Tag: Bing Liu

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf

Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …

The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …

Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …

I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.

A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.

Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.

Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.

This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:

Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA

From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.

Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-

Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK

In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.

So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.

Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.

This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With a little help from our “friends in high places”!

Oh, yeah – we’re headed back to the WHITE HOUSE!

HANG ON for the ride of your life!

Dedication

Image: https://i.pinimg.com/originals/d5/e5/ad/d5e5ad861f1fc08b93a6d511ed5ff19f.jpg

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655

Our heroine in high definition!

The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.

MINOR CHANGE NUMBER 1

Never talk about committing violence in a reply to Wolf or in response to anything Wolf has said, or you may get put into moderation so that your comments can be screened. This is ONLY because DHS is now playing door-knock Gestapo with people who have spoken at school board meetings, made public comments, etc. DHS regime jackboots are knocking on doors of school board mama bears and stupidly insinuating potential violence from things people say or don’t say on social media. A guy in Ohio pointed his FINGER at the school board, and they went after him, armed with pictures of the pointing, and screen captures of online comments. Yeah.

SO – give the Nazis ZERO ammo. Keep any mention of violence, even joking, away from Wolf, so that he doesn’t have to “explain” humor to humorless jackboots who pretend not to know things.

As for discussion of “violent humor” among yourselves (e.g., “#TeamHeadsOnPikes”), just use whatever discretion you think is appropriate for yourselves. I will only put you in moderation if your comments create problems for ME or THIS SITE, but not if they only impact you.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….

The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.

A bit of a paraphrase, I’ll admit, but it makes a few key points!

Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Here is Wheatie’s selection from just over 2 years ago!

“For your listening enjoyment, I offer this uplifting composition from Andreas Kübler of Really Slow Motion, titled ‘Save Me’:”

Wheatietoo

LINK: https://www.theqtree.com/2021/01/25/20210125-joe-biden-didnt-win-daily-open-thread/

Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.

Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

This is the weirdest set of “data joins” in my history of researching things, but it is all starting to make sense – so I’m going to invite you into the story.

The story starts recently, when this tweet appeared in my timeline:

Weirdly, I cannot find this tweet in context in Elena’s tweets or replies on Twitter. If you check out her Twitter, she is a solid retweeter of a lot of great stuff – but I have no clue where she found this.

Anyway, after I saw it, it led to THIS post:

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …

If you have not read that, please at least read a bit of it, including the “TL;DR” part, so that you can make sense of the rest of THIS post.

I did some posting about this yesterday on Twitter. Surprisingly there was no traction. This thread still has barely over 100 views on the first tweet.

I moved from the normal posting strategy, to “replying to the bigs”. Same problem – no traction.

It’s even worse today. All day I have been trying to get people to pay attention to this, and my Tweets go nowhere. However, a few examples will show you the core message, almost better than a TL;DR would.

I dumped an entire thread on a long response to ChiefNerd…..

I started replying about this stuff everywhere!

I found ONE other person tweeting about the paper – and he had almost zero engagement. And I only found the guy because I searched on the special sequence, PRRARSV.

Eventually, I even tried “mystery” to get engagement, and to get past any censorship.

No dice.

Anyway, later, THIS happened with Aubergine, from my earlier speculation about a Codemonkey Tweet.

LONG THREAD.

SO – anyway – I started a thread on Twitter…..

[We will see where this goes today. I will add more thoughts as we go on. Publishing now, for the midnight unofficial deadline….]

Wolfie’s Wheatie’s Word of the Day Year Week:

translocation

noun

  • a change of location.
  • a transfer of a chromosomal segment to a new position, especially on a nonhomologous chromosome. Also called chromosomal translocation.
  • a chromosomal segment that is translocated.

Sub-types:

  • chromosomal translocation: see above.
  • reciprocal translocation: balanced, 2-way exchanges of material between chromosomes.
  • non-reciprocal translocation: unbalanced, one-way movement between chromosomes.
  • Robertsonian translocation: a special type of chromosome rearrangement merging long arms of a chromosome and eliminating the short arms.
  • nuclear translocation: movement of genetic material into or out of the cell nucleus.

