COVID – Give Us Your Current Thoughts and Theories

Clinical_Stages_of_COVID.png

This is a very open-ended post. The goal is to get YOUR thoughts, opinions, and theories.

Without getting too deep, I can tell you that we are seeing a LOT of COVID in my world. It seems to be everywhere. But some apparent attempts to get masks going again are fizzling out fast, thank goodness.

So I’m curious what others are seeing. But beyond that, we’ve had almost 5 years of COVID in this world – maybe more.

Time for reassessment – particularly prior to the election.

Time for some fresh ground reports.

What think you about COVID?

Tell us what you’re seeing and thinking, please!!!

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With a little help from our “friends in high places”!

Oh, yeah – we’re headed back to the WHITE HOUSE!

HANG ON for the ride of your life!


Dedication

Image: https://i.pinimg.com/originals/d5/e5/ad/d5e5ad861f1fc08b93a6d511ed5ff19f.jpg

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655

Our heroine in high definition!


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Never talk about committing violence in a reply to Wolf or in response to anything Wolf has said, or you may get put into moderation so that your comments can be screened. This is ONLY because DHS is now playing door-knock Gestapo with people who have spoken at school board meetings, made public comments, etc. DHS regime jackboots are knocking on doors of school board mama bears and stupidly insinuating potential violence from things people say or don’t say on social media. A guy in Ohio pointed his FINGER at the school board, and they went after him, armed with pictures of the pointing, and screen captures of online comments. Yeah.

SO – give the Nazis ZERO ammo. Keep any mention of violence, even joking, away from Wolf, so that he doesn’t have to “explain” humor to humorless jackboots who pretend not to know things.

As for discussion of “violent humor” among yourselves (e.g., “#TeamHeadsOnPikes”), just use whatever discretion you think is appropriate for yourselves. I will only put you in moderation if your comments create problems for ME or THIS SITE, but not if they only impact you.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.

A bit of a paraphrase, I’ll admit, but it makes a few key points!


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Here is Wheatie’s selection from just over 2 years ago!

“For your listening enjoyment, I offer this uplifting composition from Andreas Kübler of Really Slow Motion, titled ‘Save Me’:”

Wheatietoo

LINK: https://www.theqtree.com/2021/01/25/20210125-joe-biden-didnt-win-daily-open-thread/


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

This is the weirdest set of “data joins” in my history of researching things, but it is all starting to make sense – so I’m going to invite you into the story.

The story starts recently, when this tweet appeared in my timeline:

Weirdly, I cannot find this tweet in context in Elena’s tweets or replies on Twitter. If you check out her Twitter, she is a solid retweeter of a lot of great stuff – but I have no clue where she found this.

Anyway, after I saw it, it led to THIS post:


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


If you have not read that, please at least read a bit of it, including the “TL;DR” part, so that you can make sense of the rest of THIS post.

I did some posting about this yesterday on Twitter. Surprisingly there was no traction. This thread still has barely over 100 views on the first tweet.

I moved from the normal posting strategy, to “replying to the bigs”. Same problem – no traction.

It’s even worse today. All day I have been trying to get people to pay attention to this, and my Tweets go nowhere. However, a few examples will show you the core message, almost better than a TL;DR would.

I dumped an entire thread on a long response to ChiefNerd…..

I started replying about this stuff everywhere!

I found ONE other person tweeting about the paper – and he had almost zero engagement. And I only found the guy because I searched on the special sequence, PRRARSV.

Eventually, I even tried “mystery” to get engagement, and to get past any censorship.

No dice.

Anyway, later, THIS happened with Aubergine, from my earlier speculation about a Codemonkey Tweet.

LONG THREAD.


SO – anyway – I started a thread on Twitter…..


[We will see where this goes today. I will add more thoughts as we go on. Publishing now, for the midnight unofficial deadline….]



Wolfie’s Wheatie’s Word of the Day Year Week:


translocation

noun

  • a change of location.
  • a transfer of a chromosomal segment to a new position, especially on a nonhomologous chromosome. Also called chromosomal translocation.
  • a chromosomal segment that is translocated.

Sub-types:

  • chromosomal translocation: see above.
  • reciprocal translocation: balanced, 2-way exchanges of material between chromosomes.
  • non-reciprocal translocation: unbalanced, one-way movement between chromosomes.
  • Robertsonian translocation: a special type of chromosome rearrangement merging long arms of a chromosome and eliminating the short arms.
  • nuclear translocation: movement of genetic material into or out of the cell nucleus.

Used in an Abstract:

Although the S [spike] protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.

Shown in an Image:

Figure 4. Colocalization between S mRNA and S protein inside infected cells. The images (see Figure 3) were analyzed by using the surface rendering and colocalization features of IMARIS. S protein and S mRNA distribution and colocalization in the cytoplasm (top panel), on the nuclear surface (middle panel) and inside the nucleus (bottom panel). The specific region of colocalization is indicated by a white spot. Scale bar 0.5 μm.

ENJOY THE SHOW

Have another great week!

W

Omicron Ground Reports – What’s Your Story?

Now that the COVID psy-op is falling apart, and we are fully resistant, we’ve overcome the COVID psy-op (GOOD), and we’ve been battling elsewhere (GOOD), but we may have lost some of our razor-sharp focus on, and ass-covering knowledge of, how to deal with COVID, and to thereby not go down for the count when COVID comes our way (BAD) .

Two recent comments by Scott and Aubergine show that COVID is still circulating, and that we are surviving without the vaccines, thank you kindly, “Dr.” Fauci.

The deal is, Omicron is still out there. In fact, so is Delta.

https://nextstrain.org/ncov/gisaid/global/6m

You can see that Omicron is everywhere around the world, vaccinating people against Delta, but Delta and its “old school buddies” still persist in small measure.

SO – I want to help give everybody a BOOSTER of several things:

  • information
  • preventative knowledge
  • courage
  • resistance to psy-ops

Please put your most recent COVID observations and experiences HERE, so that they can be found easily in the future, for historical reference, AND so that you can share your experiences, thoughts, strategies, and tactics with your fellow QTreepers.

Likewise, if you have questions, curiosities, and concerns about COVID, this is an excellent place to get some replies.

Thanks!

W

Five Fast Omicron Facts You Can Send to Your Friends, Neighbors and Doctors

This is a quick update that is almost entirely GOOD NEWS, and that needs to SPREAD AROUND LIKE WILDFIRE – just like OMICRON.

I will try to be brief and only comment as needed.


1 – A Case of Omicron Treated With HCQ

Remember that case of COVID treated with ivermectin, that was published as a video, and which I basically transcribed for the readers here?


A Seven-Day Journey Through COVID-19 in Seven Minutes, Treated with Ivermectin

This is a great selfie video, done by a young lady with a glorious Southern accent, chronicling her week of COVID-19 and recovery, treated with ivermectin. It’s short – just under 7 minutes – but it captures a lot of information about symptoms and relief by the drug. I can’t embed the video here due …


I think it’s really helpful for people to see and hear the reality of an individual COVID case, to see what to expect. This kind of information can absolutely reduce unnecessary fears. It’s a real service, IMO.

Well, Omicron is here, and it got here VERY fast (more later). THANKFULLY, somebody who GOT IT took extremely good notes, and put them online.

Specifically, a medical doctor, Dr. Henry Smith, Jr., who has published on American Thinker, got the disease, treated it with hydroxychloroquine, and recovered VERY nicely.

His account of the disease is MUST READ material. It’s short – no excuses!

Plus, he’s a photographer, and has lots of nice pictures on his site.

LINK: https://henrysmithscottage.com/viral-post-december-23-2021-my-omicron-infection/

ARCHIVE: https://archive.fo/Jm60C

No preview! Please visit his site. I left a comment there, letting him know about antihistamines, because this is something that can get past the “pharmacy gestapo” that Biden and CDC have created.

As Steve has noted here, the 2X dosage of modern, 2nd-gen antihistamines is quite safe, and his own doctor prescribed 4X dosages. This is completely analogous to doctor’s prescription of ibuprofen at 800 mg, which is 4X the OTC 1-pill dose.

I know that ivermectin is “all the rage”, but hydroxychloroquine is still an excellent drug to treat COVID, and I think it’s great to see it in use here. As I recently noted, I believe that none other than Bill Gates was behind the “take-down” of HCQ in the medical literature, via funding of studies designed to knee-cap it.

Dr. Smith comes to FIVE conclusions about Omicron, 3 being numbered, and 2 bonus thoughts after those, made post-illness, all of which I find excellent and agreeable. Please visit his post to see what they are.

OH – and his American Thinker article – a short but powerful post on the OBVIOUSNESS of the solution – natural immunity – entitled “Who Isn’t Getting Infected?”, is definitely worth reading as well.

LINK: https://www.americanthinker.com/blog/2021/12/who_isnt_getting_infected.html

It is absolutely wonderful to see doctors standing up to CDC myopia (or worse) now!

Hat tip to GA/FL for this tip!!!


2 – Graphic Views of Omicron Displacing Delta

The graph above – if you know how to read it right – is absolutely STUNNING.

The graph above is North America.

The graph is a screen capture from NextStrain, which keeps track of virus variants globally.

LINK: https://nextstrain.org/ncov/gisaid/global

What this graph shows, is NOT “itty bitty” Omicron (red) sneaking up on “big old” Delta (turquoise).

It shows – at the extreme right edge – Omicron SQUASHING the Delta empire like a BUG. At the very edge, Delta basically STOPS – as Omicron keeps moving to the right.

Let’s look at an earlier screen capture from NextStrain. This one is GLOBAL, on December 4.

Here, you see the same thing I described above, but you see it earlier, because it took a while for the variant to travel to America, where it would displace Delta. The GLOBAL data is already showing Delta getting walloped.

From this, you can tell that I just missed Omicron. I had Delta with Day 0 (first symptoms) on November 26, and was likely infected on November 22 (yeah, not a good day). Everything in America was still DELTA at that time.

This is more easily seen in another graph. Source HERE at CDC.

LINK: https://covid.cdc.gov/covid-data-tracker/#variant-proportions

Sadly, the current graphics will not archive properly.

As you can see, on 11/27/2021 in the United States, it was ALL DELTA. On 12/4, It was still almost all Delta. By 12/11, the United States was at over 10% Omicron, But ONE WEEK later, on 12/18, the USA was at

70% Omicron.

This is just INSTANT-FREAKIN’-TANEOUS.

Will it hit 100% Omicron?

Does it HAVE TO hit 100% Omicron to wipe out the nastier Delta?

Stay tuned….. for the next item.


3 – The Decline and Fall of the Omicron Variant

Hat tip to RF121 for this video, in which a South African engineering geek and university researcher, Pieter Streicher, who tracks and predicts COVID numbers, tells us what is going to happen to the Omicron variant, and is ALREADY happening in one of the “origin towns” in South Africa, where it is PAST THE PEAK.

I really recommend listening to this, because I am just grabbing a few things that caught my fancy. There is much, much more.

Streicher predicts that Omicron will PEAK and then DECLINE, leaving ultimately around 20% infected and recovered, maybe 30% tops.

It will NOT be a majority of the population.

Here is how Streicher’s predictions have been working so far:

Now – why would I trust this guy – and NOT the Imperial College guy who Bill Gates promoted?

