’s the “action” guy. He knows how to break into banks, mostly because he has a phony ID that always gets him in. The phony ID says PRRARSV in big letters on it, which makes all the bank guards at Cell Nucleus Bank and Trust say “Why, welcome, Mr. Barrow! We’re pleased to see you at the bank today! Come right on in!”

Or, to use a different analogy…..

These bank guards are such chumps, but it works every time.

Well, here is the problem for the bank. When Clyde goes in, he always brings his partner Bonnie. And SHE is trouble. She’s not so good with a gun or a fake ID, but she is a real scam artist, who knows how to get into the bank and embezzle the hell out of it.

Bonnie gets into the cell nucleus bank, and with some help from Clyde, she gets a permanent job there. Bonnie and Clyde are set for life. None of this “grab the cash, run out, get caught, and die in a hail of bullets” shit. No sir! THIS Bonnie and Clyde are smart.

Bonnie trains many of the new girls at the bank – and like the pod people in “Invasion of the Body Snatchers”, she turns every last one of them into exact copies of HERSELF. NASTY! So all these fresh Bonnies are trained by the bank and sent out to get into new banks.

But wait! Bonnie can’t get into banks. Bonnie doesn’t have a gun or a fake ID! How can she get into more banks?

Easy! Bonnie and all her Bonnie clones have the power of multiplication – not just to make more copies of each one herself, but to make more Clydes. Bonnie makes more copies of herself while she’s IN the bank, and she makes copies of Clyde while she’s OUT of the bank.

So every Bonnie that leaves the bank, creates hundreds of new Clydes on the outside. The next time Bonnie wanders near a bank, there are bound to be dozens of Clydes just hanging around, ready to escort her, and maybe even other gals [important], into the bank. If no Bonnie is already working there, she gets a job, and the process starts over.

The KEY POINT is that BONNIE makes the CLYDES who can get her, or women like her, into the next bank.

Bonnie can’t get into the bank, and Clyde can’t get a job in the bank, but together, they can make a living by embezzling banks.

Side Note: This is a beautiful example of a contradiction in the Marxist sense. Proteins and nucleic acids can’t do certain things alone, and thus NEED EACH OTHER.

Once Bonnie is on the payroll, this fact introduces a permanent security problem in the bank, and for all other banks.

And why is that?

Once Bonnie is on the payroll, you can’t get rid of her.

She will just create more Bonnies and more Clydes, and they will scam more banks.

In terms of banks, banks can resist just Clyde or just Bonnie, but they can’t resist the pair.

In terms of the cell nucleus, it can resist the spike protein or the spike mRNA, but it cannot resist both of them together.

Which pair, oddly, is exactly what the vaccines create.

WHAT ARE THE CHANCES?


We can use other analogies, using banks, which emphasize the spike protein more.

Imagine a bank that was convinced to crank out KEYS TO THE BANK, and to send out these keys. Imagine thousands of keys to the bank being sent out by the bank into the community, perhaps in a really stupid PR stunt.

God knows WHO is going to get into the bank now.

God knows WHAT is going to get into the genome now.

Are you starting to see what they did?


Fact Checking the Fact Checkers on DNA Change

The absolute best way for me to convince you that they really said these vaccines could not do what they are now proven to be doing, is to simply play back the words of the “fact checkers”.

See if you can spot how many LIES are told in this video.

If you’re not spotting the lies, read THIS ARTICLE.

AND – by the way – this video is a GREAT explanation of the way things NORMALLY work. It’s totally out to lunch on the way things ACTUALLY work.

Did you spot the lies? Tell me what you found in the comments.

This video is not alone – there are HUNDREDS OF THEM.

There are also hundreds if not thousands of articles of a similar nature. I’m just going to pick one of them – the one that happened to have the graphic I used above. That article is dated from MARCH of 2021 – right when the authorities were hard-selling the “vaccines”.


mRNA Covid-19 vaccines: Facts vs Fiction

MARCH 10, 2021

By: Maria Elisa Almeida Goes
Editing: Offspring Magazine Editorial Team
Images: Nina Lautenschläger.

LINK: https://www.phdnet.mpg.de/offspring/Covid-19_vaccines

ARCHIVE: https://archive.fo/irZec


Interestingly, this archive was made only 5 months ago. It was very likely archived by Wikipedia or somebody else who is shilling the false explanation, when faced with the emerging science showing nuclear translocation and genomic incorporation. But it’s perfect for me to preserve evidence.

As an aside, I find it terribly sad that this particular lover of “Max Planck” era scientific history, lived to see one of Planck’s namesake organizations lying about science on a grand scale, but yet here we are.

Let me just pull out the most relevant section. I was planning on highlighting ALL of the lies, fibs, evasions, etc., but there are so many, I decided to only highlight or [comment on] the most horrible and ironic.


mRNA vaccines will not alter your DNA, this is why:

Concerns about the effects mRNA vaccines over the integrity of our DNA also exist. Thankfully, you do not need to worry about this. Such an event would challenge everything scientists know about basic cell biology, and is so improbable, that one can actually call it impossible.

The main reason for that is that, besides being chemically and structurally different from DNA, mRNA is located in a different cellular compartment. While DNA is enclosed in the nucleus, mRNA is produced in the nucleus, but is quickly exported to the cytoplasm with a one-way ticket: it does not come back. In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction. Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.  Additionally, the RNA molecule is charged and carries the same charge as the nucleus, so as our 6th grade physics taught us, like charges repel, and hence the RNA molecule is physically repelled by the nucleus. [Note added by Wolf – WHAT THE HELL???]

One might also argue [HA! You TOADS! Yes, one “might”!] that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example. The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines. [OH, THE IRONY]

For the same reasons, mRNA vaccines cannot affect your unborn children. This would require genomic mutations [oh, really!] in the reproductive cells – sperm and egg – since only these could potentially be transmitted to the next generation. [AND???!!!]

Speaking of children, you might have heard that Covid-19 vaccines would cause infertility in women [why don’t you just stop there, and not go on to one bad hypothesis?] because antibodies against the spike protein could mistakenly attack placenta cells, due to an alleged similarity with a placental protein called syncytin-1. There is no scientific evidence supporting this claim – and, in fact, the two proteins are barely similar, sharing only 4 sequential amino acids out of 538. [This did seem to be a bit of a miss. Nevertheless, what new hypothesis explains all the pregnancy problems?]

Still, you might want to ask why pregnant women are excluded from the vaccination campaigns [wait a minute….not in the US], and why, during clinical trials, women are asked to use contraceptive methods that will avoid pregnancy [because there might be a problem?]. Again, this is not a red flag. Any clinical trial for a potential vaccine or drug will exclude children, pregnant women, old people and people with specific underlying conditions. Initially, trials are designed to obtain major insights whether the developed pharmaceutical product works at all, in healthy adults. Once safety and efficacy are determined [read what you just said before that, where you excluded safety as a motive], tests are expanded to smaller groups that at first were set aside. Excluding pregnant women from trials only shows that trials are being done systematically and following standard protocols. [I’m sorry, but this sounds like happy horseshit, lady.]


Let’s concentrate on the lies most relevant to this discussion. I’ll isolate them and respond to each one.


In fact, only specific proteins carrying “nuclear localization signals” are able to migrate from the cytoplasm into the nucleus, and mRNA vaccines definitely do not include such molecular instruction.

This is EXACTLY what was found with the spike protein that was produced by the full spike mRNA. What a coincidence! See De Marinis for proof that it happens, and Mehedi for WHY. OH – because there’s a nuclear location signal! Was it a “known” one, and if so, who knew it and who didn’t? If some people knew, and others didn’t, wouldn’t that make it like a “zero day” on the nucleus?

Thus, because mRNA cannot spontaneously be trafficked to the nucleus, it cannot modify your DNA sequence.

OH! But isn’t that SO STRANGE that the Mehedi work shows that the spike protein LITERALLY “traffics” the spike protein mRNA into the nucleus? WELL AHHHHH’LLLLL BE! So maybe this explains the nuclear DNA modification that is seen in the De Marinis results. Yes? Maybe? Come on, girl – you’re a scientist at a prestigious institute. Put on your big girl pants and hypothesize with me! You can do it! This is undergraduate, “smart-alec guy in the back of introductory class raises his hand” stuff! And when you were in that class, you thought the same sorts of things but didn’t raise your hand. Maybe it’s time to be brave!

One might also argue that there are mechanisms through which RNA can be integrated into the genome – HIV viruses being the classic example.

This should have been your really big hint, girl. Our local accountant named cthulhu realized that Fauci’s HIV interests and his bat virus interests had remarkable similarities, both in what he himself did, and in what he was studying. “This isn’t Fauci’s first rodeo.” Ask yourself – why was Fauci interested in this? Could it have been the same reason that Doudna was so interested in CRISPR-Cas9? The desire for WRITE PERMISSIONS on the genome?

The key differences here are that such viruses (1) express special enzymes which are able to code DNA back into RNA and (2) can associate with proteins that can traffic them into the nucleus. Neither scenario is applicable to the mRNA vaccines.

Thank you, my lying lady. You have just provided me with a huge clue, by the process of “liar subtraction” – a form of deductive reasoning. We know from De Marinis that genomic incorporation and modification is a fact. We know from Mehedi that “nuclear trafficking” (your point 2) is a fact. This means that it is almost certain that the spike protein ALSO acts as a promoter of reverse transcription (your point 1). You said it – not me. That sure seems convenient, doesn’t it? My question is now – DID YOU KNOW THIS? Were you part of the plot? Or was the person who reminded you of these things part of the plot? Or were we all part of the plot, when I, too, mindlessly parroted the “central dogma” as a defense of mRNA vaccines?

I’m willing to confess that I was wrong. I will admit to my part in promoting the conspiracy. Will you?


But their defenses get worse.