Used in an Abstract:

Although the S [spike] protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.

Shown in an Image:

Figure 4. Colocalization between S mRNA and S protein inside infected cells. The images (see Figure 3) were analyzed by using the surface rendering and colocalization features of IMARIS. S protein and S mRNA distribution and colocalization in the cytoplasm (top panel), on the nuclear surface (middle panel) and inside the nucleus (bottom panel). The specific region of colocalization is indicated by a white spot. Scale bar 0.5 μm.

ENJOY THE SHOW

Have another great week!

W

Signs of COVID Plot Downfall

Don’t relax now – we have them ON THE RUN

There are many SIGNS that we have scored a MIDWAY VICTORY…..

……in the fight against the COVID PLOT. I’m not kidding. Bringing down the SPIKE PROTEIN – the ABORTION PROTEIN – and the

  • WHOLE-BODY SPREADING
  • THROUGH-SKIN SHEDDING
  • TEEN-AGER DEADING

mRNA vaccine – is like – in reference to the “event” 20 years earlier….

…..stopping the “endless wars” immediately after Afghanistan, because we figured out the SCAM.

I want to SHOW YOU THE SIGNS.

BUCKLE UP for a FAST RIDE.

Stay tuned for the FINAL ONE. It’s the BIGGIE.

1.

Infoton Torpedo Strikes Obamian Ship C.I.A. Discreditation Operation

Recall this recent post in the “vaccine magnetism” series:

The Magnetism Challenge: Part III – Suramin: A Lesson in Discreditation of Dissident Scientists and Science

This is for the historical record. I hope that this analysis gets to the “dissident scientists” involved, but even if it never does, future historians will get a powerful look at what I call “Fake Science” – the establishment’s phony, deceptive and controlled scientific complex – and how infiltration, control, and discreditation of dissident populist …

You will recall that I located the point where the “suramin error” was dropped in front of the right people to be uploaded to the prominent doctors of the anti-vaxx community, prior to the “magnet challenge” disinformation being similarly uploaded, and then used to discredit them in the Daily Mail.

Part of the suramin attack involved a highly edited video of Judy Mikovits touting suramin, minus the full information about that drug. That video, in combination with erroneous assertions about suramin being in pine tree needles, resulted in the physicians who are currently prominent warning about the COVID vaccines, picking up the error and discrediting themselves in their very current and very popular videos about the gynecological and shedding problems of the persistent and migratory spike protein vaccines.

Well, that video which was used to misinform them has been removed.

Sunlight. It cures quite a bit all on its own.

More seriously, I realized that, at some level there, probably in the background, I was dealing with pro “influencers of influencers of influencers”. I won’t be sharing all my information on that, as much as I would love to, but it became apparent that they are watching us like hawks. Speaking of which…..

2.

The Sleeper Has Awakened

Yes, Sundance just came out with a piece critical of the COVID vaccines. You will recall that SD and his crew were all fairly pro-vaxx, so this tells me there is a fundamental shift going on.

And while the fact that the HHS entrance to VAERS went down at the same time SD came out with this article may very well just be coincidence, I am 100% certain that the policy of Barack Obama and Eric Holder is BACK IN PLACE under Merrick “Whatever You Say, Barack” Garland, and that journalists like Sundance (and ourselves) are being SPIED ON by the federal government, in a abuse of power for political purposes.

SO – anyway – keep an eye on CTH in regard to things “COVID” – there is going to be some good stuff there, I’m willing to bet.

[Just for the record, I wrote this BEFORE the recent CTH post about “QAnon” stuff, which I happen to regard as a very helpful warning, but which was “not received warmly” by most on this site. I’m not looking to exacerbate the situation, but I hate “spiking” anything – for anybody. And I’m going to be very blunt. Sundance is going to have THE BEST coverage of DOJ asshattery against our site, so prepare to see me using a LOT of his coverage in my postings and reasoning. People need to learn to keep their emotions in check, because that is how an army survives – digital or otherwise. WWG1WGA begins with YOU.]

3.