YOU KNOW…..

THIS GUY.

Yeah, the guy who ignored his own lockdowns from dodgy overblown models, so he could do the old pokerino with another “damn near model”, Little Mrs. Rubylips, his married British intelligence handler mistress.

Well, Neil Ferguson’s predictions turned out to be WILDLY overblown.

Streicher, on the other hand, whose predicted curves and actual numbers you can see above, is predicting – at the PEAKS….

25-fold LOWER deaths for Omicron relative to Delta, and…..

6-fold LOWER ventilated hospital beds for Omicron vs. Delta.

SO – Untreated Omicron is NOT exactly free of risk, and we still need hydroxychloroquine or ivermectin to treat it.

AND – failing availability of those things, we need antihistamines and azithromycin – the Spanish protocol – implement widely, as I discussed earlier…..


The Zyrtec Rebellion

Everybody underestimates Spain. The last letter in “PIGS” is far less of an insult than an error. Years ago, when I was at a conference, and Japanese industrial spies were getting me drunk (it was a great red wine), I decided that I had to give them SOMETHING for their time and effort, if only …


And if you doubt the utility of antihistamines against ALL variants of SARS-CoV-2, then you need the NEXT item to convince you otherwise.


4 – An Independent Discovery and Validation of Antihistamine Therapy for COVID-19 *and* for Both Long COVID and Genetic Vaccine Major Adverse Effects

THIS is worth getting the word out to doctors quickly. Hat tip to Gail Combs for bringing this critical video to my attention.

The antihistamine therapy for COVID-19 was independently discovered by a South African doctor, Dr. Shankara Chetty. Even more importantly, the doctor discovered the reasoning behind the therapy, and its applicability to both “long COVID” and vaccine side effects as well.

His REASONING is extremely convincing, and well-explained in the video.

This is a brilliant universal theory of severe COVID, long COVID, and vaccine side effects, which meshes quite perfectly with almost everything we know about SARS-CoV-2 and COVID-19.

Thus, we now have a universally available, over-the-counter treatment protocol for BOTH COVID and COVID vaccination side effects, the former of which was found to be 100% successful in TWO real-world studies, and which cannot be stopped by Fauci-controlled pharmacists or Gates-funded anti-studies.

This video is brilliant, because it really demonstrates how science is done, at the practicing level. A doctor and scientist, using observation and logic, figured out the antihistamine protocol BY REASONING FROM SYMPTOMS, rather than by observation of antihistamines as an accidentally useful therapy. Nevertheless, both independent discoveries confirm each other.

LINK: https://www.bitchute.com/video/LvZDx6gzbJeR/

LINK: https://youtu.be/0tgvE6fuWXY

Dr. Shankara Chetty used a very old FIRST-GENERATION antihistamine, promethazine, as his drug of treatment.

Based on this, our own group’s prediction that Benadryl – another first-generation antihistamine – would also work, is almost certainly correct.

I think this is a critical video for every doctor to watch. In fact, this might be a good one to send to YOUR doctor!


5 – Omicron Infection Amplifies Neutralizing Antibody Response To Delta Variant

Well, count this as good news. Hat tip to RF121 for tipping us to this one.

First on Twitter:

LINK: https://sigallab.net/

LINK: https://secureservercdn.net/50.62.198.70/1mx.c5c.myftpupload.com/wp-content/uploads/2021/12/MEDRXIV-2021-268439v1-Sigal.pdf

Check out some further tweets from Alex Sigal.

Here is the abstract of the preprint.


Omicron has been shown to be highly transmissible and have extensive evasion of neutralizing antibody immunity elicited by vaccination and previous SARS-CoV-2 infection. Omicron infections are rapidly expanding worldwide often in the face of high levels of Delta infections. Here we characterized developing immunity to Omicron and investigated whether neutralizing immunity elicited by Omicron also enhances neutralizing immunity of the Delta variant. We enrolled both previously vaccinated and unvaccinated individuals who were infected with SARS-CoV-2 in the Omicron infection wave in South Africa soon after symptom onset. We then measured their ability to neutralize both Omicron and Delta virus at enrollment versus a median of 14 days after enrollment. Neutralization of Omicron increased 14-fold over this time, showing a developing antibody response to the variant. Importantly, there was an enhancement of Delta virus neutralization, which increased 4.4-fold. The increase in Delta variant neutralization in individuals infected with Omicron may result in decreased ability of Delta to re-infect those individuals. Along with emerging data indicating that Omicron, at this time in the pandemic, is less pathogenic than Delta, such an outcome may have positive implications in terms of decreasing the Covid-19 burden of severe disease.

Here are the critical points:

Importantly, there was an enhancement of Delta virus neutralization, which increased 4.4-fold.

The increase in Delta variant neutralization in individuals infected with Omicron may result in decreased ability of Delta to re-infect those individuals.


IMO, this is good news for people who are infected by Omicron. It is very likely that Omicron offers some real protection against Delta.

The degree of protection against Delta is roughly a THIRD of the degree of protection against Omicron itself which is afforded by infection with Omicron (4.4-fold vs. 14-fold). That’s still ballpark. Probably comparable to a Delta-specific vaccine.

Not bad at all, IMO. We’ll just have to see how real-world data pan out.


That’s all for now, but stay tuned.

Because YES – there’s MOAR.

W

John Fink, James Coburn, and Jennifer O’Neill having a meal in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

Ivermectin – The Preparation


OK, people. It is time for THE WOLF to GET PATTON ON YOUR ASSES.

As you may know, we now have many of our dear members actively fighting COVID-19, including one (gil00) in the hospital. Several have received Regeneron. Thus far, praise God, we have not lost anybody – and I intend to keep it that way.

For updates on the health of our members, we now have a dedicated thread, listed at the top of the sidebar. Feel free to record information there, including LINKS to comments from sick members in the daily threads.


QTreeper Health Updates

This is a new thread for QTreepers with health issues of ANY kind to keep us updated. I have absolutely no problem with people posting HERE, on the OPEN THREADS, or BOTH. You do what is right for you. We’re here for YOU. I want people to post wherever they feel most comfortable. I also …


We have also covered a specific case of ivermectin, used to treat COVID-19, with FANTASTIC RESULTS.


A Seven-Day Journey Through COVID-19 in Seven Minutes, Treated with Ivermectin

This is a great selfie video, done by a young lady with a glorious Southern accent, chronicling her week of COVID-19 and recovery, treated with ivermectin. It’s short – just under 7 minutes – but it captures a lot of information about symptoms and relief by the drug. I can’t embed the video here due …


We have had many, many, many discussions of how to obtain ivermectin and hydroxychloroquine – now for over a year.

MANY of our members have gotten a hold of one, two, or even THREE OR MORE forms or versions of drugs used to treat COVID-19. When I say that people have STASHES, I mean it. They have STASHES.

So the problem is not that people don’t have the means to treat or prevent the disease.

The problem is that people don’t ALWAYS have the WILL to begin treatment EARLY.

TREATING EARLY was GOD’S GIFT TO US through Doctor Zelenko. This MAN OF GOD realized that the most important way to fight COVID was to hit it EARLY and COMPREHENSIVELY.

At that time, hydroxychloroquine, azithromycin, and zinc was the best combination.

Now, we realize that ivermectin can augment or substitute for hydroxychloroquine. We also understand that VITAMIN D is critical.

We further understand that simple antihistamines such as zyrtec, loratadine, and others can almost completely eliminate the deadly late phase complications of COVID-19 infection.


The Zyrtec Rebellion

Everybody underestimates Spain. The last letter in “PIGS” is far less of an insult than an error. Years ago, when I was at a conference, and Japanese industrial spies were getting me drunk (it was a great red wine), I decided that I had to give them SOMETHING for their time and effort, if only …


SO – I am not going to recap any of that stuff. Likewise, I am not going to re-justify the use of ivermectin, and its GREAT results in India, Indonesia, Japan, Brazil, Nebraska, Oklahoma, and everywhere ELSE that is out of the reach of the Branch Covidian propaganda machine.

Instead, I want to do these things:

I want to make sure that everybody here:

  • HAS A PLAN
  • HAS ANTIGEN TEST KITS TO BEGIN THEIR PLAN
  • HAS A STASH THAT SUPPORTS THEIR PLAN
  • HAS ADVOCATES WHO WILL ASSIST THEIR PLAN
  • HAS HOSPITAL COMMS TO THIS SITE TO UPHOLD THEIR PLAN
  • HAS THE *WILL* TO WITHOUT HESITATION START THEIR PLAN
  • HAS THE *TRAINING* TO FEEL CONFIDENT IN THEIR PLAN

Are you all with me?

TRAINING is key. You are going to assemble a plan and then you are going to TRAIN FOR IT.

Some of this is going to involve helping you understand what COULD be in your stash, and what SHOULD be in your stash.

Now – this is a moving target, and I will be changing and updating the information that follows.

But right now, the MINIMUM that should be in your stash, should be vitamin D and zinc supplements, to prevent COVID-19. Next, you need OTC antihistamines – see the above post.

This is the BARE MINIMUM to save your life. If you have adequate Vitamin D and adequate zinc, and are deficient in neither, then you are VERY unlikely to die from COVID-19.

If you take antihistamines, and you take them IMMEDIATELY or even PREVENTATIVELY, you are even LESS LIKELY TO DIE.

If you have these things, and the WILL to take some of them as needed BEFORE you get COVID, and the WILL to take the others as needed IMMEDIATELY when you think or KNOW that you have COVID-19, you can almost guarantee that you will NOT DIE.

If you want to go further, you need to get ivermectin or hydroxychloroquine.

If you want to strike with maximum efficiency, so that you can take the drugs you need IMMEDIATELY, you also need antigen tests.

These are available from your local pharmacy now, or by mail order.

I will compile a list of URLs here, as an appendix, for you to get these things.

But right now, the main thing I want to do, is to DEBRIEF each of you on your stash and your level of preparation. Then, in the comments, we are going to TRAIN EACH OTHER on preparation and RAPID DEPLOYMENT at the first sign of COVID-19.

So JOIN ME in the comments, and TELL ME (as much as you feel comfortable doing) about your STASH, but FAR MORE IMPORTANTLY….

TELL ME ABOUT YOUR PLAN.

Those of you who have fought or ARE fighting COVID right now, are welcome to TELL or RE-TELL what you did, what you didn’t do, and what you wished you had done, or might have done better.

I want to get ALL OF THIS TREATMENT INFORMATION in one place. I will distill out the most important stuff, and put it in the post itself.

You could save a fellow member, and for each of them, you could save 10 lurkers.

DO IT! Who will be first?

W

Appendix – Sources for Therapeutics

I will add entries from comments below. Please help add to this list.

1. Welcome Healthcare

https://www.indiamart.com/welcomehealthcare/search.html?ss=ivermectin

This is a great outfit. They are very professional. You need to be prepared with an email address, a PayPal account, and a phone number for them to discuss what they have and what you need. They are friendly, competent, speak good English, and have reasonable prices.

You need to know in advance exactly what you want and how much of it you want. They will ship immediately. You will have product delivered in as little as 2 weeks, or as many as 6 weeks, thanks to supply chain issues, but you will be able to track your shipment.