There are now MSM “fact checks” which specifically try to walk back the implications of both the Jaenisch and De Marinis papers, and you can bet there will be similar fact checks on Mehedi’s paper. There has likewise been pressure on those authors to DOWNPLAY the significance of their own works. To me, this is the height of bullshit.


Jaenisch Paper Downplay

Fact Check-Controversial MIT study does not show that mRNA vaccines alter DNA

LINK: https://www.reuters.com/article/factcheck-coronavirus-vaccines-idUSL1N2PK1DC

ARCHIVE: https://archive.fo/vJwBk


De Marinis Paper Downplay:

Swedish study on COVID vaccines and DNA misinterpreted

LINK: https://apnews.com/article/Fact-Check-COVID-Vaccine-Sweden-Study-986569377766

ARCHIVE: https://archive.fo/vJwBk


Rather than take these arguments apart myself, I ask you all to take a first crack at the different techniques used, by clicking the links and observing the UNETHICAL SKEPTICISM. Much of this does not require a science background.

In particular, knowing what we know now, after the Mehedi work, I think it should be very clear how much the media went to bat for the vaccines without honestly questioning the “authorities”.

I will confirm your findings in the comments, and catch any straggler sins of science.

To me, this media mendacity is all simple, stupid, and predictable.

“Nothing to see here!”

Frankly, it changes nothing for me, if any of these authors get talked into walking back their own work, because push-back on critical work is a common phenomenon in the history of science. Not all scientists are capable of weathering the storm. Here are TWO that did. Both got Nobel prizes, by the way.


A classic case, emphasizing a field aversion among an establishment group to a field solution emerging from deductive reasoning, was Van’t Hoff and tetrahedral carbon. Basically, a doctoral candidate in an applied science school had the temerity to take an old hypothesis and revive it as the solution to a very significant current problem. The guy was good – he went on to win a Nobel prize for other work. However, many chemists, especially older ones, rejected the idea, in my opinion by not prioritizing explanatory power over their own abstract philosophical preconceptions. The fact that important people rejected an elegant solution of remarkable utility and truth shows how bad group-think problems can be in science.

Another case was Rick Smalley and C60 (buckminsterfullerene). The linked article accurately describes the initial skepticism that people had for “soccer ball carbon” or “bucky balls”.

The Nature letter describing C60 was attractive and logical, but seeing a line in a mass spectrum did not convince all scientists of the discovery of a new allotrope of carbon. During the period 1985-1990, the Curl/Smalley team at Rice and Kroto at Sussex managed to amass a wide range of circumstantial evidence to support the fullerene structure proposal. Full acceptance came when Wolfgang Krätschmer of the Max Planck Institute for Nuclear Physics in Heidelberg, Germany, and Donald Huffman of the University of Arizona, with their students Konstantinos Fostiropoulos and Lowell Lamb, succeeded in synthesizing C60 in sufficient quantities to allow structural characterization.

I personally remember colleagues assuring me that Smalley was loony, demented, senile, past his prime, or at best something along the lines of “a nice guy, but clearly deluded and obsessed with an error.” The doubt about C60 as reality – particularly as a stable reality – ran thick. And that doubt was WRONG from the very beginning.


Scientists right now are NOT THINKING, and they’re letting the MEDIA push them around.

Scientists are also letting guys like Anthony FAUCI push them around, mainly by the horrible federal grant system, and by the psychology of woke universities, both designed to control science.

And that doesn’t even begin to address other malign interests altering science and medicine in dishonest ways.


Some Actual Speculation – Why Would They Push These Clearly Defective Shots So Hard?

You want some actual “conspiracy theorizing”? Here it is.

Let me go back to my “TLDR” again…..

They didn’t just lie to us about the spike mRNA not going into the nucleus and not changing human DNA – the whole purpose was very likely to do exactly what they did – to open the cell nucleus and keep it open, so that we as a species can start changing population genomics in a huge way, using a variety of technologies.

There are reasons to suspect depopulation as a motive for these vaccines, and both Gail Combs and I have written extensively about this. I continue to believe that this is part of the motivation of the “complex event” we have been undergoing, between virus and vaccine.

Depopulation is very important to these people.

MALTHUSIANS AND EUGENISTS MAKE A CASE FOR POPULATION CONTROL

DEPOPULATION – NEVER LET A CRISIS GO TO WASTE

The Population Control Shot – Introduction

The Population Control Shot – Understanding the Peoples Climate Temple

Likewise, there are many other motives, ranging from mercenary profits, to promoting gene therapy, to “Covid communism”, and beyond. Many of these roads lead back to WEF – the World Economic Forum. One of those roads may be an actual attempt to commit humanity to a future of genetic engineering as a kind of fait accompli.

Just listen to Yuval Noah Harari talk about changing humanity. A few times he talks about “we”, “I”, “me”, “my”, and “our” programs of genetic engineering of humanity. It’s not just creepy and megalomaniacal – it seems quite self-assured.

WEF’s interest in genetic transformation of humanity cannot be understated. You will note in the above video, the presence of Jennifer Doudna – the Nobel laureate who (IMO) was most responsible for pushing CRISPR gene editing technology forward. Here is the full video.

I have discussed the technology recently here:

Dear KMAG: 20230213 Joe Biden Didn’t Win ❀ Open Topic / Introduction to CRISPR/Cas9 Gene Editing Technology

This is a particularly good explanation for those who want to dig into the science a little.

So how does CRISPR-Cas9 connect to the spike protein?

I have mentioned that the spike not only is proven to have nucleus-opening properties and cell nuclear mRNA-trafficking properties, but it likely has reverse-transcribing properties as well. Thus, it may have utility in facilitating certain varieties of genomic incorporation of genetic material beyond its own spike mRNA. I’m leaving that open very broadly. We don’t really know how far the “nuclear translocation of mRNA” capabilities of the spike protein actually go.

But even just the incorporation of its own instructions into the cellular genome, makes the spike protein highly relevant to CRISPR-Cas9 gene editing technology.

We can’t REALLY be sure what happens if the spike protein code gets into egg or sperm DNA, and goes on to be a “feature” of every human cell of a “spike baby”, but I can say one thing – if that gene can be REMOVED during in vitro fertilization (IVF) by CRISPR-Cas9 technology, to the betterment of the child, then it’s very likely going to be demanded by elite parents, to assure a healthy baby.

So – I ask again – WHAT ARE THE CHANCES?

What are the chances, that people who are gung-ho on the “solution” of genetic modification of humanity – you know – like WEF – would have anything to do with releasing a virus and promoting a vaccine that would almost FORCE us into that future?

I think that this era is a lot like the chemical revolution of the late 1800s, precisely when Van ‘t Hoff was dealing with chemical theory. Figures like Malone and Doudna operate in the time of our own biological revolution. Remember Rockefeller, and what he did to science and medicine back during the chemical revolution. Well, now we have Gates and what HE did to science and medicine during the biological revolution.

Personally, I think it’s high time for us to stop taking shit from the corporate media – and particularly the “fact checkers” like Reuters and the AP – as they LIE to our faces about science – as they deny reality on behalf of the corporate titans behind them.

These mRNA vaccines are DEFECTIVE relative to how they were sold to us – very likely by intention – and the media and media organizations have LIED to us about those vaccines in the most scurrilous ways. The media has defended LIES and defrauded all of us.

You don’t have to be FOR or AGAINST gene editing per se, to be against LYING, DEFRAUDING, and FORCING IT ON THE WORLD by a criminal conspiracy.

We need to demand TRUTH about the vaccines, or the SHUTTERING of these “media” companies and organizations, which have cosigned onto crimes against humanity.

Demand no less. TRUTH or BREAK-UP. Media that lies and conceals is USELESS and a hindrance to REAL SCIENCE.

W

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you.


TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic incorporation found for both the virus and the vaccines. The special key and the mRNA shepherding can be considered to be defects in any spike vaccine that has them.

¡Muy explosivo!


Due to comments by WSB and Valerie Curren, I realized that I had to do this post.

Also, NONE of the “bigs” are talking about this, but it is HUGE, if only people will read the paper.

By sheer luck, I was alerted to this new development ASAP on Twitter.

A follower of mine, who I had followed back, posted on Twitter the link to a paper with this title:

Nuclear translocation of spike mRNA and protein is a novel feature of SARS-CoV-2

I immediately realized what this was about.

It’s about how the SARS-CoV-2 (COVID) virus spike protein and its mRNA get into the cell nucleus – an extremely important point which WSB has been hitting on over and over. It’s very important, because THAT is how “genomic incorporation” happens. And genomic incorporation is what HIV does – what retroviruses do. They “get into” the DNA and leave cookies, so to speak.

Sometimes, they leave enough cookies, that the whole virus comes back out, fully functional, and ready to infect. Sometimes, they only leave enough junk in the DNA to cause some damage. Sometimes, they leave enough to change us – and that is why human DNA is filled with “viral leftovers”.

In principle, mRNA technology should NOT do this. We were TOLD that mRNA technology could not do this. But somebody LIED TO US. And not only that – NOBODY – from Bill Gates on down – ever apologized to us about lying, or even about just “being mistaken”.

We’ll get to that later.

You will recall that there are two papers I love to mention.

One is the “Jaenisch paper”, which describes how the SARS-CoV-2 virus manages to get some of its genetic instructions for the spike protein into the DNA of cells.

LINK: https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1

ARCHIVE: https://archive.fo/XWC52


The other is the “De Marinis paper”, which describes how the Pfizer vaccine did the same thing to human liver cells in vitro – meaning that in an experiment using cells in culture, the Pfizer vaccine got its mRNA sequences into the DNA genetic material of human liver cells, and it did so in a matter of minutes.

McCullough got in a lot of trouble with Twitter for posting this, even though it was utterly true. Now we know that the government was trying to shut it down. They likely used the technicality of McCullough’s very VALID speculation (stated as speculation and concern), which turned out to be correct, IMSO.