Scientists Are Calling Out The Snakes

Everybody is seeing how people are calling out FAUCI, but in my opinion that’s actually a side-show. The REAL DEAL is scientists calling out the scientific BULLSHIT about COVID, and particularly the spike protein nuttery that was imposed on us. At long last, people in Scienceville are going “WHAT THE #### IS GOING ON?”

First, a video that came to us via Grandmaintexas and this link:

https://www.barnhardt.biz/2021/06/13/ferocious-call-out-of-the-covid-and-deathjab-crime-against-humanity-by-a-canadian-m-d-pathologist-heart-inflammation-and-young-men-dropping-from-heart-attacks-including-a-danish-soccer-player/

It’s worth listening to the beginning of this video to hear this dude list off his credentials. This guy isn’t just some country doctor. Nor is he old, senile, or out-of-date on current medicine. Just listen to him. This dude is IMPRESSIVE. He’s still sharp as a tack, just like Trump. I would almost say “more”, at the risk of offending some who believe this is not possible! Just listen to him.

Here is the URL if it doesn’t show up properly: https://www.bitchute.com/video/AA68FWFJazTd/

Among many other jaw-droppers of sensible scientific perspective, this video basically tells you why I have been so mouth-agape about that Pfizer data snagged back into American science from JAPAN.

You have to look closely at it, but not THAT closely.

The VIDEO adds more about testicular localization in males.

Yeah, boys. It ain’t just the broads. Cross those legs – this is gonna make you cringe like a prostate exam.

One of the things which is EXTREMELY NOTEWORTHY about the video is that this lady YouTuber / Facebooker / BitChuter and all-around “social media presenter” goes into deep detail about the extreme censorship she is encountering, and how she deals with it.

For example, she states that the YouTube video was taken down in about 10 minutes.

Alternatively, you can listen to some different scientists in THIS great video, thanks to singingsoul.

https://youtu.be/Du2wm5nhTXY

There is a necessary backup of this on BitChute: https://www.bitchute.com/video/TH2HAmTp40xq/

Here we have Bret Weinstein interviewing a doctor and an engineer who explain – to the satisfaction of any honest scientist – WHY the mRNA vaccines (and to a lesser extent, the adenoviral vector vaccines) are CLEARLY problematic.

This is EXACTLY the same stuff we’ve been talking about. And it will be extremely useful in getting to where we are going, looking at NEW VACCINES COMING.

I’ll give you a hint now – the new vaccines could be a strong correction, back to what vaccines SHOULD be – or they could just be a slower and stealthier path to get us where the cabal has us going now – elite-controlled social contraception, and immunity debt enslavement – which is the worst-case future of “vaccine capture” a la Marek.

So – let me review previous posting, mostly mine, but also Deplorable Patriot’s reachy but prophetic question about the incredible and previously unthinkable idea of vaccine shedding. All of it based on what YOU, our loyal posters, brought here for the group to digest.

Take a bow, people. YOU DID GOOD.

4.

A Short Bibliographic Toldjaso From This Site

I will preface each of these blurbs with another short blurb, explaining relevance.

This will “refresh your memory”, before we get into the FUTURE.

We start, very appropriately, with RAND PAUL.

Gotta give DOCTOR Rand Paul credit – he has led the fight to bring SANITY back to medicine and science. Thank GOD Trump put him where he saved the most people – in the SENATE. I also have a personal debt here, as a recoveree, forced to wear a needless mask, aggravating my hypoxia. Rand Paul has FREED ME of my TORTURE MASK.

Thank you, Rand. I mean it.

Rand Paul Nails Fauci and Cuts to the Chase on Coronavirus Variants – Are the Vaccinated and Recovered Even Getting Reinfected or Sick?

Introduction You have GOT to see the video I’m going to show you. It’s not just what they’re talking about. It’s WHERE IT LEADS. Most of the people who watch Rand Paul go after Fauci here, are concentrating on MASKS, because that is the TOP LAYER of the argument. But THAT is the small potatoes. …

This post is where disparate cracks in the narrative all opened at once. I was no longer going along with the bullshit. Too many questions, too many pat answers turning up WRONG – no – the narrative was full of holes, and it was time to think ON OUR OWN.