They also have azithromycin, hydroxychloroquine, doxycycline, steroids, and others. I do NOT recommend buying anything you are not VERY comfortable using, and which you don’t already know proper dosage and contraindications. Likewise, if you are not comfortable purchasing “global OTC medicines” from suppliers like this, and wish to only obtain medicines with a doctor’s prescription, then please seek those drugs through doctors listed below.

This method is not for sissies. I don’t want to talk you out of it, but you are buying real medicine and treating YOURSELF by general published medical recommendations. If that makes you nervous, then go the doctor route. But remember this.

Hydroxychloroquine and ivermectin can SAVE YOUR LIFE.


2. Veterinary Supply Companies

https://www.tractorsupply.com/tsc/product/agrilabs-agri-mectin-1-injection-50-ml

https://www.tractorsupply.com/tsc/product/agrilabs-agri-mectin-1-injection-200-ml

https://www.calvetsupply.com/ivermectin-injection-1-50ml.html

https://upco.com/?s=ivermectin

Some people feel more comfortable this way. Not a problem if you do. These are quality drugs, suitable for human use.

Veterinary supply companies provide ivermectin as both the injectable form (1%) and the horse paste.

In BOTH cases, you want to take it ORALLY. You do not want to inject it. You just have to use the right amount, because you are not a horse, so you don’t need as much.

The horse paste is probably easier if you are more of a COOK, and the injectable is probably easier if you are more of a LAB RAT. We can work with you either way, to get what you need and to help you understand dosages.


3. FLCCC Alliance & Other Doctors’ Organizations

FLCCC Alliance

https://covid19criticalcare.com/guide-for-this-website/

Remote Health Solutions

If you want to go through a doctor, these groups are how to do it.


4. Antigen Tests

https://www.cvs.com/shop/abbott-binaxnow-covid-19-antigen-self-test-2-tests-for-serial-testing-prodid-550147

The advantage of using antigen tests, is that you won’t waste your ivermectin or hydroxychloroquine on some cold or weak flu. You will KNOW that you have COVID, and you will be able to take your therapeutic in CONFIDENCE. Thus, if you are AMBIVALENT about taking ivermectin or hydroxychloroquine preventatively, then just wait until you have a positive antigen test, and THEN take the drugs, when you KNOW they will work.

With an antigen test, you can hit COVID on DAY ONE of the clinical infection.


5. Antibody / Regeneron / Lilly / MAb

Use these links to find infusion centers and information on availability.

https://covid.infusioncenter.org/

https://protect-public.hhs.gov/pages/therapeutics-distribution

In my opinion, you can HOPE for these treatments, but (1) there are no guarantees, and (2) you may prove not to be eligible for many reasons, EVEN if you try to get treatment within the first 10 days.

Don’t count on this method, is my advice. But DO make it part of your PLAN!

6. Moxidectin

This is an alternative to ivermectin, which are longer-lasting with completely different dosages. Be VERY careful if you investigate this therapeutic. IMO it is not nearly as well-understood as ivermectin as an antiviral or treatment for long-haul, but it has been clearly demonstrated as effective, IMO. If anybody has information from doctors about safe dosages of moxidectin in humans, please post it!

Moxidectin:

http://www.medchemexpress.com/moxidectin.html

Moxidectin cautions:

http://www.maximpulse.com/permethrin/moxidectin_01.html


7. Other Online Pharmacies (not verified)

https://pharma-doctor.com/ivermectin.html

https://drugsforhealth.org/product/Stromectol.html


8. Please Suggest MORE LINKS!


PS – Ivermectin vs. Pfizer’s New Drug Paxlovid

https://conservativeplaylist.com/2021/11/16/why-ivermectin-is-superior-to-pfizers-antiviral-pill/

Pfizer’s Drug: https://justthenews.com/politics-policy/coronavirus/pfizer-will-seek-emergency-use-authorization-its-covid-19-antiviral

QTreeper Health Updates

This is a new thread for QTreepers with health issues of ANY kind to keep us updated. I have absolutely no problem with people posting HERE, on the OPEN THREADS, or BOTH. You do what is right for you. We’re here for YOU.

I want people to post wherever they feel most comfortable. I also want people to get updates in real time. BOTH this thread and the open thread will help accomplish that goal.

Thank you!!!

W

“You want ivermectin? Nurse Wolf says you GET ivermectin!”

Why Was Pfizer-Wuhan Demanding Military Bases as Collateral for Vaccines?

Just askin’. I think it’s becoming obvious now.


Thanks to INDIA – which gets historic Chinese duplicity – for making me see the connection between Pfizer the company, which is fast becoming a CHINESE-based multinational, and what Pfizer is doing globally.

You see, I remember hearing from the VERY FIRST PFIZER WHISTLEBLOWER – who the treasonous media tried very hard to silence, if you will recall – that Pfizer was making all kinds of outrageous demands from different nations, in the contracts for its vaccine.


#PfizerLEAK

Stew Peters is doing great work. Sure he’s had some people on, in the past, who I was not terribly impressed with. Later, he had Jane Ruby on, with magnetic stuff that I believe is mostly disinformation. Sorry – not buying. The Magnetism Challenge: Part II – Scientific Disinformation During the COVID-19 Narrative Collapse Wherein …


One of the CRAZIEST demands was MILITARY BASES as collateral.

What in the HELL does Pfizer need with military bases? America might, but……

At the time, I was thinking “No WAY would America do that. It’s just so BLATANT.”

Well, I wasn’t thinking BIG ENOUGH.


Let’s follow this information back to the source from where I first got it.

First, Gab.


ricHARD Moriarity
@hardmasada
·

EXPLOSIVE REVELATION: Indian Television Exposes How Pfizer Bullies and Blackmails Countries for COVID Shots – “Desperate Countries force to Make Humiliating Concessions” (VIDEO) 
https://www.thegatewaypundit.com/2021/11/explosive-revelation-indian-television-exposes-pfizer-bullies-blackmails-countries-covid-shots-video/

does this sound like an American Co? No, this sound like a RED CHINESE conglomerate, so are they?

Pfizer Reserves the Right to Silence Governments – Pfizer is silencing the governments through its contracts. It has forced countries not to talk about the deals they strike for shots.

Pfizer Controls Distribution of Shots – Pfizer controls the donations of the shots, not the country that buys them. Pfizer will decide where the shots go.

Pfizer Secured an “IP Waiver” for Itself – If Pfizer is accused of intellectual property theft, governments will pay not the company.

Private Arbitrators, not Public Courts, Decide Disputes in Secret – If there are disputes, private arbitrators and not public courts will decide on them

Pfizer Can Go After State Assets – Pfizer can go after state assets to secure its compensation.

Pfizer Calls the Shots on Key Decisions – Pfizer decides delivery timeline and more.

EXPLOSIVE REVELATION: Indian Television Exposes How Pfizer Bullies and Blackmails Countries for COVID Shots (VIDEO)

WION Gravitas, a popular prime-time show in India that brings viewers news and discussions on concurrent issues and across the globe, exposed in a recent episode…

The Gateway Pundit

View Link Feed

4 likes
4 reposts


Then, the Gateway Pundit.

EXPLOSIVE REVELATION: Indian Television Exposes How Pfizer Bullies and Blackmails Countries for COVID Shots – “Desperate Countries force to Make Humiliating Concessions” (VIDEO)

November 1, 2021, 2:36pm

by J H.


There is a lot of GREAT information on the Gateway Pundit article, including sections of documents.


The video is HERE, on RUMBLE:

https://rumble.com/vokf3l-primetime-show-in-india-exposes-how-pfizer-bullies-and-blackmails-countries.html


It is imperative to remember that Pfizer now has a HUGE operation in……

…..WAIT FOR IT…..

WUHAN, HUBEI, CHINA

Yeah, that’s right.

Conveniently close to where some of the vaccine components come from, I might add, per former Pfizer employee and second whistleblower Karen Kingston.


EXPLANATORY LINK HERE


It turns out that the Pfizer Wuhan operation was nicely exposed in an article back in July of this year.

One of the things you will note as you read the article, is that there was indeed some effort to cover up Pfizer having a huge research center at the epicenter of the outbreak of the disease that they are making so much money on, thanks to the outbreak.

Funny, that.


LINK: https://miningawareness.wordpress.com/2021/07/22/pfizer-has-large-rd-facility-in-wuhan-china-pfizer-employed-members-of-the-chinese-communist-party-according-to-a-data-leak-pfizer-3-month-revenue-from-the-covid-vaccine-was-3-5-billion/

ARCHIVE: https://archive.fo/AQwcc

Pfizer December 2020 SEC filing: https://archive.md/SMPQa

[WOLF NOTE: I am just including SOME of the great research from this article to give you a taste.]


In 2010, Pfizer founded an R&D facility at China’s National Bio-industry Base in Wuhan (Biolake). By 2015, Pfizer was moving its “medicine safety business” from India to the Wuhan Biolake facility. Lan Zhanghua, the site head of Pfizer (Wuhan) Research & Development Co Ltd. stated in 2016: “Every one of Pfizer’s new drugs has indispensable contributions from the Wuhan team.“ He states that two R&D “functions run exclusively at Wuhan and nowhere else in the world… our Wuhan teams manage the clinical trial registry information and clinical trial master files for all Pfizer’s medicines”. https://archive.md/puanr Pfizer should be under investigation by the FBI-Homeland Security, but they almost certainly are not.

According to a data leak, Pfizer has employed 69 known members of the Chinese Communist Party. This sounds like a low number, considering that around 500 people work at their Wuhan site. Maybe this is members working for Pfizer outside China? See: “Huge Data Leak of 2 Million CCP Members Reveals ‘Golden Age’ of Chinese Espionage” By Daniel Y. Teng, December 14, 2020 https://archive.vn/5O49L

Pfizer is one of the major beneficiaries of SARS-CoV 2 (Covid-19), which started in Wuhan, China: “Pfizer Reaps Hundreds of Millions in Profits From Covid Vaccine: The company said its vaccine generated $3.5 billion in revenue in the first three months of this year”, New York Times, May 4, 2021: https://archive.md/l6Sy1. It accounted for almost a quarter of Pfizer’s total revenue and they will make close to an estimated $1 billion in vaccine profits for the first three months alone. (NYT estimate is $900 million pretax.)

The Pfizer-BioNTech COVID-19 Vaccine is an unapproved vaccine that may prevent COVID-19. There is no FDA-approved vaccine” for Covid-19. Notice that they don’t put “death” as one of the risks. They merely note that “These may not be all the possible side effects of the Pfizer-BioNTech COVID-19 Vaccine. Serious and unexpected side effects may occur. Pfizer-BioNTech COVID-19 Vaccine is still being studied in clinical trials”. This is not informed consent! https://www.fda.gov/media/144414/download

As of December 2020, Pfizer’s SEC filing still listed the following subsidiaries in Communist China, which carries the false name of “People’s Republic of China”: Pfizer (China) Research and Development Co. Ltd, Pfizer (Wuhan) Research and Development Co. Ltd., and Pfizer Biologics (Hangzhou) Co. Ltd., as well as Pfizer International Trading (Shanghai) Limited, Pfizer Investment Co. Ltd., Pfizer Pharmaceutical (Wuxi) Co., Ltd., Pfizer Pharmaceuticals Science and Technology Co., Ltd., Pfizer Finance Share Service (Dalian) Co., Ltd. https://archive.md/SMPQa Funny thing that the Wuhan R&D isn’t listed as one of their R&D locations on the Pfizer web site. Even prior to the Covid-19 outbreak, it wasn’t listedhttps://web.archive.org/web/20190321054103/https://www.pfizer.com/science/research-development/centers If you do a search for Wuhan on their web site, you don’t find it, as of this writing. If you type China in the search you find some relevant things.