LINK: https://www.mdpi.com/1467-3045/44/3/73

LINK: https://portal.research.lu.se/en/publications/intracellular-reverse-transcription-of-pfizer-biontech-covid-19-m


These papers explain ALMOST everything. When I saw the Jaenisch paper, I predicted that we would see the De Marinis paper. MEANING – when I saw that the virus could get mRNA into the DNA, I predicted that the vaccine might get its mRNA into the DNA, too. And yes, I was right. Clearly others thought the same thing, and decided to investigate.

Now, after the De Marinis paper, it seemed very obvious to me that one did not need any kind of special conditions or reverse transcription promoters to get the vaccine mRNA to incorporate.

That bothered me, and I suspected, at the time, that MAYBE – just maybe – the spike protein ITSELF was somehow causing genomic incorporation – that it functioned as a kind of reverse transcription promoter.

Well, it sure looks like that is the case.

According to the discoveries revealed in the new paper, which I have taken to calling the “Mehedi paper”, there is a special sequence in the spike protein that acts like a “key to the nucleus” – and this sequence is found in NO other coronavirus spike protein.

LINK: https://www.frontiersin.org/articles/10.3389/fmicb.2023.1073789/full

ARCHIVE: https://archive.fo/kW9Bd

Here is the abstract of the new paper.


Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes severe pathophysiology in vulnerable older populations and appears to be highly pathogenic and more transmissible than other coronaviruses. The spike (S) protein appears to be a major pathogenic factor that contributes to the unique pathogenesis of SARS-CoV-2. Although the S protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.


Let me put that in plainer English.


COVID-19 really hurts old people and seems to be both deadlier and easier to catch than other coronaviruses. The spike protein seems to be why. Although the spike protein is a surface protein that normally would not do this, it might be predicted to get into the cell nucleus because it has a special sequence “PRRARSV,” a known key to the nucleus which appears in no other coronavirus. Sure enough, the COVID spike protein gets into the nucleus of infected cells. What’s more, the mRNA for COVID spike protein also gets into the nucleus. What happens is that the spike mRNA collects near the spike protein, which helps it get in. While a different protein called the “nucleoprotein” of many coronaviruses is known to get into the nucleus of cells, the penetration of the cell nucleus by BOTH the spike protein AND the mRNA for it, seems to be a unique new feature of the SARS-CoV-2 virus.


Once you read it in plain English, it’s much more mind-blowing.

Now – I really recommend that you read the rest of the paper, but it’s really just technical details about what was mentioned in the abstract. Those details can help you gauge the expectedness or unexpectedness of things, but I have tried to do that as best as I could in the translation.

At this point, you should have all kinds of questions.

  • could this defect of the vaccines have been predicted?
  • should it have been predicted?
  • did the Chinese know this when they sent us the sequence?
  • did we know it when we got the sequence?
  • would NOT using the full spike protein have prevented this?
  • if so, why did we use the full spike protein anyway?
  • would the “forbidden” Winfried Stöcker RBD vaccine have avoided this?
  • if so, why was his vaccine suppressed by the German government?
  • does this affect the Peter Hotez vaccine, Corbevax?
  • if not, why didn’t his vaccine get promoted through the process quicker?
  • is nuclear penetration a common problem with mRNA technology?
  • how did this “key” get into the sequence? Naturally or not?
  • could “directed evolution” of the spike have yielded this?
  • why wasn’t this clear from the moment we got the sequence?
  • did people know this and hide the information?
  • were key people like Bill Gates (their side) and Robert Malone (our side) aware of this possibility?

The last question is a gift to WSB and her virologist friend. I am by default a defender of Dr. Malone, but WSB and her friend are long-time skeptics of the technology, and thus of Dr. Malone. In all fairness, I think we have to ask EVERYBODY the same questions.

  • Did people KNOW that mRNA technology had this vulnerability?
  • Does this look any more like an engineered bioweapon, designed to get into the nucleus?
  • Was this thing made by nature, by people, or by somebody with more advanced technology?
  • What is the purpose of getting into the nucleus, if it is designed to do that?

That should be enough. I will leave some links to prior comments I have made, in an appendix, hopefully added later.

Thank you.

W

John Fink and James Coburn discuss case in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

PS – A great interview of our site mascot!

https://thehollywoodinterview.blogspot.com/2008/02/james-coburn-hollywood-interview.html

Dear KMAG: 20220228 Joe Biden Didn’t Win ❀ Open Topic / Microwave Monday / Google Is Now Anti-Science / mRNA Vaccines Really Do Change Your DNA

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.

Get your rest, Trumpy Bear! You’re needed in WASHINGTON, DC!!!

Vladdy Bear and Winnie The Pooh are making Sleepy Creepy Joe look like a punching bag!



The Business At Hand

This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And indeed, it’s Monday…again.

But we’re ON A ROLL.


The Rules

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.

The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Gonna be quick this time.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

After his speech at CPAC, I think it’s quite clear that praying for President Trump’s return to the White House is indeed praying for our enemies, who are too messed up to realize how much better off they would be under a Trump presidency.


MUSICAL INTERLUDE

For your listening enjoyment, and general encouragement, we continue Wheatie’s tradition of fine music videos, shipped fresh from the seas of information by our intrepid authors.

Microwave Monday reminds me of this song from back in the day.

ENJOY!

This right here is the stiffest dose of teased-out 80s chick hair you are EVER going to get.

And if you want to see it with 2008 hair….

And then there’s an outdoorsy 2014 version which has a really great “live” feel…..

But how about a 2021 version with just Susanna Hoffs and a string section?

But if you’re still feeling like it’s all unfamiliar, here’s the original video!

Yeah – that’s more like it!


Call To Battle (H/T Sundance)

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.

…..and now for…..


Microwave Monday

After recent discussion of Havana Syndrome, and the possibility that it involves electromagnetic radiation (and in particular microwaves), I have decided that we all need to LEVEL UP our gut-level understanding of the electromagnetic spectrum – even beyond what Steve has done with his explanation of the science behind it.

This will also help us deal with both the REALITIES and DISINFORMATION of 5G telecom.

I will be doing this by giving you all a bunch of INFOGRAPHICS to get started.

Steve got us started HERE, in his 8th science lesson on LIGHT.

You may remember some of this stuff….. (CLICK TO ENLARGE)

Let’s start breaking up that electromagnetic continuum into REGIONS that have NAMES.

You can see that microwaves lie between RADIO and INFRARED.

Let’s look even more closely at those groups.

We can even start breaking those radio and microwave regions down into BANDS that you are all familiar with.

Here you can start to get a feel for the SIZE OF THE WAVES versus objects and frequencies.

The SIZE OF WAVES and WHAT THEY AFFECT actually matters – although it’s not simple.

Megahertz, gigahertz, teraherz, and petahertz are all there.

You can really see it more easily in the following infographic.

You can easily see how we have made “radio devices” push farther and farther away from the very SAFE “radio” region, through television, mobile phones, and WiFi, closer and closer to the microwave and infrared radiation that constitutes COOKING MICROWAVES and RADIANT HEAT ITSELF.

And as you can see here, many technologies emit electromagnetic radiation – and some more than you may have realized.

So where are the 5G frequencies? Please be aware that there is constant change in this stuff, so that these infographics may be slightly out of date. Do not let that deter you – minor changes don’t NIX any issues of the basic range in which 5G operates, unless specifics of the science are given.

Use COMMON SENSE.

Let’s zoom in a bit.

Note that the above is just the US – other countries use different regions.

Here is more detail on European and US 5G.

Much of this is SQUARELY in the microwave region. From Wikipedia, we’re basically talking 300 MHz to 300 GHz.

Now let’s start looking at ALLEGED but possibly REAL health effects of EMR in the microwave region, which may VARY ACROSS THE REGION.

Remember also that DOSAGE MATTERS – like anything else.

You have to squint to see the next infographic, but look at “Biological Effect”.

It depends strongly on FREQUENCY / WAVELENGTH.

This is a very good listen. This lady is also a climate dupe, but she will get you to realize that your microwave devices may actually be doing to YOUR MEAT what microwaves normally do to YOUR MEAT, albeit at LOWER BUT LONGER DOSAGES.

This is another good one!

More of her schtick. This gal will get you to question the “harmless” narrative, just like vaccines, but try to keep some common sense. Remember – driving is a killer, too. You still want the freedom to drive?

Common sense! How do we get the BEST of both worlds?

Now I’m just going to play a bunch of their infographics. Caveat emptor! But some of this stuff is interesting and counter-intuitive. SIGNAL and NOISE matter. In more ways than one.





SO – maybe you should THINK about how to handle the devices you have!!!

But then talk back to all that stuff HERE.

Be sure to be SKEPTICAL of this SKEPTIC lady – that is an essential part of ETHICAL SKEPTICISM. We don’t want to be panicky about 5G, or believing disinformation, but we do want to treat MICROWAVES as maybe not that awesome for our health, in doses that exceed our individual sensitivity.

So BEWARE of BROAD-BRUSH SKEPTICS who downplay too much in favor of technology.

After all, we just got through a BATTLE ROYALE over disastrous mRNA technology that was advanced too fast for all the wrong reasons.

LINK: https://www.skeptic.com/reading_room/electromagnetic-fields-and-parental-panics/

Finally, a GREAT infographic. It’s MASSIVE. I’m only showing you the small version – you have to click the link for the BIG ONE that’s easy to read down to the details.

MASSIVE EMR Infographic (Thumbnail)

MASSIVE EMR Infographic (Full Version)

LINK: http://www.50northspatial.org/wp-content/uploads/2015/12/EMR_Welch.png

So that’s it. Let’s start investigating 5G, Havana syndrome, spy devices, and microwave crowd control devices, with some intelligent skepticism.