Branch Covidians – Seven Ways To See Through The Phony Pharmageddon of COVID-19

PREFACE I thought that I might withhold this post on Easter Sunday, and then I changed my mind, thanks to Deplorable Patriot, Trump, Gab and Jesus. If anybody ever FOUGHT on Easter Sunday, it was Christ. It’s time to FOLLOW POINT. The Branch Covidians have taken a toll, but the WAR is turning, and – …

I just went back and read this thing, and – WOW – just WOW. I was all over two things – spike protein and genetic incorporation – the JAENISCH paper. We are now all over the spike protein, but we MUST turn our attention to genetic incorporation of the vaccine – particularly in people who “fountain” the spike protein. I had forgotten this, but much of the suspicion of Fauci on this site centered around his seeming obsession with vaccines for viruses capable of genomic incorporation.

Yes, Wuhan is important, but I see that as the plotters playing “hot potato scandal” to distract us from the deeper purposes of this LYING phony pandemic.

Genetic incorporation of these vaccines must be investigated. There has been so much we have been told that is WRONG – I think genetic incorporation due to the spike protein acting as a reverse transcription promoter for its own RNA is a biggie.

Wolf’s Red-Hot Date With Retrotranscriptive Faucipox

Alternate Title: Is Persistent Reverse Transcription a Hidden Virus/Vaccine Objective? Gloating Pre-Preface There are few feelings of satisfaction like opening up the NEWS and knowing one’s theories and understandings are WORKING even better than one thought. Let’s see if they use this one for damage control, and get the “new science” out before the STORY …

No good guys among these genetic vaccines. They are all RISKY for certain people, and when we EUAed them forward, we took those risks. The problem is, with idiot BIDEN in charge, instead of Trump, there was nobody to push the sensible idea of sparing the vaccine from those for whom it would be knowingly risky.

Fake elections matter.

Johnson+Johnson Vaccine Follows Pfizer, Moderna, and AstraZeneca into Problem Territory, and Proves Once Again – Clinical Trials Have Limits

Every coronavirus vaccine so far has shown us SOME defect upon mass release, which was NOT evident in EVEN phase III clinical trials. Look HERE for a searchable PDF document of adverse effects from the Pfizer vaccine: https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/977005/COVID-19_mRNA_Pfizer-_BioNTech_Vaccine_Analysis_Print.pdf Check out these videos on the low-platelet clotting problem from the Oxford/Astrazeneca vaccine. Here is a fantastic …

I was really starting to get it here. I was starting to accept that “it’s the full spike protein, stupid!”

Are Clotting Problems a General Minor Risk of COVID Vaccines?

I saw an excellent explanation of the clotting problem with the AstraZeneca vaccine against SARS-CoV-2 / COVID-19 here: The doctor, Dr. ZDogg, MD, offers an exceptionally clear explanation of both what is going on with the AstraZeneca vaccine, and why its distribution was halted or limited in some places for some age groups of patients. …

This is when I realized that all the gynecological problems being reported for the COVID vaccines were actually a REAL problem, and not just a sub-problem of the clotting problems. I also realized that this effect was too pronounced to be an accident. And then the complications going to other people in close contact – how could this even be possible?

So I considered what sounded like a more reasonable alternative to “vaccine shedding” – namely, spike protein shedding. Indeed, both avenues could be operating, but vaccine shedding now has DATA to support it, in the form of the Pfizer animal data showing persistence and migration. And if you stay with this to the very end, you will see that these lipid nanoparticles have been nothing but trouble from the beginning. It’s an impressive technology, but clearly not fully baked.

Thus, read this post, knowing that the vaccine is likely to be nearly as persistent as the spike protein it produces. Everything I’m saying for the spike protein, should apply in spades for the vaccine, which essentially brings in mRNA as a transmissible FACTORY for creating spike protein. It would not take much vaccine transfer to create the EXACT problem that is observed in alleged shedding incidents.

Is The Abortion Vaccine Right For You?

“When the people have any power to object to a socialist solution, a deniable 5% fait accompli is always more desirable to socialists than a negotiated 50% solution, because they can always negotiate on the remaining 95%.” -Wolf Moon When I first heard about a case of a miscarriage by a pregnant doctor, due to …

This is where I really laid out the evidence that the spike protein is causing the problems we’re seeing.