On a separate Pfizer (China) site (last updated in 2011) one can find regarding Pfizer’s China Research and Development Center (Shanghai and Wuhan): “CRDC supports Pfizer’s global biological and chemical pharmaceutical R&D programs across our clinical development pipeline, and serves as an important hub of Pfizer global and Asia-Pacific R&D activities. As such, CRDC is an integral part of Pfizer’s global R&D site network, providing support across many R&D disciplines, including clinical drug development, medical, regulatory and safety.” See this and more here: https://archive.md/IQBZy

Pfizer founded an R&D facility in Wuhan (October 8, 2010) at China’s National Bio-industry Base in Wuhan (Biolake). It was the first Fortune 500 company to located at Wuhan’s Biolake facility. By 2015, Pfizer was moving its “medicine safety business” (whatever that means) from India to the Wuhan Biolake facility.

Lan Zhanghua site head of Pfizer (Wuhan) Research & Development Co Ltd. stated: “We developed beyond expectation. Now the Wuhan team has comprehensive coverage in Pfizer’s medicine development. Every one of Pfizer’s new drugs has indispensable contributions from the Wuhan team.

Whereas, Pfizer’s Wuhan team started “performing only one function to 12 functions in the R&D system. Two functions run exclusively at Wuhan and nowhere else in the world: ‘No other but our Wuhan teams manage the clinical trial registry information and clinical trial master files for all Pfizer’s medicines. These are of utmost importance – making any mistake or losing documents could mean the medicine would never go to market,’ Lan said.”

As of 2016, Pfizer employed almost 500 people at the Wuhan site.

MORE


I’m gonna be blunt.

THIS was not a good look for those who have gotten in bed with Pfizer.

Just sayin’.

First, this little bit of very phony salesmanship. Good grief, Israel. To SHILL for vaccines.

The world is no longer full of IDIOTS who fall for “patent medicine shows” like this.


Now check this out.

Note the part about vaccinating KIDS.

They’re EAGER. Long before Rochelle Alinsky was talking about it here in the US.


MORE


It is now VERY clear that the spike protein vaccines were a case of “designed obsolescence”. They were designed to peter out with spike variation, and to not give the same superior, robust “natural” immunity that the disease gives, through nucleocapsid antibodies.

THAT enables MORE CLOT SHOTS. More “abortion vaccines”. MORE population control.

At the same time the “vaccines” enforce inferior immunity, the spike was the first step toward cutting back human longevity. Population reduction through incrementally distributed disease.

It’s a SELF-FUNDING DEPOPULATION PROGRAM.

The most diabolical form of “smallpox blankets” ever devised. Distributed to all of humanity.


Corporate and Political Elite Gather at COP26 To Discuss How The Global Population Destroying The Planet – An Ideological Motive to Deploy a Mandatory Vaccine To Eliminate Human Lifespans

November 1, 2021 | Sundance | 572 Comments


The American government, the Israeli government, and Pfizer may be friends, but they are no longer OUR friends.

Know your real friends are.

Know who tells the truth, and make THEM your friends.

W

Sheep to the Slaughter

OK, to be honest I had Zero plans to write this post when I woke up “today”. In fact I’d been hoping to take advantage of my solo weekend to wrap up a post or two I’ve had in draft mode for months, but it appears that they’ll have to still wait. My hunters will be home soon…

This journey started out by reading Carl’s beautiful Sunday post.

Being very moved by the teaching he shared I wanted to look up the source material by John Piper AND finally came to a page that appears to contain much, or even all, that Carl shared, here:

https://www.desiringgod.org/messages/glory-majesty-dominion-and-authority-keep-us-safe-for-everlasting-joy

In the course of searching for the actual message, & not just other people’s blog posts about Piper’s teaching that was apparently given at some type of conference, a few interesting links popped up. One looked to be addressing how seemingly Piper weighed in on the 2020 election & from the couple lines of text visible at the search may have spoken against Trump. I was curious so went to read that article too.

https://notthebee.com/article/john-piper-wrote-a-weird-article-talking-about-the-freedom-to-be-vaxxed-and-james-white-had-some-thoughts-for-him

What a surprise to discover that the article was more about promoting the vax from the pulpit rather than steering people away from Trump during the stolen election. Hmmm

OK, so this post is NOT trying to attack John Piper as a man, a Christian, nor as a theologian. I’m trying to steer clear of my own biases, which is obviously impossible. In reading the search engine thumbnail descriptions it appears that Piper is affiliated with the Baptist church, which makes my “legalism radar” perk up. I’m just being honest, I have issues with legalism that go way back & have a (possibly misplaced) perception that Baptist takes might hover in the legalism domain…so grain of salt going forward here…

Here are a couple places where I’ve addressed legalism, & the other end of the spectrum, the prosperity gospel, for context on some of my thinking in these arenas…

So, back to the issue at hand. I like to think of myself as a Truth-seeker AND a Truth-teller. So let’s see if we can unearth some Truth in the controversy before us, namely shilling for the vax from the pulpit. Whom the Son sets free is Free indeed!

Let’s look into John Knox’s Not The Bee article a bit first. Per his opening remarks he appears to be a Conservative Christian, who is perhaps comfortable with MAGA & Trump’s leadership.

“I’m not here to slander John Piper. He’s a brother-in-Christ and a man who has, by all accounts, picked up his cross daily to preach the hope of Christ and Christ crucified to a broken world.

With that being said, Piper has come to some odd conclusions in recent years, starting most notably with the idea that voting for the worldly bravado of Donald Trump was just a [sic] morally wrong as the utter institutional corruption, unfettered support of abortion, and woke totalitarianism of Joe Biden.”

He then starts to dissect Piper’s article:

https://www.desiringgod.org/articles/a-reason-to-be-vaccinated-freedom

Let’s dive into Piper’s perspective without immediately referring to Knox’s take & see what might jump out…

Here is his opening & yikes he’s seeming like a Pro-vaxer from the outset, not just pro-freedom (in Christ).

My aim in this article is to encourage Christians to be vaccinated, if they can do so with a good conscience and judicious medical warrant.

The people I have especially in view are those who are not vaccinated because of fear of being out of step with people they respect, and in step with people they don’t admire. My message to them is simple: You are free.

So, I am not talking directly to everybody. If the shoe fits, put it on, check your conscience, consult your doctor, and go get vaccinated. If it doesn’t, go tearfully and cheerfully on your way. Tearfully, because over 4.5 million people have died from COVID-19 worldwide (including over 700,000 Americans). And cheerfully, because Christ makes it miraculously possible to love people by being “sorrowful yet always rejoicing” (2 Corinthians 6:10).”

So I’m pretty close to an anti-vaxer for numerous reasons now. It would be nearly impossible to read consistently here at The Q Tree & not be Extremely Concerned about the many & manifold dangers of the so-called Covid vaccine. Obviously Piper is coming from a very different worldview, though we Might be somewhat similar in our Christian biblical foundational viewpoints. Some of what he said above strikes me as manipulative, which is a big red flag to me!

Below is a comment written before the Plannedemic was on the scene with some vaccine concerns I expressed elsewhere, for perspective, but we’ll just stick with the Covid “vax” concerns today:

So Piper cites a number of sources that all seem to show that being unvax’d is Way more dangerous than being vax’d. Obviously here at the Q-Tree we consider material much more wider afield & also take into account the numerous reports, medical, scientific, & anecdotal that expose Much of the danger of the clot shots. It appears that Piper is unaware of this alternative & alarming material. Here’s his take, shudder:

When people respond to this increasingly clear reality by pointing to untrustworthy and disreputable government and medical leaders, I respond, “That’s a non sequitur.” The team called “vaccination” just made a first down, even if monkeys are holding the chains. For friends around the world who don’t know American football, that means a win is a win even if all the coaches and referees are incompetent.

Piper’s take on freedom is interesting & I encourage you to read it for yourself. He then lists a series of considerations to ponder as one decides for the shot or not. He doesn’t elaborate on those issues, even the implications of fetal cell lines, though he does link to a YouTube video on the topic. I have no idea if Piper is a pro-lifer or not, but at least he brings up that fetal tissue issue, though by implication doesn’t apparently consider it an impediment to Christians taking the “vax”. He appears to have made up his mind to take the shot & seems to be freeing, or even persuading, his parishioners to do the same–concerning!

Now let’s consider Knox’s other cited material that is opposed to Piper’s take before returning to Knox.

https://www.aomin.org/aoblog/personal/freedom-is-the-primary-casualty-of-the-experimental-mandated-vaccines/

James White, the author of the above, pulls no punches & calls Piper out for his writings AND remarks on the election & the shot! Here is White pointing out what many Q-Treepers might consider to be quite obvious.

God’s ownership of our bodies implies our own stewardship thereof, which is why many of us take serious issue with experimental genetic therapies with record-breaking reports of adverse reactions, including death, with no long-term studies relating to safety (cancers, fertility), for a disease with an average mortality age above life expectancy and a mortality rate of less than 0.5%.

Further from White, bold is my take:

there is the arrogance of the secular worldview that actually leads man to believe he is wise enough, while remaining in rebellion against his Creator, to meddle with the very essence of his being (genetics). When such arrogance is joined with a lust for power and dominion, it becomes deadly.

So the bulk of the article, comprising numerous biblical citations about freedom, is not the issue. Instead, the problem is found in the section that reads like a Pfizer promotional advertisement, and then the application portion at the end.

White’s wisdom & Piper’s naivety are on display in this next quote from White (not italicised to preserve his presentation):

“From late October of 2020, as word about the technology that is behind the Pfizer and Moderna vaccines came out, I have stated that I would consider use of these vaccine [sic] once three and five year safety studies had been completed. Prior to 2020, this would have been considered a sober, even mundane position to take. You do not do genetic manipulation at “warp speed,” especially when the threat you are seeking to counteract is one that almost always requires multiple co-morbidities and results in an age of death equal to or above life expectancy. But we do not have such data, and with how this one particular disease has been handled, we have good grounds to wonder if we will ever have geniune [sic] data in the future. The VAERS database, maintained by the CDC, has catalogued record numbers of negative results from the vaccines, so it is now regularly dismissed as “untested” (the irony is palpable) by the media. The amazing reality that we are now counting deaths with the Covid-19 as the same as deaths from Covid-19 has resulted in massively inflated numbers, numbers Dr. Piper repeats without comment, and uses in his final argumentation as well. The fact is we are playing with dangerous and unknown long-term impacts with these types of experimental1 therapies. Dr. Piper does not even acknowledge this reality.”

Here is the material for the footnote #1 above & a reference to further work by White (an 8 page pdf). This appears to be a level of truth AND integrity to be much admired & emulated, yet too rarely seen!