And may be even start thinking about HEADBAND technology.


Google Is Now Anti-Science

Something stinks, and to my nose, it’s the New World Odor.

But first, a disclaimer.

I’m actually ashamed that I wanted to work for Google at one point, but I need to get that out into the open right away, lest somebody, someday, use that “gotcha” against me and think it’s actually damaging.

Heck – I even bought a variety of Google swag, back when they were small and upstarty, just like when Netscape, Firefox, various Linux brands, and other rising tech companies were once “new” and “cool”.

A lot of people once thought that Google’s motto of “Don’t be evil” was a bit of a bass-ackwards under-performer, which should have been a positive, rather than a double-negative. Not me. I realized back then that this paradoxical formulation was exactly why the motto was so ahead of the curve.

“Being good” lacks skepticism – particularly of self. “Being good” as a primary motivator is a guaranteed set-up for the primary sin of PRIDE.

“Not being evil”, in contrast, is automagically skeptical of self. And skepticism isn’t just good for science – it’s good for religion.

Yes – I think it’s clear you need both. This is part of why (IMO) Christianity always refreshes itself by going back to its Jewish roots when there are foundational questions. No matter how you slice it, we need to concern ourselves with the Law, which includes consequential negatives, because we don’t want to get rid of our saving prohibitions.

We need our Peters, but we also need our Pauls.

Thus, when Google ditched “don’t be evil”, I smelled trouble.

And what is happening now, may be evidence that Google has forgotten how to “not be evil”.


Google has made mistake after mistake since they began tampering politically with their search engine, largely during the Obama years, but to an even greater degree during the Trump years. And now, in one short year of Biden – Google has arrived at the point of adopting a policy that conflicts with the most basic principles of science.

Simone Gold, of America’s Frontline Doctors, just tweeted this.

“Nor do we allow content from any site that contradicts or runs contrary to scientific or medical consensus and evidence-based best practices.”

Well THAT’S great. How do you think science is going to advance? YOU CHUMPS!

Let’s just save that tweet, simply to make sure that it doesn’t disappear when Twitter inevitably suspends Dr. Gold.

Note these final words from Dr. Gold.

And we have been proven right, again and again, and again.

Dr. Simone Gold, AFLD

Dr. Gold is not lying. Throughout COVID-19, free and independent doctors and scientists have been LEADING captive science and captive medicine against their BIASED FUNDERS AND CONTROLLERS – which clearly include GOOGLE now.

The “concensus” science has repeatedly and continuously been ABNORMALLY WRONG due to BIAS, and has required continuous correction by – very sadly – OUTSIDERS.

Science does not progress by sticking to consensus. It advances by CHALLENGE TO CONSENSUS. Google is INTERFERING with that process. SHAME!!!


In my opinion, “they” are all scared.

And the reason they’re scared it this.

Now – as insurance companies look around to see who picks up the tab for people dying from the ERRORS OF THE CONSENSUS, it sure ain’t gonna be able to pin it on the people who WARNED about the experimental vaccines.

It may indeed be that some of the blame (moral, even if not monetary) will land on those who CENSORED THE SAVING WARNINGS.

Over and over, people like Google censored us because they said that the things WE SAID were not true, and yet it turned out that the things we said WERE true, and that the consensus THEY said was true, was both WRONG and responsible for MANY DEATHS.

And THIS may be the biggest CENSORED TRUTH of all.


mRNA Vaccines Really Do Change Your DNA

You will notice that this tweet no longer exists.

https://twitter.com/P_McCulloughMD/status/1497284602540351491

It was up for a day, and then it disappeared. I was lucky we had copies up in WordPress.

Here is a “tweetstamp”, that proves that it really did exist.

https://tweetstamp.org/1497284602540351491

Here is the text, where Twitter can’t touch it.


Alden et al, Lund University, Sweden, confirms one of our worst fears. The exogenous genetic material coding for the dangerous Spike protein is reverse-transcribed into the human genome; possible long-term constitutive expression/synthesis of disease promoting/lethal Spike. pic.twitter.com/JEzSwSruWM— Peter McCullough, MD MPH (@P_McCulloughMD) February 25, 2022


Here, I saved an image of a copy which was only partially destroyed by Twitter.

And here I saved the actual tweet (in two pieces).

Here is that image within the tweet, in more detail.

So what is McCullough talking about? And what is Twitter hiding?

THIS SCIENTIFIC PAPER.

LINK: https://www.mdpi.com/1467-3045/44/3/73/htm

ARCHIVE: https://archive.fo/TIfnZ

Open Access Article

Intracellular Reverse Transcription of Pfizer BioNTech COVID-19 mRNA Vaccine BNT162b2 In Vitro in Human Liver Cell Line

by Markus Aldén 1,
Francisko Olofsson Falla 1,
Daowei Yang 1,
Mohammad Barghouth 1,
Cheng Luan 1,
Magnus Rasmussen 2 and
Yang De Marinis 1,*
1Department of Clinical Sciences, Lund University, 20502 Malmö, Sweden
2Infection Medicine, Department of Clinical Sciences, Lund University, 22362 Lund, Sweden
*Author to whom correspondence should be addressed.

Academic Editor: Stephen Malnick
Curr. Issues Mol. Biol. 202244(3), 1115-1126; https://doi.org/10.3390/cimb44030073 (registering DOI)
Received: 18 January 2022 / Revised: 19 February 2022 / Accepted: 23 February 2022 / Published: 25 February 2022
(This article belongs to the Topic Clinical, Translational and Basic Research on Liver Diseases)

Abstract

Preclinical studies of COVID-19 mRNA vaccine BNT162b2, developed by Pfizer and BioNTech, showed reversible hepatic effects in animals that received the BNT162b2 injection. Furthermore, a recent study showed that SARS-CoV-2 RNA can be reverse-transcribed and integrated into the genome of human cells. In this study, we investigated the effect of BNT162b2 on the human liver cell line Huh7 in vitro. Huh7 cells were exposed to BNT162b2, and quantitative PCR was performed on RNA extracted from the cells. We detected high levels of BNT162b2 in Huh7 cells and changes in gene expression of long interspersed nuclear element-1 (LINE-1), which is an endogenous reverse transcriptase. Immunohistochemistry using antibody binding to LINE-1 open reading frame-1 RNA-binding protein (ORFp1) on Huh7 cells treated with BNT162b2 indicated increased nucleus distribution of LINE-1. PCR on genomic DNA of Huh7 cells exposed to BNT162b2 amplified the DNA sequence unique to BNT162b2. Our results indicate a fast up-take of BNT162b2 into human liver cell line Huh7, leading to changes in LINE-1 expression and distribution. We also show that BNT162b2 mRNA is reverse transcribed intracellularly into DNA in as fast as 6 h upon BNT162b2 exposure.

Keywords: COVID-19 mRNA vaccineBNT162b2liverreverse transcriptionLINE-1Huh7


I am going to call this the De Marinis paper, after the lead author, Yang De Marinis, to whom correspondence is to be addressed.

I do this in analogy to a very important COVID-19 paper I refer to as the Jaenisch paper, which bears heavily on this more recent work.

LINK: https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1.full

ARCHIVE: https://archive.fo/XWC52

I have discussed the Jaenisch paper numerous times since I became aware of it in December of 2020, and more importantly in March of 2021.

In fact, in the following blog post I made in April of 2021, I actually hypothesized a scenario which is basically the findings of the De Marinis paper!!!


Wolf’s Red-Hot Date With Retrotranscriptive Faucipox

Alternate Title: Is Persistent Reverse Transcription a Hidden Virus/Vaccine Objective? Gloating Pre-Preface There are few feelings of satisfaction like opening up the NEWS and knowing one’s theories and understandings are WORKING even better than one thought. Let’s see if they use this one for damage control, and get the “new science” out before the STORY …


See also: https://www.theqtree.com/?s=Jaenisch


Now – let me state, in the simplest possible way, what these papers mean.

The Jaenish paper proves that the SARS-CoV-2 (COVID-19) virus alters human DNA.

The De Marinis paper proves that the Pfizer mRNA vaccine also alters human DNA.

Oh, there are quibbles that I’m “oversimplifying”, but they’re just quibbles, and I will show you WHY they are not just quibbles, but extremely disingenuous ones.

And please note that I am UNDERSTATING when I just say “alters DNA”. The Jaenish paper proves that the viral DNA changes are going into GENOMIC DNA. The De Marinis paper strongly suggests that THE SAME may be happening due to the vaccine.

But before I give you MY take on the De Marinis paper, let me give you the opinions of OTHERS.

Let’s review one first.


Peter McCullough:

Alden et al, Lund University, Sweden, confirms one of our worst fears. The exogenous genetic material coding for the dangerous Spike protein is reverse-transcribed into the human genome; possible long-term constitutive expression/synthesis of disease promoting/lethal Spike.


Translation: The pseudo-mRNA code for the spike protein in the Pfizer vaccine gets into the genomic DNA inside human cells in test tube experiments, and produces both DNA and mRNA coding for what was uniquely in the vaccine. This new cellular DNA and RNA very likely (as a consequence) produces spike protein, causing long-term disease and health issues.

One can legitimately contest the assertion that genomic DNA is being altered (we don’t know this yet – hopefully soon), but any denial of the fact that CELLULAR DNA is being changed, is simply not “fact-based”.

For example, I saw “downplay trolls” on the original McCullough tweet, quibbling about in vivo vs. in vitro – that these results don’t “prove” that the same thing happens in living humans – only in living human cells in a test tube.

The reason this is a hypocritical crock of shit, is that “due to an abundance of caution”, almost every single “carcinogen” and other “bad boy chemical” that is restricted or controlled in the United States, at the cost of trillions of dollars which go into the pockets of the deep state and China, is because of IN VITRO results.