Obviously I’m all “nodding Jack Nicholson” now.

Spike Protein = Spike Protein ≈ Snake Protein

Using Principles of Protein Equivalence and Analogy as Predictive Tools for Coronavirus Understanding Surely you’ve heard of the BROWN RECLUSE SPIDER. The brown recluse is related to several other recluses, and a couple of other families of spiders, that all have a similar venom – a protein called sphingomyelinase D. This is an enzyme that …

If you don’t think those “lipid nanoparticles” of the mRNA vaccines can’t “act like viruses” and basically pass “disease” to a NEW HOST – read this. LNPs ≈ VLPs.

EVERYTHING we are seeing in vaccine medicine now is a COPY of what nature did about 70-100 million years ago, in the insect world. Once I realized this, I was able to pattern this stuff all over what Big Pharma is doing, and get ahead of their game.

This post is probably going to go over a lot of heads, but I think scientists will find it disturbing until they find it compelling, and then ultimately find it satisfying. Creation teaches us – not the other way around.

Look to the wasp, thou sheeple, and be wise.

No New Bioweapon Under The Sun

OK – we’re going to have some fun here – but stick with me, and you could learn A LOT. Cue the music! Borrowed from Wheatie! Previous posts helped put both the SPIKE PROTEIN DISEASE and the SPIKE PROTEIN VACCINE into deep perspective. We were seeing that the SOLUTION was a significant part of the …

Deplorable Patriot hit the nail on the head here. Before I accepted the awful fact that these vaccines are not what we thought they were, I didn’t believe shedding could be real. Oh, boy, was I wrong about that.

Keeping COVID Shot Transfer Out Of Your Life

Our dear boss, Wolf, has been busy putting together scientific primers on just what it is the various shots and inoculations marketed to be preventative of severe symptoms of COVID do, but what hasn’t been addressed for those of us who chose not to be shot up with whatever is in the syringes is how …

This was beautiful – mainstream science and medicine starting to question the Fauci BS. Revel in it. Some of this is now “accepted” – all of it will be, soon enough. We’re headed back to sanity, folks.

COVID-19: New Treatment Protocol and Important Contraindications

This is a very important video you don’t want to miss. It just came out, and the doctor is a guy I’ve been following. He chooses his words carefully, to stay inside the establishment where he can publish some of the top papers, but he speaks the truth at all times. Don’t let the video …

This is where I was blown away by the Pfizer leak out of Japan. The targeting of the ovaries.

AYE-YI-YI. What is one supposed to think? Good GRIEF.

The Spike Protein’s Purpose Betrayed By Its Own Superiority

TL;DR – you MUST listen to a short podcast of a scientist revealing the latest research on the spike protein vaccines. The VACCINE ITSELF (not just the spike protein – the mRNA vaccine itself) is persistent and is not only concentrating in ovaries – THE VACCINE ITSELF IS EXCRETED – e.g., in breast milk. Meaning …

Now you can see it very easily – the enemy threw that “Magnet Challenge” out to muddy the water as we were gaining understanding. But here is where I started to look at it experimentally – give it a real examination – and come away fairly doubtful that there is anything to it. The Magnet Challenge is bad science. It may be well-motivated, but it’s quality disinformation. Top-shelf stuff – ACTIVE DISINFORMATION to make people SELF-DISCREDIT – meant to insulate the controlled and groomed experts by discrediting smart people outside of controlled science.

The Magnetism Challenge: Part I

Wherein we examine, in something like “MythBusters” style, the dubious “Magnet Challenge”, without relying (too much) on the anti-scientific crutch of scientific authority First, a confession. The main reason I am attracted to these videos of people sticking magnets to the COVID vaccination injection sites on their shoulders, is that I love to watch normal …

This is where I actually call out the other side for trying to mislead our side with the “Magnet Challenge”. At this point I really understand how utterly misleading this trick is, and WHY it was inflicted on us.