1 Yes, they remain experimental. The FDA approved the Pfizer jab without public comment, fundamentally altering the entire process. Video exists of Anthony Fauci in 2019 (Milken Institute found on CSPAN2) lamenting how long it would take to get these kinds of vaccines approved. Given his own role in the Wuhan lab, gain-of-function funding, etc., the reality of the situation is clear.

Note: I have written a fuller statement on the basis for Christian rejection of vaccine mandates here: https://standwithwarriors.org/wp-content/uploads/2021/09/Statement-on-Christian-Faith-and-Mandated-Experimental-Medical-Procedures.pdf

AND White continues with his truth-telling…

“Many studies are now showing efficacy rates below 50% and dropping for these vaccines. But the UK report is even more dangerous. We are now seeing that the vaccines are inhibiting the natural ability to produce antibodies against not just the well-known “spike protein,” but against the shell of the virus as well. Our bodies provide not only a much more robust immunity (as all studies are showing, and which Dr. Piper misrepresented when he said natural immunity is “as effective as vaccination immunity” when it is actually 13 to 27 times greater), but it is a much wider immunity, responding to more of the structure of the virus. This study is telling us that vaccination degrades our natural immunity, leaving us even more exposed to future infection.”

And this treat from White on Piper!

“He then provides one of the most disappointing lines in the article: “You have pondered the likelihood and unlikelihood of conspiratorial conjectures.” Without defining his meaning, or providing examples, Piper does us no favors. Is the recognition of the cooperation of Big Tech and Big Pharma with the extreme leftists in political power resulting in the transfer of literally trillions of dollars of wealth a “conspiratorial conjecture”? Are the banishments from social media of medical experts who are warning about dangers fictional? We are not told.”

Winding down toward his conclusion White displays both insight AND wisdom:

“It is undeniable that the vaccines are not a solo issue. They are coming to us after mask mandates and church closures and pastoral imprisonments and before the next onerous demands from governments drunk on the power that inevitably comes from the rise of secularism. The secular state is far worse than the ancient pagan context of Rome (which was bad enough), for by its very definition it must be ultimate in all things as there is no Creator. Why Piper does not see the role the vaccines play in the overall demands of the newly empowered totalitarianism I cannot say, but it is not the first time he has missed the role a particular element plays in the whole. Mean, arrogant tweets are, in the overall scheme of things, significantly less important than the fact that the Biden regime is intent upon forcing your children to celebrate drag queens and likewise just as intent upon taking control of every aspect of your life to force you to live in denial of the lordship of Christ. What Piper has missed, badly, is the role these vaccinations play in a much bigger, much more basic movement into a technologically based, chemically and medically controlled secular totalitarianism.”

Obviously it is easier to resonate with White, at least for me. So let’s return to Knox. Piper is presented as

“…either unable or unwilling to see past the veneer of Everything is Fine™ that’s been peddled by the leftist politicians, the woke media, the “progressive” academy, and the neo-Marxist Big Tech offices.”

Knox reminds us to consider the source AND question conclusions drawn from faulty data & assumptions:

“As a math professor once told me, even if your calculations are 100% correct, your solution will be insanely wrong if your starting premises are off!”

Honestly I did enjoy reading all three pieces. Knox was my intro to the other two & his framing & take is invaluable. Piper was who I’d been searching for in appreciation of the Wonderful Teaching Carl shared with us today (now yesterday). Piper was shallow on facts but deeper on scripture in his writing compared to what the other two shared, but both Knox & White were addressing Piper’s factual fallacies more than his biblical prowess. Because I was reading Piper’s article as more of a vax skeptic, I found some of his scriptural insights to work on me in the opposite way than where he was going in his applications. White was factual, truthful, & masterfully insightful on both human nature & the creeping totalitarianism in our societies. I resonated with his take & hope to read further of how he also might “rightly divide the Word of Truth”!

I guess I would prefer to just hear from Piper on scripture, not social issues. Because White & Knox are seemingly aligned with my worldview they are more comfortable reads to me when addressing social &/or cultural concerns. Knox is an easier, quicker read, so he’s a good place to start. White dives in deep & dispenses truth, wisdom, & integrity quite liberally. Piper would do well to stick to biblical truth & could expand his sources of information so he has a better grasp of what is Really happening in the world today.

Now let’s turn to the reason for this post’s title, since many Shepherds (pastors & other leaders) are seemingly leading their flocks of Sheep to the metaphorical, if not literal, slaughter.

I’m going to share Ezekiel 34 in a moment, but this is how thinking along those lines developed, in the comments section on this excellent post by Wolfmoon:

Aubergine

AubergineOfflineCoyote October 17, 2021 08:58

AND logic.

There are markers in the vaccine, AND they are testing (using useless PCR) for infection, AND they are taking DNA.

All bases are covered. The sheep will see the “testing for viruses” part and be satisfied. The lions will see the markers and the DNA theft and walk majestically away.

They are flailing around trying anything they can think of to trick the lions into submission.

But I am a lion, and not subject to such gaslighting trickery.11 Reply

Wolf Moon

Wolf MoonOnlineAuthorWolf Reply to  Aubergine October 17, 2021 12:45

EXACTLY! That’s what I’m thinking. The small cheese was the vaccine in as many as possible. The BIG CHEESE was “everybody gives their DNA to the globonazis just to travel”. The really big cheese behind the scenes is “now we can modify and study every single person like a lab animal”. When we talked about being “controls”, they rubbed their hands in glee. “We can use that! We can surely use that!” The trick THERE is to foil that plan – to say “No, KlauSS. No DNA for you!”

One of the things they would surely be testing for would be immune function. Shedding. OMG. There is so much modification and study of us possible.

Once again….

comment image


Very clear who wants control.

“Bill Gates – Future Leader” one of them.

smiley2


smiley2OfflineCoyote Reply to  Aubergine October 17, 2021 13:13

pure lawlessness…

cleverly disguised as “peace and safety” for all !

and coming soon…

comment image


   marker

sounds like mark.

but we’re not quite there just yet.

the UN’s Sustainablity crap + the 2030 Agenda + the WEF + the Vatican + the Covid/Climate Change tyranny…and the global compliance to all of that…is creating Alinsky style chaos.

   they will need all the chaos they can manufacture…so that…

the machiavellian psychopath man of universal “peace” can show up, and quell all the chaos…

by then, ppl of the global village will have become rendered compliant enough so as to readily take the mark which will require, not just relinquishing our privacy, but something much worse : our souls.

to worship that man of lawlessness, perversion & lies.Last edited 7 days ago by smiley29 Reply

singingsoul1

singingsoul1OnlineWolverine Reply to  smiley2 October 17, 2021 15:09

We would be stronger if the Church leaders around the globe including Pop would stand with God’s people. They are not for a second time in history the past 80 years.
They failed God and humanity and will be judged more harshly for selling out God and Christ for a lousy bag of silver.4 Reply

Valerie Curren

Valerie CurrenOnlineCoyote Reply to  singingsoul1 October 18, 2021 04:36

The whole 34th chapter of Ezekiel is profoundly applicable Right Now!

Ezekiel 34
New International Version
The Lord Will Be Israel’s Shepherd
34 The word of the Lord came to me: “Son of man, prophesy against the shepherds of Israel; prophesy and say to them: ‘This is what the Sovereign Lord says: Woe to you shepherds of Israel who only take care of yourselves! Should not shepherds take care of the flock? You eat the curds, clothe yourselves with the wool and slaughter the choice animals, but you do not take care of the flock. You have not strengthened the weak or healed the sick or bound up the injured. You have not brought back the strays or searched for the lost. You have ruled them harshly and brutally. So they were scattered because there was no shepherd, and when they were scattered they became food for all the wild animals. My sheep wandered over all the mountains and on every high hill. They were scattered over the whole earth, and no one searched or looked for them.

“‘Therefore, you shepherds, hear the word of the Lord: As surely as I live, declares the Sovereign Lord, because my flock lacks a shepherd and so has been plundered and has become food for all the wild animals, and because my shepherds did not search for my flock but cared for themselves rather than for my flock, therefore, you shepherds, hear the word of the Lord: 10 This is what the Sovereign Lord says: I am against the shepherds and will hold them accountable for my flock. I will remove them from tending the flock so that the shepherds can no longer feed themselves. I will rescue my flock from their mouths, and it will no longer be food for them.

https://www.biblegateway.com/passage/?search=Ezekiel%2034&version=NIV

Let’s add the rest of Ezekiel 34 (that wasn’t included in my original comment above) for perspective:


11 
“‘For this is what the Sovereign Lord says: I myself will search for my sheep and look after them. 12 As a shepherd looks after his scattered flock when he is with them, so will I look after my sheep. I will rescue them from all the places where they were scattered on a day of clouds and darkness. 13 I will bring them out from the nations and gather them from the countries, and I will bring them into their own land. I will pasture them on the mountains of Israel, in the ravines and in all the settlements in the land. 14 I will tend them in a good pasture, and the mountain heights of Israel will be their grazing land. There they will lie down in good grazing land, and there they will feed in a rich pasture on the mountains of Israel. 15 I myself will tend my sheep and have them lie down, declares the Sovereign Lord. 16 I will search for the lost and bring back the strays. I will bind up the injured and strengthen the weak, but the sleek and the strong I will destroy. I will shepherd the flock with justice.

17 “‘As for you, my flock, this is what the Sovereign Lord says: I will judge between one sheep and another, and between rams and goats. 18 Is it not enough for you to feed on the good pasture? Must you also trample the rest of your pasture with your feet? Is it not enough for you to drink clear water? Must you also muddy the rest with your feet? 19 Must my flock feed on what you have trampled and drink what you have muddied with your feet?

20 “‘Therefore this is what the Sovereign Lord says to them: See, I myself will judge between the fat sheep and the lean sheep. 21 Because you shove with flank and shoulder, butting all the weak sheep with your horns until you have driven them away, 22 I will save my flock, and they will no longer be plundered. I will judge between one sheep and another. 23 I will place over them one shepherd, my servant David, and he will tend them; he will tend them and be their shepherd. 24 I the Lord will be their God, and my servant David will be prince among them. I the Lord have spoken.

25 “‘I will make a covenant of peace with them and rid the land of savage beasts so that they may live in the wilderness and sleep in the forests in safety. 26 I will make them and the places surrounding my hill a blessing.[a] I will send down showers in season; there will be showers of blessing. 27 The trees will yield their fruit and the ground will yield its crops; the people will be secure in their land. They will know that I am the Lord, when I break the bars of their yoke and rescue them from the hands of those who enslaved them. 28 They will no longer be plundered by the nations, nor will wild animals devour them. They will live in safety, and no one will make them afraid. 29 I will provide for them a land renowned for its crops, and they will no longer be victims of famine in the land or bear the scorn of the nations. 30 Then they will know that I, the Lord their God, am with them and that they, the Israelites, are my people, declares the Sovereign Lord. 31 You are my sheep, the sheep of my pasture, and I am your God, declares the Sovereign Lord.’”

Footnotes

  1. Ezekiel 34:26 Or I will cause them and the places surrounding my hill to be named in blessings (see Gen. 48:20); or I will cause them and the places surrounding my hill to be seen as blessed

New International Version (NIV)

Holy Bible, New International Version®, NIV® Copyright ©1973, 1978, 1984, 2011 by Biblica, Inc.® Used by permission. All rights reserved worldwide.