Thus, if it’s OK to have vaccines that do what Pfizer’s vaccine does, then it’s OK to remove the restrictions on benzene, and have benzene everywhere. Likewise for thousands of other chemicals.

Starting to see how this works? Let’s move on.


Alex Berenson:

Hey, remember how they told you the mRNA in the vaccines could NEVER wind up in human DNA? A new study out of Sweden suggests otherwise (at least in lab-grown cells).

Don’t worry, everything is fine.

After all, we have all that long-term placebo-controlled clinical trial data proving the safety of these mRNA shots.*

All that careful preclinical work too.**

*No we don’t.

**Not that either.


Karl Denninger:

LINK: https://market-ticker.org/akcs-www?post=245270

ARCHIVE: https://archive.fo/RpDoE

So About Not Needing Actual Study…[Comments enabled]

Oh, mRNA won’t get taken up into cell lines and thus can’t propagate on a permanent basis in the human body, we were told.

Indeed that’s rather important.  Mutagenic (cancer), cytotoxic (you’re ****ed) and teratogenic (any child you give birth to or sire is ****ed) things that get into cellular DNA can lead to irreversible damage because most cells in the body are replaced on regular basis.

There’s an infamous quote that is in fact wrong: Our body fully replaces itself every seven years.  That’s not true.  It came out of a study that looked at the average age of cells in a human, using Carbon-14 dating.  Anyone who has done any sort of statistical work knows the problem with averages: They are just that, and the statistical outliers are there but unaccounted for with such simplistic tripe.

There are several types of cells that are never replaced.  Certain ones in the cerebellum, for example, that deal with coordination and balance, those in the ocular lenses and the eggs in a woman’s ovaries.

There are also cells that are much more-frequently replaced.  Red blood cells, for example, have a roughly 90 day life cycle.  This is why an A1c test, which measures glycated hemoglobin (that is, red cells that have been damaged by glucose) will tell you what your average blood glucose level has been over the last three months.  The epithelial cells in your intestines last only about five days, and the live (dermal) part of your skin is replaced in about 2 weeks.  Skeletal muscle and the rest of your intestines, on the other hand, are good for around 15 years.

But with few exceptions it is indeed true that most cells are in fact replaced.  This is why you can get cancer; when there is an error in that replication the result can be a cell that has wildly damaged regulatory mechanisms on self-replication.  If that damage kills the cell immediately then there’s no real foul, but if it leads to much more rapid reproduction…… that’s cancer.

We have known for quite a while that viruses can and do in some cases infiltrate into DNA.  We know this because we’ve found pieces of viral RNA in our genome and not a few of them either; they’re literally all over the human genomic code.  It’s wildly improbable that said congruence happened by random alignment of the various codons in our genetic code; ergo, it got in there at some point in evolution and then got into either the eggs of a developing female fetus or the sperm of a male and thus propagated.  We only know, of course, about the integrations that weren’t fatal to offspring or the person in question.  We also know that in general genetic mutation is harmful or fatal nearly all the time, so that we have said evidence in our genome means this sort of thing happens quite frequently and most of the time it screws the person who has it happen to them.

Indeed some cancers are blamed on viral infections where the viral RNA gets transcribed into the DNA of the cells and causes said errors.

mRNA is not really “new” technology; Moderna has been trying to make it work for cancer, for example, for a long time — without success.  The reason for failure has always been dose-related toxicity that has overtaken the benefit when used in sufficient quantity to actually deliver a therapeutic effect.  This is not an uncommon reason for drug and therapy failure; in fact that too happens all the time.

But we didn’t bother doing intermediate and longer-term study on the specifics of using mRNA (or, for that matter, a modified virus as with J&J) to deliver a partial viral payload in this regard before rolling it out.  Instead, we just trusted that there’d be no integration.  Indeed zero epigenic, mutagenic and teratogenic studies were done;they take years to do and we just flat-out didn’t bother.  Where we had original control groups in the summer and fall of 2020 we intentionally destroyed them by giving the placebo arm of the original trials the drug three months later, making analysis on any sort of clean analytical basis impossible.

This was wild arrogance given that we know viruses do indeed integrate via infection.  To presume it won’t happen here, when we cause cells to produce viral proteins, when the very same thing, producing viruses when a cell is infected, sometimes does is ridiculously and wildly-irresponsible arrogance.

Unfortunately now we’re finding out that said arrogance may well screw you and if it has there’s nothing you can do about it — and worse, could screw your offspring.

In the BNT162b2 toxicity report, no genotoxicity nor carcinogenicity studies have been provided [26]. Our study shows that BNT162b2 can be reverse transcribed to DNA in liver cell line Huh7, and this may give rise to the concern if BNT162b2-derived DNA may be integrated into the host genome and affect the integrity of genomic DNA, which may potentially mediate genotoxic side effects. At this stage, we do not know if DNA reverse transcribed from BNT162b2 is integrated into the cell genome.

This study does not prove that said genetic pollution has occurred, but it raises the distinct possibility as the precursor events required for this to occur are now known to happen with scientific certainty.

We don’t know because we deliberately did not look; the studies were not done prior to use.

MORE: https://market-ticker.org/akcs-www?post=245270


I think I’ve given you enough to chew on for now.

The bottom line is this:

The Jaenisch paper was concerning smoke.

The De Marinis paper is a four-alarm FIRE.

Please warn everybody who is even THINKING about giving an mRNA vaccine to kids.

SET THESE VACCINES ASIDE until we know more. Even spike protein vaccines are too risky, IMO. Set them all aside.

And NEVER, EVER, EVER AGAIN, mandate another vaccine. This was our wake-up call.

Soon, we will talk about the BIG PICTURE of what is going on here.


Wolfie’s Wheatie’s Word of the Day:

genome

noun

In the fields of molecular biology and genetics, a genome is all genetic information of an organism.[1] It consists of nucleotide sequences of DNA (or RNA in RNA viruses). The genome includes both the genes (the coding regions) and the noncoding DNA,[2] as well as mitochondrial DNA[3] and chloroplast DNA. The study of the genome is called genomics. The genomes of several organisms have been sequenced and genes analyzed. The human genome project which sequenced the entire genome for Homo sapiens was successfully completed in April 2003.

genomic DNA

Genomic deoxyribonucleic acid (abbreviated as gDNA[1]) is chromosomal DNA, in contrast to extra-chromosomal DNAs like plasmids. Most organisms have the same genomic DNA in every cell; however, only certain genes are active in each cell to allow for cell function and differentiation within the body.[2]

The genome of an organism (encoded by the genomic DNA) is the (biological) information of heredity which is passed from one generation of organism to the next. That genome is transcribed to produce various RNAs, which are necessary for the function of the organism. Precursor mRNA (pre-mRNA) is transcribed by RNA polymerase II in the nucleus. pre-mRNA is then processed by splicing to remove introns, leaving the exons in the mature messenger RNA (mRNA). Additional processing includes the addition of a 5′ cap and a poly(A) tail to the pre-mRNA. The mature mRNA may then be transported to the cytosol and translated by the ribosome into a protein. Other types of RNA include ribosomal RNA (rRNA) and transfer RNA (tRNA). These types are transcribed by RNA polymerase II and RNA polymerase III, respectively, and are essential for protein synthesis. However 5s rRNA is the only rRNA which is transcribed by RNA Polymerase III.[3]

Used in a sentence:

While we tend to be more concerned about changes to genomic DNA, changes to any kind of human DNA are potentially problematic.

Used in a picture:

Used in a video:

OK – I think that’s enough geekiness for now.

That’s all, folks!


ENJOY THE SHOW

Have another great week!

W

Weffen SS Demands Our “Bloody” Papers – But What Are They Looking For?

This is a response to an interesting post by Sundance over at CTH. Please read that FIRST.


LINK: https://theconservativetreehouse.com/blog/2021/10/16/did-klaus-schwab-and-world-economic-forum-admit-the-covid-vaccine-injects-traceable-markers-their-promoted-covid-pass-blood-test-requires-them/

MORE: https://theconservativetreehouse.com/blog/2021/10/16/did-klaus-schwab-and-world-economic-forum-admit-the-covid-vaccine-injects-traceable-markers-their-promoted-covid-pass-blood-test-requires-them/


It’s important that you read what Sundance says AFTER the video.

The following line is critical:

The entire premise of the World Economic Forum’s “COVIDPass” is predicated on a blood test being able to identify whether a person has been vaccinated or not.

However – IMO – that is not what is actually being called for.

To see this, you need to go back to the video, and also read the WEFFEN SS article:

LINK: https://www.weforum.org/agenda/2020/07/covid-19-passport-app-health-travel-covidpass-quarantine-event/

Here is the key frame of the video:

You can also read the details in the article:

A possible solution

CovidPass is the brainchild of one of the World Economic Forum’s Young Global Leaders, Mustapha Mokass. It also involves other YGLs across 5 continents, including Muna AbuSulayman and Peggy Liu. CovidPass uses blockchain technology to store encrypted data from individual blood tests, allowing users to prove that they have tested negative for COVID-19.

Unlike contact tracing apps, CovidPass will not track users’ movements. Non-mandatory contact tracing apps have met with only limited success so far due to privacy concerns.

Germany, regarded as one of the most successful nations in rolling out a voluntary app, currently has only 16 million users out of 83 million citizens. Experts say at least half the population needs to use a contact tracing app to make it effective in fighting the virus.

Meanwhile, governments are faced with a variety of different testing regimes to validate the health of travellers. “This isn’t enough to reassure tourists or health authorities”, says Mokass.

Mokass hopes his app, which is launching in September, will become a standardized solution for airlines, airports and border agencies, and eliminate quarantine for healthy travellers. CovidPass could also allow hotels, cinemas, theatres, sporting and concert venues to reopen safely.