The Magnetism Challenge: Part II – Scientific Disinformation During the COVID-19 Narrative Collapse

Wherein we look at how the COVID scammers are now using “magnetic” disinformation to try to escape justice for REAL abuse of liposome biotechnology to achieve [most likely contraceptive] vaccine persistence and migration. TL;DR – after mRNA vaccine persistence and anatomical migration were revealed in leaked Pfizer data, explaining “shedding” via persistent liposomes, the COVID …

This is where I investigate the origins of one of the “fake facts” used to trip up the doctors opposed to the spike protein mRNA vaccines. I am convinced that this was some kind of discreditation operation – a precursor to the “Magnet Challenge” psy-op.

The Magnetism Challenge: Part III – Suramin: A Lesson in Discreditation of Dissident Scientists and Science

This is for the historical record. I hope that this analysis gets to the “dissident scientists” involved, but even if it never does, future historians will get a powerful look at what I call “Fake Science” – the establishment’s phony, deceptive and controlled scientific complex – and how infiltration, control, and discreditation of dissident populist …

At this point, you should be ready for more information – about WHERE vaccination is going.

5.

New Vaccines – The Great Crony Blame Escape

It took me a while to put 2 and 2 together, but when I first saw the June 7 cover article on my new “vaccine snitch”, Chemical & Engineering News, something bothered me about it.

NASAL VACCINES? FOR COVID-19? ALREADY?

LINK: https://cen.acs.org/pharmaceuticals/vaccines/Intranasal-nose-vaccines-stop-COVID/99/i21

This is more excellent reporting by Ryan Cross, who routinely ferrets out (pun intended) the full story on virus science and vaccine technology, as available to “public science” – to be distinguished from the deeply hidden stuff. Cross never adds in any politics, crime, depolitical deconstruction, “conspiracy theory” speculation, or any of the things that are MY JOB. I have to respect that. This is the way THE NEWS used to be.

  • get the facts
  • understand the facts
  • teach the facts
  • teach the understanding
  • light fuse, run away

AH. I love my job. BE THE FUSE.

Figuring out the criminality of the government, industry, and financial backers – getting past the obscurantism, deceptions, and lies – that is OUR JOB – We The People – for we are (now that Merrick Garland soils the DOJ with Chicago communism) the

REAL DEPARTMENT OF JUSTICE.

Yup. WE are not the communist insurrection and their corporate cronies, destroying everything in their path to money and power, including honest science and doctor-patient medicine.

We are (and like Confucius, I WANT them to hate this) the RESURRECTION.

The RESURRECTION vs. The INSURRECTION.

Eat your own label, insurrectionist commies. It’s good for you!

OK, back to science.

I really encourage you all to read this full article, which is written so that the general public can understand 99% of it easily. You will learn a LOT about vaccine technology. I will move you along through it, skipping over things, but when we’re done, consider reading the whole thing both WITH and FOR greater understanding.

I will try to only quote selectively from it, as I capture a few key points. But I can do no better than to give C&EN’s own “TL;DR” which they label “In brief“:

Vaccines are synonymous with shots, but it doesn’t have to be that way. More than a dozen groups are working on COVID-19 vaccines that can be squirted or sprayed into the nose instead of injected in the arm. Besides the potential practical advantage of easier administration, these vaccines could trigger the mucosal immune system to make antibodies in the nose and help stop the coronavirus at its point of entry. It sounds great, but the mucosal immune system is hard to study, and pharma companies have been reluctant to invest in the needle-free approach. Mucosal immunologists and intranasal vaccine developers are hoping the pandemic will change that.

This is where my first “2+2” $0.02 comes in.

Note the final statement:

Mucosal immunologists and intranasal vaccine developers are hoping the pandemic will change that.

It’s not the phony pandemic that is “going to” change delivery route. It’s already happening, in my opinion, due to the massive unveiling of not just the problems of the systemic gene therapy vaccines, but the clear motivations behind these vaccines, some of which were not just hidden from the public, but also from the scientific community, which I believe is now getting WISE.

Stated more simply, OUR PRESSURE in getting out the TRUTH about the existing vaccines is forcing the industry to react to vaccine shortcomings they WILL NOT ADMIT otherwise. The industry is likely also under forces from ABOVE THEM which are also being exposed.

You will see this as I go through the article.