Here is that same passage in a couple popular versions around the Q-Tree, the King James Version & the Douay-Rheims 1899 American Edition:

https://www.biblegateway.com/passage/?search=Ezekiel+34&version=KJV

https://www.biblegateway.com/passage/?search=Ezekiel+34&version=DRA

VC housekeeping note, footnotes from Bible Gateway show up as numbered here though they are lettered within the biblical text, please make adjustments (a=1, etc.).

I was going to expound on that passage but I think at this point it might be best for the Word of God to speak to your own heart as He wills…

Here is an example of a church that has gone overboard in the wrong direction, way beyond Piper’s vax persuasion. They wouldn’t allow the unvax’d to enter nor apparently work there, even those with medical or religious exemptions. I really hope the majority of the remaining flock got saline instead of the real clot shot!

https://notthebee.com/article/georgia-church-requiring-worshippers-to-show-proof-of-vaccination

Closer to home there have been disturbing trends. Our old home church seemed to go pretty overboard on Covid craziness. Earlier we visited to support a family member’s music ministry. At that time masks were strictly & personally enforced by deacons or elders, significantly impeding worship AND fellowship. They had Covid stations w/ hand sanitizer & masks positioned by entrances & strategically elsewhere in the building. Thankfully, over the summer the restrictions were relaxed as in people were encouraged to wear masks rather than “required”. At our daughter’s wedding there in August only a very small minority, like 2% of attendees, were pretty consistently masking.

My parents’ very large & prosperous church went through a season of only having online services. They spent exorbitant amounts of money to install various health measures including outfitting multiple gathering rooms w/ microbe killing lights, I believe. Since they also operate a Christian School they may have been proceeding with an abundance of caution. The online services were a blessing to my parents who may continue to do church that way when health or weather issues make attendance an hour away from home much more challenging. More churches having an online presence AND broadcasting services can be one of the seeming few positive changes since Covidiocy has mesmerized global sheep & tantalized totalitarians!

My husband has been very activie in music & leadership in a local church that might best be described as “seeker-friendly” & more youth oriented. This church is part of an extended church plant ministry in Michigan & most of the leadership are on the young side too. Michael, my husband, got one of our sons involved in music ministry there & our daughter-in-law was active in the children’s ministry. M & son got quite close to a Conservative Christian church employee who grew increasingly frustrated with various “woke” aspects of leadership that he was unable to sway whatsoever, even though he was on the church board. He finally moved out of state, largely to escape what was becoming toxic church culture.

Our son chose to leave because he couldn’t stand the mask mandates that were pretty heavy-handed for many months. Our daughter-in-law lost her motivation when they shut down all of the children’s ministry areas due to Covid lies. This church has had an extensive youth & children’s ministry & much outreach to the community. What had been a welcoming atmosphere, complete w/ complementary coffee & treats, turned into a desert of fear, in so many ways. Talk about serious mixed messaging…

My husband’s experiences with music there were becoming so frustrating compared to pre-covid freedoms. Significant enforced masking. No access to normal musician hang out rooms before or between services–much interpersonal ministry had occurred spontaneously in that environment previously. No longer were refreshments provided for the worship team (nor the church at large, for that matter). In fact they often had to wait in their cars when they weren’t on stage or in the service. Michael would hit a nearby drive-through & pick up cheap breakfast food to share with his team but it wasn’t even close to the same.

I attended service there at Easter & M had to RSVP so the church would have a head count & not get overcrowded. I’m not sure if they were attempting to limit numbers due to “social distancing” or what. Our son wasn’t able to make the RSVP cut so he stayed home on Easter, again. I refused to wear a mask & nobody called me on it, which was a relief. There were Many empty chairs so our son could likely have come too but the “restrictions” made the concept of joyfully coming into the House of the Lord pretty foreign–Tragic! Compared to the previous Easter, when virtually All Michigan churches were closed, this was an “improvement”. What a very twisted way to disrupt the celebration of Jesus’ Resurrection, the very lynchpin of the Church’s existence. Surely just accidental tyranny–NOT!

Although my husband Loves being a part of that music ministry AND has developed a number of quality relationships that have extended beyond just fellowship within the church walls, he has stated on numerous occasions that if that church ramps up the Covid crap again he is going to have to leave.

Churches bowing to government lies, tyranny, AND deception is transforming the natural areas of ministry that should be unfettered and subject to the leading of the Holy Spirit, Not the permission of The State! To see a pastor, like Piper, shilling for the death shots is beyond horrifying to me. Having ubiquitous masking & promoting fears & isolation & a lack of human contact (touch, hugging, holding hands to pray, shaking hands to greet others, laying hands on others in prayer &/or fellowship, facial expressions, etc.) are all destructive of the church & in effect are putting the Light of Christ under a metaphorical bushel.

Early in the Scamdemic when our dictator in the Governor’s mansion (Gretchen Half-Whitmer, to quote Trump) banned churches from being opened, or even people leaving their own households, we had a House Church service in our home. People from Four different households attended (family & pending family) and we were technically in violation of some illegitimate “mandate”. It was joyful, liberating, moving, godly, AND surreal. I wondered if we were, as a society, on the cusp of seeing the church driven underground, like in China or ancient Rome. Honestly our home church service was more meaningful & powerful with God’s presence than Any church building service I’d experienced in Many Years (my issues, not necessarily the church’s “fault”).

If driven underground The Church, The True Bride of Christ, will survive AND thrive…& suffer significantly…

In contrast to some of the above, other family members have been blessed to discover a vibrant & growing church about an hour away that did not bow the knee at Any level to the “pandemic” paralysis. Apparently this church has been on the front lines in fighting against illegitimate powers & even has some legal eagles in the congregation that have contributed significantly to clipping the Nazgul’s wings (Gretchen Whitmer). Standing up to tyranny may be One of the key factors why this church is growing so much right now.

I went to the church’s website to see if any of their Covid “activism” featured prominently, and it did not. Here is a link to an article from earlier in the scamdemic that quotes the pastor & gives context to his decision to keep their church open against manifest pressure from the system. It’s interesting given our hindsight view on much of what was happening then.

https://www.whmi.com/news/article/brighton-pastor-still-holding-in-person-services

Another distant family member, on the other side of the state, has recounted how her small community church has fared during the Covid manufactured “crisis”. Her church stayed mostly open, didn’t mask, & didn’t do social distancing. Many people got sick AND now have natural immunity. Many congregants are well-versed in alternative healing approaches to Covid & have been helping to bring healing to their community whenever the illness kicks in. I’ve shared some of her approaches here before & hope to do so more fully in another post…eventually.

Alarmingly on Detroit area TV there are a number of pastors featured prominently in Michigan propaganda pieces trying to still convince the masses of the importance of taking the clot shot. Every time I see one I think of Margaret Sanger’s desire to keep the “uppity” “undesirables” from thinking for themselves & not getting abortions. Basically the de-population agenda is still finding “spiritual shills” to sell their snake oil!

OK I went looking at Michigan.gov to see if I could find an example commercial featuring a faith leader & found this document on fetal cells & the “vax”. At the bottom are links to various faith organizations statements on the topic. I would guess the state isn’t linking to anyone who objects to the “vax” but am not taking the time to check. All of the links say Catholic or Vatican except the Charlotte Lozier Institute.

https://www.michigan.gov/documents/coronavirus/COVID-19_Vaccines_and_Fetal_Cells_031921_720415_7.pdf

Here is a link with a plethora of presumably propaganda materials promoting the clot shot from Michigan.

https://app.box.com/s/4cy0so8b5ux8dzmdcj5297bikvc4sejz

Here’s a link for the TV spots folder from the above file:

https://app.box.com/s/4cy0so8b5ux8dzmdcj5297bikvc4sejz/folder/129356162329

It looks like in order to view one needs to download the file. The top one tries to convince pregnant women the shot is safe. The seventh video features one of the pastors lamenting people dying alone. From the second from the bottom on page 2, link below, there is a spot on “keeping the faith”.

https://app.box.com/s/4cy0so8b5ux8dzmdcj5297bikvc4sejz/folder/129356162329?page=2

Just even considering this material makes me feel like I need to take a shower. This is like the PR campaign to convince people to willingly enter the Nazi cattle cars & showers, bringing about their own destruction!

Here’s an example of the kind of pastoral leadership I would much rather see!

Here’s the larger scene preceding that one:

I’ve spoken/written numerous times about movie-quoting as a language in our family, including at my inaugural Q-Tree post immediately below. Comments are closed now, but well worth reading. If someone might care to comment there is a copy of that post on my main blog, Special Connections, also below.

https://wqth.wordpress.com/2020/05/02/luna-wolf-pack/

Oh for a protective, patriotic pastor’s heart to arise in these dark days! Here is a possibility. I haven’t watched this video in full just share it for your consideration…It’s almost 2 hours & from earlier this month. Interestingly You Tube won’t allow that video to embed…hmm…just a glitch in the matrix surely!

Medical Freedom: Educate. Don’t Mandate.

1,072 views Streamed live on Oct 6, 2021

https://youtu.be/Vv0cvPPmRe0

Here is an appropriate warning from scripture for those who presume to teach others.

James 3:1 Not many of you should become teachers, my fellow believers, because you know that we who teach will be judged more strictly

I went looking for some scriptures that might be applicable & encouraging in these dark days, here is truth!

2 Samuel 22 New International Version

David’s Song of Praise

22 David sang to the Lord the words of this song when the Lord delivered him from the hand of all his enemies and from the hand of Saul. He said:

“The Lord is my rock, my fortress and my deliverer;
    my God is my rock, in whom I take refuge,
    my shield[a] and the horn[b] of my salvation.
He is my stronghold, my refuge and my savior—
    from violent people you save me.

“I called to the Lord, who is worthy of praise,
    and have been saved from my enemies.
The waves of death swirled about me;
    the torrents of destruction overwhelmed me.
The cords of the grave coiled around me;
    the snares of death confronted me.

“In my distress I called to the Lord;
    I called out to my God.
From his temple he heard my voice;
    my cry came to his ears.
The earth trembled and quaked,
    the foundations of the heavens[c] shook;
    they trembled because he was angry.
Smoke rose from his nostrils;
    consuming fire came from his mouth,
    burning coals blazed out of it.
10 He parted the heavens and came down;
    dark clouds were under his feet.
11 He mounted the cherubim and flew;
    he soared[d] on the wings of the wind.
12 He made darkness his canopy around him—
    the dark[e] rain clouds of the sky.
13 Out of the brightness of his presence
    bolts of lightning blazed forth.
14 The Lord thundered from heaven;
    the voice of the Most High resounded.
15 He shot his arrows and scattered the enemy,
    with great bolts of lightning he routed them.
16 The valleys of the sea were exposed
    and the foundations of the earth laid bare
at the rebuke of the Lord,
    at the blast of breath from his nostrils.

17 “He reached down from on high and took hold of me;
    he drew me out of deep waters.
18 He rescued me from my powerful enemy,
    from my foes, who were too strong for me.
19 They confronted me in the day of my disaster,
    but the Lord was my support.
20 He brought me out into a spacious place;
    he rescued me because he delighted in me.