Another possible use would be to help restart the worldwide conference and exhibition industry, which has contracted by 60%, at a cost of $180 billion in lost revenues and impacting 1.9 million jobs, according to the industry’s global association, UFI.

CovidPass commits to mandatory carbon offsetting for each flight passenger, to preserve the environmental benefits of reduced air travel during the crisis.

And here is the critical sentence:

CovidPass uses blockchain technology to store encrypted data from individual blood tests, allowing users to prove that they have tested negative for COVID-19.


First of all, it’s important to understand that these “Young Global Leaders”, like the guy who proposed this idea, are just pawns. They’re dupes – chumps – smart young knuckleheads who will be heavily brainwashed, including MK tech, to be future BOTS. The idea that “Mustapha” is suggesting may have even been the result of mental suggestion to HIM.

My little corner of the swamp used to create “Future Leaders” just like this, and it was very painful to realize that the “honor” these kids were being given was basically a future of ESTABLISHMENT SLAVERY. And there is no way to warn these kids – they would never believe they are being cut out and set up – not in a thousand years.

All that said, it’s important (IMO) to realize that – as long as COVIDPass is just testing for VIRUS – it’s actually a VERY cunning idea. It’s CUNNING, because it RELIEVES the conflict between vaccinated and unvaccinated.

I repeat.

This solution is NOT about testing for vaccine – it’s about testing for NO VIRUS. Which means the NON-VAXXED can FLY AGAIN.

CAN IT BE GAMED? CAN IT BE RIGGED? CAN IT ALSO TEST FOR VACCINE MARKERS?

Is the Pope a Communist? Of course. It is DESIGNED to be rigged. This actually puts GLOBAL LEGS on the scam that Political Moonshine spotted with PCR and CDC.

But it’s EVEN MORE, because it tests and follows the UNVACCINATED.

This is a way to control ALL HUMAN MOVEMENT (that they want to control – hint, hint) of both the vaccinated AND the unvaccinated, and it’s designed to BOTHER fewer people than requiring vaccination.

We have ALL been getting blood draws – right? That’s not putting something INTO our bodies – it’s taking something OUT. Fewer people are concerned with a blood draw to travel internationally – that’s not a problem for most people.

This is all really brilliant.

They take away the masks.

They take away the lockdowns.

They take away the quarantines.

They EVEN take away the vaccines, for those who don’t want them, can’t have them, etc.

Instead, they just require periodic blood draws, allegedly to prove that you don’t have the virus they released.

Notice how they tie in all this climate BS here as well. This is TOTAL CONTROL on international travel – maybe even national travel.

They will likely use highly manipulable PCR for the tests – in any case – YOU have no say in the test result.

Just like Mike DeWine could not meet with Trump, because of a bad test which I’m certain was RIGGED, so you can be sure that the Lauren Southerns, James O’Keefes, Sidney Powells, Tommy Robinsons, and Wolf Moons of the world, are going to get false positives right before traveling to “inconvenient” destinations or events.

And THIS is very important, too.

Whatever they are putting in the vaccines? They can TEST YOUR BLOOD to look for whatever they need or want to look for.

So I am NOT saying that Sundance isn’t right about his suspicions with marked vaccines. I am SURE that marking vaccines ARE one of the HIGHEST goals, if not THE HIGHEST goal, on their little list of such things. Knowing the lot numbers of the vaccines, they can run all sorts of experiments on us. This is the PERFECT opportunity for them to pull such crap.

But I think this scam is EVEN BIGGER. Complete control of movement and networking in “meatspace”, using the phony PCR tests “as needed”. PLUS they get your DNA. My DNA. ALL of our DNA.

Can the WEFFEN SS pull this off?

I think they are STILL interested in TOTAL CONTROL.

I’m interested in your take as well!

W

Proud Event 201 Sponsors

No New Bioweapon Under The Sun

OK – we’re going to have some fun here – but stick with me, and you could learn A LOT.

Cue the music! Borrowed from Wheatie!

Previous posts helped put both the SPIKE PROTEIN DISEASE and the SPIKE PROTEIN VACCINE into deep perspective.

We were seeing that the SOLUTION was a significant part of the PROBLEM, and that CDC was engaged in LYING, BLAME-SHIFTING, and HIDDEN AGENDAS.

And now the SCIENCE is coming out, and we were RIGHT.

We’re WINNING.

Another post discussed how – for whatever reasons are quietly embedded upon the length of the full spike protein and fragments thereof, chimeric or not – we are also now cursed with what appears to be, to some [currently socially tolerable] extent, an abortion virus and abortion vaccines.

Trust me – THAT is a trumpet that BRINGS DOWN WALLS.

We may even have a scientifically sound explanation for the craziest reports of vaccine side effects in the close but unvaccinated – namely, hormonal activities that are operating at the low microgram level.

Oxytocin – abortion dose = 10-30 IU = 16-50 mcg


Let me explain how that works. Think “DUST”.

I can tell you all about the potency of carfentanil. ONE BREATH of inhaled dust containing a tiny amount of it knocked me out like a roundhouse to the left jaw. If that ENTIRE DUST had been carfentanil, I would have been DEAD. But there was a fraction – a tiny fraction – of that tiny grain you see right there, that got into my lungs, riding on OTHER DUST, and I was OUT LIKE A LIGHT.

NOW you understand the POWER of the spike protein.

Yes, there is SO MUCH that they HIDE FROM US to maintain POWER OVER US.

However, now I want to put ALL of this virology technology into DEEP PERSPECTIVE.

“Black goo” biological agent in the movie Prometheus, part of the “Alien” franchise.

What I am going to tell you is almost certain to shock you – both about the disease and about the vaccine. It shocked me. That’s why I figured I had to explain this to people.

And what’s even WEIRDER – this is not totally about the disease or the vaccines, but also about their CONTEXT, which forces you to SEE them both differently and more CLEARLY.

A while back, I was just browsing the “edutainment” about viruses on the internet, when I was led down an interesting rabbit hole of viruses in entomology. You know – INSECTS. I read something on Wikipedia which bothered me, so I set it aside. It all seemed FAR too familiar. It surely impacted all this crap we’re going through now – I just wasn’t sure how. Later I came back and read it again.

Now, I understand. It’s actually rather beautiful. But – well – it’s interesting.

The greatest point being – THERE IS NOTHING NEW UNDER THE SUN.

The great irony of the idea “nothing new under the sun” is the self-referential part – the idea that EVEN this little bit of wisdom is with certainty not even attributable to its first alleged “author”, who HIMSELF surely understood the great irony of his saying it, and that others might attribute it to him, someday.

Nothing new under the sun. This bit of Solomonian passed-on wisdom about the curation rather than creation of wisdom is far truer than I realized. Let’s EXPAND just a bit.

The idea that this universe is as old as it appears to be, and that in all that time, Einstein was the first person (using the term rather broadly) to discover the logic of how speed actually works, strikes me as a violation of Solomon’s logic about “first discovery” being rare as hen’s teeth.

Likewise, Solomon’s logic goes further and tells me that “hen’s teeth” undoubtedly happened a lot more often than, when in its earthly rarity, it happened “here and almost now”, but seemingly only roughly once.

Rarity being somewhat relative, with distance providing a deceptive but effective cover for number and frequency, all of them together being a control of wisdom over knowledge.

Yet even these seeming corollaries of the idea of “nothing new under the sun” are just repeats of the idea with some frill on the edges enlightened for our benefit.

“…it is curiosity that gives meaning and savour to life.”

LIFE. Seems to be part of the design. No?

Have I BOTHERED you yet?

Maybe even a bit of trepidation – or even FEAR?

Good. THAT has happened before. “Nothing new under the sun.”

You can never go wrong with Solomon.



The Last Time Gene Therapy Was Reinvented

I keep trying to tell people – DNA is very smart. We are slowly learning how to talk to it. Sometimes we actually listen. Sometimes we even plagiarize.

DNA bargains and wheedles its way into the future, changing in whatever ways it has to, to keep itself alive. It gains as much vision of the future and the past that it can, using proteins, to persist as well as it can.

Think of it this way. DNA fights and feuds with DNA, but who wins in the end?

DNA.

NOTHING that these foolish young humans are trying to do with their coronaviruses, their “vaccines”, and their “gene therapy” is new to DNA. DNA came up with ALL of this stuff – AGAIN – at least 100 million years ago. THAT was its destiny. Ironically repeating like its own form.

I am absolutely serious. The technology of EVERY one of our wonderful new coronavirus vaccines (or “injections” or “gene therapies”, if you prefer) was RE-invented by DNA approximately 70-100 million years ago on this planet, and is still around.

ONE example of a prior reinvention of gene therapy resides in a tiny biological war-game where THREE organisms cut a deal that keeps them all alive. I will point out all of the “original versions” to you, and you will see where human science basically plagiarized.

One of the three organisms is an insect – a kind of wasp – that gravitated into using a living host for reliable reproduction. The second is a voracious plant-predatory host insect – a caterpillar – that needs a dependent predator to keep its numbers in steady balance, because it won’t do it itself. The third is a virus that found a way to survive by helping insure that the host-guest “life transfer” process always succeeded, so that it, too, would survive.

DNA uses ALL OF THEM to optimally persist.

The key to understanding all of this, is a kind of virus called a “polydnavirus”. I personally like to pronounce that “Poe-LID-na-virus”, even though that is wrong. They’re actually supposed to be called “Polly-D-N-A-virus”. My advice is pick whatever you like – you’re probably never going to have to say the word publicly – and on the internet, your canine pronunciation is always perfect.

Or just call them PDVs.

Wikipedia’s entry for them is an excellent place to start.