The most powerful weapons in our hands are the UNDERSTANDINGS of the following:

  • spike protein toxicity
  • vaccine persistence
  • vaccine migration
  • spike genetic incorporation
  • Fauci’s reverse transcription obsession
  • Bill Gates’ “pre-programming the experts”
  • Zuckerberg connection to Baric lab
  • irrational hatred of cheap available therapeutics
  • generality of therapeutics being fought, thus…
  • the enabling of ChiCom manipulations
  • ovarian and testicular targeting
  • hiding of evolutionary knowledge
  • “circuits of plausibility” to create errors and crises

Put these things together and the “easy path” of systemic vaccines which do NOT mimic stimulation of natural immunity as well as NASAL VACCINES do, has been chosen under the cover of simplicity, but in reality because it always lies closer to what the industry TRULY wants, e.g., right now, gene therapies, where they NEED to target many specific organs. Nasal vaccination is a niche safety point which has always WAITED while systemic gets the action the deep backers want and NEED.

When it’s just easier and possible to do the wrong thing they want, they DO IT.

The current gene therapy desideratum – organ specificity – is actually in another article in the same issue of C&EN, talking about CRISPR, anti-CRISPR, and how to make gene therapy not have side effects, a point which is admitted more openly now that they are “safe on first” by having “proven” that gene therapy “works”.

Such a scam.

But it gets worse. Industry motives are not the motives of those who manipulate THEM.

As you read the rest of this, note that the “running dog” industry layer, which now performs for taskmaster commies, is also manipulated by THEIR true masters, the global elite, now looking at pesticides for humans, and particularly deplorables. It’s clear to me now, after the ovarian, placental, and testicular actions of the spike protein broke media containment, that the reason the entire vaccine industry jumped into full spike protein gene therapy tests masquerading as necessary vaccines is manipulation by the one guy who double-controls vaccine technology via “owning” CEPI – and that would be BILL GATES.

Yes, that Bill Gates, whose father is standing behind Fauci here.

Thus, when both the Gates Foundation and CEPI back some project, it’s Bill Gates getting TWO SCOOPS of control.

Note also Event 201 backing.

With Fauci and the Faucists inside government, and Bill Gates on the outside, there was no way that safer, metered, recombinant spike protein tech or peptide subunit tech was ever going to go first. They needed the new tech given a carte blanche, and they got it. This plus the “crisis” allowed the full spike protein’s foot to be shoved in America’s door, past everybody who might have questioned it.

This is one of the guys who spotted the “snake protein analogy” first, in what would have been time to alter the landscape.

No longer random, this is what happens when people get in the way of a conspiracy TWO LEVELS UP, where the really big boys and girls play. There are money motivations in between, but this guy’s real crime was potentially interfering with “the spike must flow”.

Have I raised your suspicions?

GOOD! Let’s look more deeply at the article now.

In fact, the mucosal membranes that line our airways, digestive systems, and reproductive tracts are often the first parts of our bodies to face an invading pathogen. A network of immune cells resides underneath our mucous membranes, or mucosae, and forms a front line of defense against invaders, and they prevent most infections from taking root. This is the mucosal immune system, and some immunologists think we have been seriously underestimating it.

“When you think about it, that’s where we acquire most of our infections: we inhale them, we consume them, or we get them through sex,” says Michael W. Russell, a mucosal immunologist and professor emeritus at the University at Buffalo.

This is where we begin to realize that mucosal immunity and systemic immunity are NOT the same thing. And it doesn’t have to be “either/or” – you can have BOTH. There are many plausible reasons for one over the other, but it will become clear that using the mucosal pathway adheres more strongly to the natural “API” of immunity by “contact”, if you will, with the pathogen, rather than sudden systemic introduction.

Have we really been underestimating it? Or have we been IGNORING IT ON PURPOSE at the highest motivational levels of power?

In my opinion, if the powers that be in VAXX WORLD would have been looking out for us all this time, there would have been stronger forces pushing researchers toward mucosal immunity. The problem is, that kind of naturalistic and patient-centered thinking is a problem for those who see vaccination as more of a path to power or other ends, particularly SOCIAL ends, rather than as part of a path to individual health. Nothing has made this more clear than the “pandemic”, controlled by “experts” who seemed not to know what they were doing.