21 “The Lord has dealt with me according to my righteousness;
    according to the cleanness of my hands he has rewarded me.
22 For I have kept the ways of the Lord;
    I am not guilty of turning from my God.
23 All his laws are before me;
    I have not turned away from his decrees.
24 I have been blameless before him
    and have kept myself from sin.
25 The Lord has rewarded me according to my righteousness,
    according to my cleanness[f] in his sight.

26 “To the faithful you show yourself faithful,
    to the blameless you show yourself blameless,
27 to the pure you show yourself pure,
    but to the devious you show yourself shrewd.
28 You save the humble,
    but your eyes are on the haughty to bring them low.
29 You, Lord, are my lamp;
    the Lord turns my darkness into light.
30 With your help I can advance against a troop[g];
    with my God I can scale a wall.

31 “As for God, his way is perfect:
    The Lord’s word is flawless;
    he shields all who take refuge in him.
32 For who is God besides the Lord?
    And who is the Rock except our God?
33 It is God who arms me with strength[h]
    and keeps my way secure.
34 He makes my feet like the feet of a deer;
    he causes me to stand on the heights.
35 He trains my hands for battle;
    my arms can bend a bow of bronze.
36 You make your saving help my shield;
    your help has made[i] me great.
37 You provide a broad path for my feet,
    so that my ankles do not give way.

38 “I pursued my enemies and crushed them;
    I did not turn back till they were destroyed.
39 I crushed them completely, and they could not rise;
    they fell beneath my feet.
40 You armed me with strength for battle;
    you humbled my adversaries before me.
41 You made my enemies turn their backs in flight,
    and I destroyed my foes.
42 They cried for help, but there was no one to save them—
    to the Lord, but he did not answer.
43 I beat them as fine as the dust of the earth;
    I pounded and trampled them like mud in the streets.

44 “You have delivered me from the attacks of the peoples;
    you have preserved me as the head of nations.
People I did not know now serve me,
45     foreigners cower before me;
    as soon as they hear of me, they obey me.
46 They all lose heart;
    they come trembling[j] from their strongholds.

47 “The Lord lives! Praise be to my Rock!
    Exalted be my God, the Rock, my Savior!
48 He is the God who avenges me,
    who puts the nations under me,
49     who sets me free from my enemies.
You exalted me above my foes;
    from a violent man you rescued me.
50 Therefore I will praise you, Lord, among the nations;
    I will sing the praises of your name.

51 “He gives his king great victories;
    he shows unfailing kindness to his anointed,
    to David and his descendants forever.”

Footnotes

  1. 2 Samuel 22:3 Or sovereign
  2. 2 Samuel 22:3 Horn here symbolizes strength.
  3. 2 Samuel 22:8 Hebrew; Vulgate and Syriac (see also Psalm 18:7) mountains
  4. 2 Samuel 22:11 Many Hebrew manuscripts (see also Psalm 18:10); most Hebrew manuscripts appeared
  5. 2 Samuel 22:12 Septuagint (see also Psalm 18:11); Hebrew massed
  6. 2 Samuel 22:25 Hebrew; Septuagint and Vulgate (see also Psalm 18:24) to the cleanness of my hands
  7. 2 Samuel 22:30 Or can run through a barricade
  8. 2 Samuel 22:33 Dead Sea Scrolls, some Septuagint manuscripts, Vulgate and Syriac (see also Psalm 18:32); Masoretic Text who is my strong refuge
  9. 2 Samuel 22:36 Dead Sea Scrolls; Masoretic Text shield; / you stoop down to make
  10. 2 Samuel 22:46 Some Septuagint manuscripts and Vulgate (see also Psalm 18:45); Masoretic Text they arm themselves

New International Version (NIV)

Holy Bible, New International Version®, NIV® Copyright ©1973, 1978, 1984, 2011 by Biblica, Inc.® Used by permission. All rights reserved worldwide.

Here are links to the King James & Douay-Rheims versions for your convenience:

https://www.biblegateway.com/passage/?search=2+Samuel+22&version=KJV

https://www.biblegateway.com/passage/?search=2+Samuel+22&version=DRA

Another passage filled with truth AND hope!

Job 5 New International Version

“But if I were you, I would appeal to God;
    I would lay my cause before him.
He performs wonders that cannot be fathomed,
    miracles that cannot be counted.
10 He provides rain for the earth;
    he sends water on the countryside.
11 The lowly he sets on high,
    and those who mourn are lifted to safety.
12 He thwarts the plans of the crafty,
    so that their hands achieve no success.
13 He catches the wise in their craftiness,
    and the schemes of the wily are swept away.
14 Darkness comes upon them in the daytime;
    at noon they grope as in the night.
15 He saves the needy from the sword in their mouth;
    he saves them from the clutches of the powerful.
16 So the poor have hope,
    and injustice shuts its mouth.

17 “Blessed is the one whom God corrects;
    so do not despise the discipline of the Almighty.[a]
18 For he wounds, but he also binds up;
    he injures, but his hands also heal.
19 From six calamities he will rescue you;
    in seven no harm will touch you.
20 In famine he will deliver you from death,
    and in battle from the stroke of the sword.
21 You will be protected from the lash of the tongue,
    and need not fear when destruction comes.
22 You will laugh at destruction and famine,
    and need not fear the wild animals.
23 For you will have a covenant with the stones of the field,
    and the wild animals will be at peace with you.
24 You will know that your tent is secure;
    you will take stock of your property and find nothing missing.
25 You will know that your children will be many,
    and your descendants like the grass of the earth.
26 You will come to the grave in full vigor,
    like sheaves gathered in season.

27 “We have examined this, and it is true.
    So hear it and apply it to yourself.”

Footnotes

  1. Job 5:17 Hebrew Shaddai; here and throughout Job

New International Version (NIV)

Holy Bible, New International Version®, NIV® Copyright ©1973, 1978, 1984, 2011 by Biblica, Inc.® Used by permission. All rights reserved worldwide.

Links to the KJV and the DRA:

https://www.biblegateway.com/passage/?search=Job+5&version=KJV

https://www.biblegateway.com/passage/?search=Job+5&version=DRA

I’m searching for scriptures based on the word “rescue” AND there are Many. Here are more that leap out to me: Psalm 18; Isaiah 35; & II Peter 2. Also the many shared below!

Isaiah 46:4Even to your old age and gray hairs I am he, I am he who will sustain you. I have made you and I will carry you; I will sustain you and I will rescue you. In Context | Full Chapter | Other Translations


  • Ezekiel 34:27
    The trees will yield their fruit and the ground will yield its crops; the people will be secure in their land. They will know that I am the Lord, when I break the bars of their yoke and rescue them from the hands of those who enslaved them. In Context | Full Chapter | Other Translations

Daniel 3:28Then Nebuchadnezzar said, “Praise be to the God of Shadrach, Meshach and Abednego, who has sent his angel and rescued his servants! They trusted in him and defied the king’s command and were willing to give up their lives rather than serve or worship any god except their own God. In Context | Full Chapter | Other Translations

Daniel 6:27He rescues and he saves; he performs signs and wonders in the heavens and on the earth. He has rescued Daniel from the power of the lions.” In Context | Full Chapter | Other Translations

Zephaniah 3:19At that time I will deal with all who oppressed you. I will rescue the lame; I will gather the exiles. I will give them praise and honor in every land where they have suffered shame. In Context | Full Chapter | Other Translations

Luke 1:74to rescue us from the hand of our enemies, and to enable us to serve him without fear In Context | Full Chapter | Other Translations

Acts 12:11Then Peter came to himself and said, “Now I know without a doubt that the Lord has sent his angel and rescued me from Herod’s clutches and from everything the Jewish people were hoping would happen.” In Context | Full Chapter | Other Translations

Acts 26:16-18 New International Version

16 ‘Now get up and stand on your feet. I have appeared to you to appoint you as a servant and as a witness of what you have seen and will see of me. 17 I will rescue you from your own people and from the Gentiles. I am sending you to them 18 to open their eyes and turn them from darkness to light, and from the power of Satan to God, so that they may receive forgiveness of sins and a place among those who are sanctified by faith in me.’

2 Timothy 4:18 New International Version

18 The Lord will rescue me from every evil attack and will bring me safely to his heavenly kingdom. To him be glory for ever and ever. Amen. Read full chapter2 Timothy 4:18 in all English translations

As you can see from the numerous scriptures shared above God’s Word is full of hope for us all! Please dive in for yourself & see how God might speak directly to you in your hour of need from His Word!!!

Here is the passage I was originally searching for, Absolutely Applicable to pastors, leaders, AND to us all!

Proverbs 24:10-12 New International Version

Saying 25

10 If you falter in a time of trouble,
    how small is your strength!
11 Rescue those being led away to death;
    hold back those staggering toward slaughter.
12 If you say, “But we knew nothing about this,”
    does not he who weighs the heart perceive it?
Does not he who guards your life know it?
    Will he not repay everyone according to what they have done?

God grant us the wisdom, grace, AND strength to speak the truth in love AND to rescue those who are “staggering toward slaughter”.

Well God Bless you AND thank you for reading along with these thoughts today. I hope you are encouraged, inspired, AND challenged to go forth boldly proclaiming grace And truth. In Jesus Love, Valerie

VC note on use of AND throughout. This is a bit of an inside joke at The Q-Tree as Wolfmoon is fond of using the term “AND logic”, as in many times things aren’t either or but more like both AND…

PS, if this post has blessed you an earlier post reflecting on God’s intervention in our battles is below:

Transhumanism – The Great New Reset Is The Same Old Serfdom

A Guest Post by Gail Combs


1.

“Own Nothing and Be Happy”: The Great Reset’s Vision of the Future

What does the Elite Cabal actually have planned for us and what indications are there showing how they are going to implement those plans.

HISTORICAL BACKGROUND

There are really only two types of governments.

  1. A government FOR the People that protects the RIGHTS of the INDIVIDUAL.
  2. A government FOR the Elite that controls the people and strips them of their wealth and whatever else the Elite may decide to take.

As I said before, since 1776, the European Aristocracy and City of London have been trying to retake the USA by any means they can think of.

G. Edward Griffin in his Talk on the Federal Reserve said:

….interest on any loan of fiat money (meaning money made out of nothing)…. [is a] dead short across the productive element of society. Money being taken from people who are working hard providing the material and the labor. They don’t even know that this is being taken from them and it’s in this huge river of wealth flowing into the banking cartel…. You are led to the question of where is this river flowing? Where’s it going? Get a picture of this that it’s all going into a lake somewhere and maybe there’s a dam and the wealth is building up and somewhere they’re getting it all. Getting it no, they’re spending it. They’re not accumulating it at all. What are they spending it for? The answer may surprise you. They’re not buying more yachts and mansions with this money, they’ve already got all of those they possibly want…. When a person has all the wealth that you could possibly want for the material pleasures of life, what is left? Power. They are using this river of wealth to acquire power over you and me and our children. They are spending it to acquire control over the power centers of society…

And they did so. In 1913, they passed the Federal Reserve Act and the 16th Amendment. The 16th was passed by Congress on July 2, 1909, and ratified February 3, 1913, the 16th amendment established Congress’s right to impose a Federal income tax. ”…the income tax amendment became part of the Constitution by a curious series of events culminating in a bit of political maneuvering that went awry.….”