LINK: https://en.wikipedia.org/wiki/Polydnavirus

ARCHIVE: https://archive.fo/YHP7V

The bottom line is very simple. The wasp lays its eggs INSIDE a caterpillar by injection. However, instead of injecting a mere venom along with the egg – a kind of chemical weapon – the wasp injects a venom containing a VIRUS – a biological weapon. The virus provides biological effects like immune suppression that HELP the wasp egg survive, hatch, and grow. This is much more efficient than merely injecting, say, immunosuppressive proteins in the venom. The immune suppression by the virus prevents immune response by caterpillar cells known as hemocytes.

All of that is shown in the following graphic.

Here is one of the first really fascinating aspects of these polydnaviruses. When they are in the wasp, they are actually PART of the wasp genome. That’s right. They’re IN THE WASP’S CHROMOSOMES. The virus is now PART of the wasp’s genetics. One could even view it as the wasp sending PART OF ITS OWN GENES into the host, to make sure that the egg survives.

When the virus is still inside the wasp, it only comes out of the genes and reproduces in one place, in FEMALE wasps, near where the eggs are formed. It doesn’t harm the wasp, because DNA is NOT stupid. Viral DNA learned – the hard way – don’t shoot the pilot. Just stay in your seat until it’s time to debark. Wasp DNA learned – the hard way – let the jihadists sleep until we get to the airport we want them to shoot up. All of it mediated through the most annoying code in the world, with zero comments and nearly inscrutable, almost accidental language.

You remember those “well, it works” phone calls, coders. “I don’t know. Try this.”

Now – the next point is even cooler – because it’s the exact same strategy as the coronavirus vaccines that use viral vectors (e.g., Johnson+Johnson, Oxford/AstraZeneca, Sputnik V).

The infection does not lead to replication of new viruses, rather it affects the caterpillar’s immune system, as the virion carries virulence genes instead of viral replication genes.[4] They can be considered a type of viral vectors.[5]

Wikipedia, https://en.wikipedia.org/wiki/Polydnavirus#Biology

The virus particles that are sent into the caterpillar are NOT reproductive – they are merely infective. They don’t code for creation of new virus, which might reproduce exponentially and kill the host or use up too many resources. Instead, the infective non-reproductive virus particles – just like the coronavirus vaccines – give a nice, predictable amount of expression of new proteins, useful for the wasp eggs and larvae to prosper. The virus basically CONSERVES caterpillar so that it has a ticket and a ride OUT of the dead caterpillar when it’s all over.

That’s the EXACT same strategy as our mRNA and DNA vaccines. Don’t crank out too much spike protein, by cranking out any new virus, and thereby kill the host. The main point is SAVING the host. The point may also be STERILIZING the host, to some extent, because THAT protein effect is beneficial to the injecting parasites known as the Democrat Party, globalist banks, and China. And probably more than one type of pencilneck. But they do want us to live – at least for some time, it would appear.

But seriously – the wasp polydnavirus immunosuppression strategy IS the human adenovirus vaccination strategy.

The only difference is what the proteins that are created DO. In the caterpillar, they suppress the immune system response to the egg or larva. In humans, the one protein stimulates antibodies to itself, and possibly does other things which are intended or not.

So you may be wondering how the virus gets from parent wasp to child wasp if the virus that is sent into the caterpillar host is not reproductive. AHA. It is because the virus is tucked into the GENOME of the baby wasp, safe and sound, for a ride into the future. The virus genome is essentially protected by the wasp.

LINK: https://www.microbiologyresearch.org/content/journal/jgv/10.1099/0022-1317-77-11-2873

Thus, you can see how genetic incorporation of the VIRUS benefits BOTH the wasp and the virus – and even – in a weird way – the caterpillar. The wasp gets to control the genetics and expression of the virus, so that they don’t cause the wasp too much trouble, but instead yield maximum benefit. The virus can then be more effective at its now exclusively delegated task of immune suppression in the caterpillar, by relinquishing reproduction to the wasp. Division of labor creates a great mutual dependency, but it also creates a strong contract.

One could say that genetic incorporation is a STRONGER CONTRACT between the virus and the wasp.

Just like genetic incorporation of COVID-19 spike protein could be a STRONGER CONTRACT of reduced human fertility.

But how does the caterpillar benefit?

The caterpillar is not going to live on as THAT particular caterpillar, but THAT particular baby caterpillar-culling wasp will live on in an assured 1:1 trade-off, and the REST of the caterpillars which benefit by the current culling will also live on as a stable population. The C-W-V balance is maintained BETTER by seeking a more stable chaotic resonance, without the wild swings of boom and bust, if wasp reproduction and population can be more closely tied to the caterpillar population, and they all live into the future without wild swings in numbers.

Another way to view it from the caterpillar perspective, is that viral efficiency minimizes the number of sacrificial caterpillars needed to keep the necessary number of wasps alive.

Now – we’ve seen viral vector vaccines analogous to the non-reproductive but infective polydnavirus virus particles – those would be the Johnson-+Johnson, AstraZeneca, and Sputnik V vaccines, which use adenoviral vectors for non-reproducing, protein-creating, virus DNA. But what about the Pfizer and Moderna vaccines?

Well, it turns out that these {{{wasps + viruses}}} invented ANOTHER way to get DNA or RNA into the caterpillar host – those are called VLP, for “virus-like particles”. There is a lot of range and variability here, just as there is in non-viral-vector vaccine technology. So in the same way that the Pfizer, Moderna and Inovio vaccines use proprietary “virus-like lipid droplet nanotechnology” to get their mRNA or DNA into human cells and thus cranking out spike protein, wasp/virus DNA can also use a strategy of “virus-like particles” that don’t even mimic non-working viruses, and STILL get their effective DNA transferred to the caterpillar, to effect the desired expression of needed wasp/virus proteins in the caterpillar.

Now – that is not to say that PDV (polydnaviruses) and VLP (virus-like particles) are the only tricks up the ovipositors of these parasitic wasps. It turns out that – in addition to these well-described DNA viruses, there are also apparently RNA viruses which ride along with wasp eggs during injection. So YES – both DNA and RNA “vaccines” are part of the wasp injections. And YES – there can be genetic incorporation in the caterpillar cells – for their short lifespan – just as there is already genetic incorporation, long-term, in the wasps.

Remember – who wins? DNA WINS. The HOUSE always wins.

But don’t forget Novavax! It may just be protein, but protein shills for DNA!

Not only are the Novavax “pseudo-viral protein-based nanoparticles” already examples of virus-like particles – they are matched by protein-based components of the wasp venom, both free-floating or otherwise. Indeed, one cannot read about the virus-like spiked particles in this wasp venom and not think that Novavax design is pretty much the same thing.

NOW – this is all a LOT to unpack. Not just that, but my “dumbing it down” probably made it just plain dumber. To correct that, I’m going to let the experts FIX THINGS UP.

The field of polydnaviruses in insects is NOT a huge field. It’s actually rather obscure, despite the phenomenal importance we are witnessing now. Just as the media can help those in power hype and control a field like climate science, or literally HIDE certain other fields like [[[ COUGH ]]], they can obscure still other fields which radically affect you, by hiding them pretty much in plain sight.

There is a BOOK that reviews the field, however, which is EXTREMELY helpful.

You can download parts of this book, and that includes TWO parts which are more than enough for a reasonably smart normal person to see the CONTEXT EXPLAINED.

Let me get ONE of those parts out of the way because you’re not going to be interested in this, unless you’re ready to get VERY nerdy on the history of science. But I am including it because it is AMAZING STUFF. You might view this as “The history of the science of the rediscovery of all the evolutionarily discovered technology used in the “vaccines” or “shots” or “gene therapy” of the coronavirus genetic injections”. It’s a beautiful window into HOW SCIENCE WORKS.

Foreword – The Discovery of Polydnaviruses and the Influence of Dr. George Salt

You can download a PDF of this at the linked page.

Now – if you read that – you will get a LOT, including a window into the slow and painful nature of research, but it’s a bit difficult to extract the good stuff if you’re not used to reading scientific review literature.

In contrast, the PREFACE of the book is MUCH easier to read, and it puts ALL this stuff in context that normal humans who are not experts in polydnaviruses can understand.

Preface – Parasitoid Viruses – Symbionts and Pathogens

I highly encourage you to read the full preface at the linked page. But what I’m going to do here is simply pull out all kinds of juicy quotes – which is damn near the whole thing. [ My comments ] and identified WOW sequences will be in bold.

Here we go – this is all quoting:


Among parasitoid viruses, the fascinating models of polydnaviruses (PDVs) were discovered in the 1970s and the new field of polydnavirology was thus opened.

This field has been moving very fast since the beginning of the century thanks to the use of genomic approaches and rapid expansion of accessible databases on insect and viral gene sequences.

Parasitoid and viral genomic studies have confirmed that PDVs are functionally gene transfer agents used by parasitoid wasps to manipulate the physiology of their parasitized lepidopteran hosts by introducing modified versions of their own genes into host cells.

In the case of PDVs from braconid wasps, this kind of gene therapy (detrimental for the patient, which is in this case the lepidopteran host!) originated from the integration of a virus genome in a wasp genome ca. 100 million years ago. [LOL – I just noticed this “being impressed by the date” part – looks like we BOTH realized this independently. -Wolf]

This virus has been modified to incorporate wasp genes instead of its own viral genome in the nucleocapsids inside the viral particles. [Minor beef here – ownership and original genetic penmanship on the payload could be more “virus” and less “wasp” – interesting problem.]

Such use of viruses as vectors has been selected several times independently during the evolution of parasitoid wasps. [There it is. VIRAL VECTORS. Invented by DNA.]

The PDVs associated with braconid and ichneumonid wasps (Campopleginae subfamily) are unrelated as judged from the machinery producing the particles, and they represent an example of convergent evolution with different viral origins.

A third association event is suspected to have occurred in the Banchinae subfamily of ichneumonid wasps. In essence, the parasitoids have ‘captured’ viral elements that have evolved a host regulatory role that benefits the parasitoid to facilitate successful parasitism. [This is more “archaeopteryx” on the payload being of viral origin.]