LINK

After that, it didn’t take long for the Elite to jump into action. In 1915, they grabbed control of the leading newspapers. It was even reported in the Congressional Record two years later:

Congressional Record, February 9, 1917 — J.P. Morgan interests buy 25 of America’s leading newspapers and insert their own editors

In 1917 … the Bolshevik revolution actually was financed by wealthy financiers in London and New York. Lenin and Trotsky were on the closest of terms with these moneyed interests both before and after the Revolution. Those hidden liaisons have continued to this day and occasionally pop to the surface…

Knowing that, is it any wonder that the Communists have taken over our schools, universities and now our government?

As Charles Buriss writes:

This classic 1911 cartoon by the internationally acclaimed Communist cartoonist Robert Minor needs to be resurrected and posted on the front pages of every regime Establishment newspaper, beginning with the Wall Street Journal, the New York Times, and the Washington Post… Sadly, the cartoon desperately needs to be updated for 2021 with the knelling, decrepit usurper Joe Biden surrounded by the leading honchos of Big Tech, Big Pharma, Wall Street banksters, and top CEOs of the Woke Fortune Five Hundred, eagerly lined up to French kiss the ass of Chinese Communist Party Chairman Xi Jinping.

When you look at it Communism, is nothing more than feudalism in a new dress and fresh lipstick.

Karl Marx does not even hide this.

“The bourgeoisie, wherever it has got the upper hand, has put an end to all feudal, patriarchal, idyllic relations. It has pitilessly torn asunder the motley feudal ties that bound man to his ‘natural superiors,’ and has left remaining no other nexus between man and man than naked self-interest, callous ‘cash payment….” – The Communist Manifesto

I am pretty sure the City of London and US Federal Reserve are also tied to the Chinese Communist party but that Deep Dive is for another day.

At first I thought control would be through RFID chips, (See ChiefIO’s August 2013, Experiments in Mobility and Anonymity) and digital currency, all thanks to OH!Bummercare.

I read the Obama ‘Health’ ‘Care’ bill (HCA) and here are some of the goodies I found:

Pg 30 Sec 123 of HC bill a Government committee (good luck with that!) will decide what treatments/benefits a person may receive.

Pg 42 of HC Bill The Health Choices Commissioner will choose your HC Benefits for you.

Pg 239 Line 14-24 HC Bill Government will reduce physician services for Medicaid. Seniors, low income, poor affected.

PG 50 Section 152 in HC bill HC will be provided to ALL non US citizens, illegal or otherwise.

Pg 170 Lines 1-3 HC Bill Any NONRESIDENT Alien is exempt from individual taxes. (Americans will pay.)

Pg 58 HC Bill Government will have real-time access to individual’s finances and a National ID Healthcard will be issued!

Pg 195 HC Bill -officers & employees of HC Admin (the GOVERNMENT) will have access to ALL Americans’ finances and personal records.

Pg 59 HC Bill lines 21-24 Government will have direct access to your bank accts for funds transfer.

However there was another goody buried in the bill that had NOTHING to do with healthcare and is now coming back in a different version… ON STEROIDS!

Section 9006 of the health care bill — just a few lines buried in the 2,409-page document — mandates that beginning in 2012 all companies will have to issue 1099 tax forms not just to contract workers but to any individual or corporation from which they buy more than $600 in goods or services in a tax year. The stealth change radically alters the nature of 1099s and means businesses will have to issue millions of new tax documents each year. Right now, the IRS Form 1099 is used to document income for individual workers other than wages and salaries… The bill makes two key changes to how 1099s are used. First, it expands their scope by using them to track payments not only for services but also for tangible goods. Plus, it requires that 1099s be issued not just to individuals, but also to corporations…. http://money.cnn.com/2010/05/05/smallbusiness/1099_health_care_tax_change/

(This section got repealed ASAP after Sam’s Club et al realized the amount of paperwork they were in for.)

However the interesting tidbit was this:

”…the IRS has stated that even for transactions covered by the law, they intend to exempt purchases made with credit cards….”

Can you say DRIVE PEOPLE TO DIGITAL CURRENCY???

CLEARING UP 1099 CONFUSION

The NEW 1099 Law – IRS Form 1099-MISC

This 1099 law (Section 9006 of the health care bill passed earlier this year) is scheduled to go into effect January, 2012. Under this law you will have to report ALL purchases of goods and services over $600 (including smaller purchases aggregated over the full year.) Yes, that includes your retail clients, your fellow dealers (no more corporate exemption), office supply stores, show travel providers (hotels & airlines), etc.

Small businesses and associations (including ICTA) have protested this provision so fervently that Congress – and even President Obama – have acknowledged that it is a problem. Potential fixes include repeal of Section 9006 (ICTA’s strongly preferred solution), raising the dollar amount threshold to $5,000, exempting businesses with fewer than 25 employees, and exempting transactions paid for via credit or debit cards. However, the administration is extremely sensitive to the word “repeal” as applied to any part of the health care bill.

https://forums.collectors.com/discussion/795970/1099-information-you-need-to-act-on-now-from-icta


2.

TRANSHUMANISM CONFERENCES

Report on conference:

https://rumble.com/vnswds-transhumanist-techonocult-meets-to-discuss-world-domination.html

Article: https://www.sott.net/article/459537-Transhumanists-gather-in-Spain-to-plan-global-transformation

Humans will be DESIGNED –  Made In China 2025 – CHINA WOULD DOMINATE THE TEN INDUSTRIES NEEDED for the FOURTH INDUSTRIAL REVOLUTION. Five or six converge for the ‘Singularity’ –> Immortality for ELITES. Think organs-ON-Demand FROM CHINA https://rumble.com/vkkmze-ccp-enforcing-live-organ-harvesting.html

and now Human – Computer interface to control the serfs.

https://rumble.com/vnswe2-made-in-china-2025.html

WORSE IT EVEN INCLUDES RELIGION AND CHRISTIANS!!!

(And not just Catholics.)

Pope sponsored a conference on Transhumanism at Vatican on 23th of October – HUMANITY 2.0 AND THE VATICAN DISCUSS THE TRANSHUMAN CODE

SEE: Vatican is captured by the World Economic Forum transhumanist death cult where a lot of different articles are gathered supporting that statement.

…The meeting has been described as an “exclusive gathering of technology, corporate, finance, government, academic, ecclesiastic and media leaders … to catalyze awareness and establish the best path forward with humanity and technology in harmony.”…

And yes, that is Francis Collins, FauXi’s old boss.

October 21, 2021 Warning Over Electronic Religion

https://rumble.com/vo1dkz-warning-over-electronic-religion.html

2:20 Joe Allen:….imothy O’Leary talked of creating an electronic religion in the 60s…Already been enacted via 2nd life the very popular simulation space…… D.J. Soto who founded the First VR Church, founded in 2015, 2016. the way it works is you put on your oculist goggles, you are in a virtual sanctuary space surounded by cartoonish avitars, and listening to his vapid sermon behind the pulpit. ….What does he hold sacred… In 2019, he held a gender bending transracial baptism in which he was depected as a buff black man, and a man at the other end is depicted as a cartoon girl, and there were homo-erotic jokes cracked throughout the entire thing. But when I confronted Pastor D.J. Soto about this via email, he came back with, I would do it again in a heart beat, you just have to be more open minded. He has also floated the idea of having cartoon jesuses in 3-D virtual space that congregates can interact with directly. And this isn’t just off in the corner, these people have been boosted by NewsWeek, BBC, Wired Mag. And that should raise flags already….

Transhumanists Aim To Replace God With Machines Through Digital Immortality

The Five Pillars of Transhumanism

https://rumble.com/vng4he-the-five-pillars-of-transhumanism.html

Elon Musks’ Satanic Dreamworld – Steve Bannon’s War Room: Pandemic

https://citizensoftheamericanrepublic.org/2021/09/29/elon-musks-satanic-dreamworld-steve-bannons-war-room-pandemic/

https://www.americanthinker.com/articles/2021/09/elon_musks_crusade_to_save_you__by_destroying_your_humanity.html

Elon Musk and the Pagan Witch Who Summoned a Computer God

https://salvomag.com/post/elon-musk-and-the-pagan-witch-who-summoned-a-computer-god

https://citizensoftheamericanrepublic.org/2021/09/30/a-technocracy-is-a-greater-threat-to-freedom-than-fascism-and-communism-steve-bannons-war-room-pandemic/

Facebook’s Plans ON Becoming A Metaverse Company

?Vintage? Scriptures talk about an Astro plane which is an Immaterial Plane of Existence. We are technologically realizing that deeply ancient notion of an immaterial plane of existence. plane A metaverse is a persistent social virtual world where one can live, create, work, and play. DEEP FUTURE Mind Uploads a la Permutation City Metamind group or Hive Minds Exploratory Van Neumann metaverse-ships From Felipe Van ?Medervelda? Virtual reality pioneer. Speaking @ Transvision 2021.

April 2, 2021 – War Room Previews ‘Unholy Saturday of Transhumanism’ Special (7 min.)

https://rumble.com/vfbblp-war-room-previews-unholy-saturday-of-transhumanism-special.html

https://stream.org/the-unholy-saturday-of-transhumanism/

Includes TWO 48 minute War Rooms ON TRANSHUMANISM PLUS AN ESSAY By JASON JONES & JOHN ZMIRAK  AUTHORS OF ‘The Race to Save Our Century [a book that ] pointed to the causes of the genocides in that epoch in various forms of “Subhumanism.” 

LINK: https://stream.org/the-unholy-saturday-of-transhumanism/

Descent Into Hell: Transhumanism and the New Human Race

https://citizensoftheamericanrepublic.org/2021/04/03/episode-848-descent-into-hell-transhumanism-and-the-new-human-race-part-2/


3.

Bobby Piton

“As Bobby Piton reminded us, the Nazis, thanks to IBM, even knew the number of animals and how much food a farm grew.”

David Clement interview of Bobby Piton:

https://rumble.com/vm5y0r-bobby-piton-finance-wizard.-election-fraud-fighter.-u.s.-senator.html


4.

The Clot Shot and Graphene Oxide

Transhumanism and the connecting of the serfs to computer Will-he Nil-he certainly would explain Graphene Oxide in the Clot Shot and the MASSIVE PUSH to get everyone vaccinated wether it kills you or not.

It also explains the Magnetic Shot Hoax used to discredit the addition of graphene to the shots.

Stew Peters Show Interview with Former Pfizer Employee | Poisonous Graphene Oxide is 100% in the Vaccines

and

Can Graphene Oxide Turn The Human Body Into A Networked Biological Computer?

https://vimeo.com/572772371

…Since graphene oxide “is considered to be the world’s thinnest, strongest and most conductive material”, how would this function in the body? Could it transmit frequency into and out of our bodies? Well according to other studies, graphene oxide is a “high-efficient interconnector in radio-frequency range”, in other words, it “has high potential for transmitting signals at gigahertz ranges” … “0.5–40 GHz. Radio- frequency transmission”. This would include 4G, 5G, and other wifi and microwave frequencies. So now we have many more questions than answers….

– Gail Combs


GC/wm