Other associations with viruses or virus-like particles might have evolved with different organisms but they have not been unraveled yet, and parasitic amoebae that have associations with mammalian viruses are just one example. [“Lots of room at the bottom.”]

Many insects have evolved associations with a large number of species of bacteria such as Wolbachia and associations with viruses have been less well studied to date compared to bacterial symbionts.

A number of different viruses are found in the genital tract of the parasitoid wasps and conceivably they could be transferred to female wasps by behavioral traits, such as host feeding, initiated following ovipositor puncture of the surface of the integument.

Host feeding may thus be an advantageous behavior for viruses which facilitates their spread within insect populations and this intimate association with viruses might have favored interactions leading in some cases to integration of viral sequences into the wasp genome, although most of the wasps described in this book are no longer host feeders.

These viruses include RNA viruses of insect parasitoids and most of them appear nonpathogenic. Could these likewise have evolved a symbiotic relationship with their host? Future research may reveal such an intimate relationship with the wasp host carrying them but, currently, we have little information about their functional role as symbionts or pathogens in the virus–wasp–insect host relationship. [This was in 2012 – the situation could be different now.]

While the study of polydnaviruses was initially inspired by the pioneering studies of George Salt and Susan Rotheram at Cambridge University, more recent studies of Venturia (formerly Nemeritis) canescens particles (the virus-like agent studied by George Salt) by Otto Schmidt and Sassan Asgari documented that these virus-like virions lack both DNA and RNA; the particles are comprised of proteins encoded by parasitoid genes. [This is basically virus-like particle nanotechnology akin to the Novavax vaccine.]

The multiplicity of different molecular forms seen in these viruses and virus-like particles is truly amazing but, compared to polydnaviruses, we have less information about the biology of virus-like particles and how they function. [There is clearly an infinitude of possibility here – clearly WHY the push for gene therapy.]

Finally, not all parasitoid species are associated with viruses and most in this category have to rely on virulence factors produced by their ovaries and venom glands instead of using the host to produce them like for PDV-encoded gene products. [Translation – most of the wasps use plain old venom.]

PDV-associated species also produce venom that was shown in some cases to synergize the effect of the virus. [Combination biological and chemical weaponry.]

New sequencing approaches are more comprehensive and will thus allow comparisons of the arsenal of proteins used in different species, which will enhance our understanding of the dynamics of evolution of parasitoid virulence strategies. [Big data will allow spying on the past to happen even faster.]

Ectoparasitic wasps have not been examined yet for the presence of viral symbionts, and appear to have exploited venoms as a source of host regulatory molecules instead. Comparative studies on paralyzing versus nonparalytic venoms are lacking, and screening ectoparasitic species for viral elements should also be a future research priority. [Translation: there’s more to learn from regular stinging / paralyzing wasps.]

In addition to enhancing our knowledge of parasitoid strategies and increasing our understanding of the importance of symbiotic relationships in species evolution, parasitoid viruses and venoms may constitute a source of new molecules to control insect pests. This might be a revolutionary outcome of research on PDVs and other parasitoid viruses, since the safety of many chemical pesticides with respect to their detrimental impacts on human health and key species in the environment such as bees and other beneficial insects, is questioned. [You think proteins are going to be safer? HA! Get ready for new problems.] We anticipate that harvesting biopesticidal molecules from parasitoid venoms will likewise prove fruitful. [Translation: All this human wasp techno coronavirus lying crap is headed to agriculture, and presumably already there. Yeah.]

Finally, we hope that this book will satisfy the reader by presenting an overview of the most recent findings on all these topics presented by an international assemblage of authors. [You can say that again!]

In addition, we aim to inspire many future researchers to choose polydnavirology or studies of other parasitoid viruses or viral-like elements and venoms as their focus field. [You’ve inspired me, even though it’s a bit late for me to enroll in one more Marxist university.]


That’s it.

I tell you – this whole thing was a revelation. Suddenly, everything these people in Big Pharma have been doing has been HUMBLED BY GOD, using BUGS. LOL! Pretty amazing.

And being humbled, all of us, the TRUTH now becomes clear.

Now – if all this seems a bit scary, but you’re thinking “Hey, this isn’t exactly like our case, in which Democrats mind-fracked their victims with an RNA virus” – well, HOLD YOUR BEERS. With God – IRONICALLY – all things are possible.

Yes, this, too – baffling the victim with an RNA virus – was borrowed from nature, although I am being just a wee bit facetious, since it was done much more intelligently and much more socially against a more intelligent and social species.


The Case of the Shanghaied Babysitter

Yeah, I’ll try to keep this one shorter, but I don’t really have to go back TOO MUCH to the original literature here.

Here is where I FOUND this case originally. An article that was COPIED onto a forum.

Parasitic wasp uses virus to control its host

LINK: https://forums.spacebattles.com/threads/parasitic-wasp-uses-virus-to-control-its-host.332664/

The links back to this forum article are ALL bad, but I was able to google for correct ones. Here is the article in Discover Magazine:

Biological Warfare: Parasitic Wasp Uses A Virus To Control Its Host

Science Sushi By Christie Wilcox Feb 11, 2015 2:36 AM

LINK: https://www.discovermagazine.com/planet-earth/biological-warfare-parasitic-wasp-uses-a-virus-to-control-its-host

THAT article goes back to THIS scientific literature:

LINK: https://royalsocietypublishing.org/doi/10.1098/rspb.2014.2773

This is actually a very long and complete scientific article. Let me give you the “TL;DR” version.

When the wasp lays an egg in the ladybug, it also injects an RNA virus. That virus makes the ladybug go “mask Karen” crazy, and stick around and GUARD the pupated larval wasp after it emerges from the ladybug and cocoons. The ladybug may then even kick the virus and go on living after the young wasp departs.

Yeah, let me HIGH FIVE that long-hauler ladybug.

Just sayin’.

Democrats.

SPIT.

SO – where are we now?


Is Phony Gene Therapy About Population Control?

We have now looked at the COVER PRESENT (coronavirus and vaccines), the EFFECTIVE PRESENT (spike protein virus and vaccines), the LIKELY DEEPER MOTIVATING PRESENT (contraceptive / abortive virus and “vaccines” that look pretty much like public “health” gene therapy), and the PURPOSED ORIGINAL HONEST PAST (infection and/or genetic modification of the injected to produce desired effects using RNA viruses and/or specialized viral vectors) – the latter insect past being a lot like what is happening now.

Are you ready for the FUTURE?

Well, there’s a lot of range on that. Maybe it’s THIS…..


Now I know a lot of y’all are, like me, saying “Yeah, that will be a cold day in hell!” But let’s consider it anyway. It helps to understand things.

WHY would Hillary say this, about Trump’s possible winning in 2016?

What crime could POSSIBLY send hundreds of historic conspirators to some horrible fate like what happened to the NAZIS? They would have had to have done something even more horrible – right?

Well, viewed in “holocaust” (small “h”) terms, an “abortion virus” followed by “abortion vaccines” might count.

It’s a pretty ingenious idea. If you honestly believe that overpopulation threatens the planet, and that stopping it “by any means necessary” is justified, then the idea of:

  • taking a modifiable cold virus but…..
  • don’t call it that, so people will be AFRAID
  • warm up the FEAR CROWD with SARS, Ebola, Zika, etc.
  • use a cold with its own moderate antiprogestogenic or oxytocin hormonal activity, or some other way of exerting a contraceptive or abortive activity
  • optionally increase that activity
  • release the virus
  • create vaccines with the same effect
  • require ongoing vaccines to titrate the effect on society

To me, this is very much like the wasp strategy, only instead of hijacking the juvenile butterfly with immunosuppressive negative gene therapy in a PRO-FERTILITY strategy for its own offspring, what the Democrats are doing is an ANTI-FERTILITY strategy using progestosuppressive negative gene therapy on basically all humans who are not in on the scam. And they also used an RNA virus to mess with our minds, though THAT was a bit artful, shall we say.

Now, I think the success or failure of their operation is going to depend on the ultimate level of contraception that is achieved here. The effect on society will depend on whether the Dems, globalists, and Chinese are trying to pull off a very steep and fast population drop that would generate a social immune reaction, or a long, slow, incremental one that would not. We probably won’t know this for several years.

But just consider this “back of the envelope” calculation.

Let’s say that Demmunists require 2 coronavirus boosters every year. Say that between compliance and effectiveness, ONE of those boosters is effectively pregnancy-blocking for any pregnancy currently in process. Run this over all of humanity, so that once every year, every woman is hit with a “menstruation and miscarriage vaccine” using the spike protein. With a pregnancy window of 75% of the year, that target is the broad side of a barn, as long as CDC continues to insist that it’s safe for pregnant women, or women who are trying to become pregnant. You would get massive observable menstruation and miscarriages after vaccination, and the plot would not last.

It’s not a SUSTAINABLE LIE.

BUT – as long as the effect is random, subtle, and single-digits, it can be hidden by a compliant scientific community, which is socially conditioned to reject the truth. Even bigger, control of social media, communications, and other avenues of discovering the truth, mean society can be kept completely blind to a subtle population control.

But seriously – reducing the fertility of humans by 5% is a BIG DEAL. It doesn’t mean it’s the end of it. It’s a GOOD BEGINNING – from their point of view.

You’ve got to look at this thing, like you’re trying to pull it off, to see that you really COULD pull it off.

And if we could pull it off, they will pull it off.

So – that’s where I’m at.

And if I’m right, they will NEVER FACE JUSTICE for what they’re doing.

So here is a rule about Democrats.

Democrats, China and other communists will always pick an unjust fait accompli over a just agreement.

Thus, as long as they do things where the price of tolerating their crimes is less than the cost of a civil war, they will just keep doing those things.

Something to think about.

W