Are you now starting to understand how and why conspiracies are intentionally mischaracterized as giant joint illicit cooperation, when they are in fact TOWERS OF LAYERS OF INTERNAL DECEPTIONS?

Good. Let’s move on.

Our mucosal immune cells make a special class of antibodies that are constantly secreted from the mucous membranes to protect the nose, gut, and other vulnerable sites from pathogens we’ve seen in the past. “But if you don’t stimulate the immune system in the mucosae, you don’t obtain mucosal immune responses,” says Pierre Charneau, head of the Molecular Virology and Vaccinology Unit at the Pasteur Institute.

Yet most research on SARS-CoV-2 and our immune systems has overlooked mucosal immunity in favor of the easier-to-study systemic immunity. “When the pandemic hit last year and I started to see papers coming out about immunity, it really quite staggered me to see an absence of attention to the mucosal immune response,” Russell says.

See that? The TILT of the field – the RUSH to systemic – that is a SOCIAL phenomenon – and socialists, or believers in the effectiveness of socialist tactics, like me – will tell you very honestly that science can be controlled SOCIALLY – that the SOCIAL aspects of science are not all warm campfires around each other’s blogs, but actually PART OF THE FIGHT that controls WHAT SCIENCE THINKS and WHAT SCIENCE DOES.

Or like this blog. I’m just honest about it.

I keep telling people that the “jabs” were PUSHED and SHAPED to be what they were – for REASONS – diverse yet all valid – which compromised all the insiders to DO WHAT WAS NEEDED to create what was needed at the TOP:

SYSTEMICALLY MOBILE, GONAD-TARGETING, SPIKE PROTEIN OVERDOSE INJECTIONS AT CONTRACEPTIVE LEVELS.

Stated more generally, it wasn’t a BUG – it was a FEATURE. And we were RUSHED into testing (if not USING) the feature ON PURPOSE.

Now – remember how COVER works – these vaccines did what they were SUPPOSED to do in our little world – but they also did what other people wanted in THEIR little and very exclusive world of “human benefactors”.

We move on.

Charneau and a group of scientists in Paris have shown that natural SARS-CoV-2 infections trigger both systemic and mucosal immunity. But our current crop of COVID-19 vaccines offer only systemic protection. Developing vaccines that are sprayed up the nose, rather than injected into the arm, could change that, Charneau says. Mucosal immunity in our noses could be like a guard at the door, potentially helping stop even small infections of SARS-CoV-2 right where they start.

It’s a tantalizing notion, but whether it’s a viable one is up for debate.

Now, the FIRST thing I think when I read this is “hey, that means my disease immunity is almost certainly BETTER than vaccine immunity – as doctors have all known for decades prior to COVID-19”.

Of course, we know they lied about that to “prevent vaccine hesitancy”. Or stated using different words, “to prevent picking the mild disease over the vaccine in the safer age groups, the latter being most of them”.

Do you see that? Almost ANY lie can be justified in the name of “overcoming vaccine hesitancy”. Who, besides Fauci and CDC is so obsessed with that Swiss army knife excuse and viral talking point?

But you know what – Fauci knew this – and Rand Paul knew Fauci knew this. So when Rand Paul went after Fauci on reinfection of COVID recoverees, like both HIM and ME, he knew Fauci was on THIN ICE.

But toss that all aside. At BEST, we went straight after systemic immunity “because emergency”. But it turned out that it wasn’t all that big of an emergency, and that’s where it gets interesting.

As I said, things are changing very rapidly now – obviously getting a technology on the cover of Chemical & Engineering News is a big deal.

And I quote:

After all, the pandemic provided a chance for messenger RNA (mRNA) vaccine technology to finally prove its worth, and mucosal immunologists are hoping that this will be a moment for intranasal vaccines to do the same. “This climate is a game changer,” says Hiroshi Kiyono, codirector of the University of California San Diego Center for Mucosal Immunology, Allergy, and Vaccines. “This is a great opportunity to advance nasal vaccines, not just for COVID-19 but for other respiratory diseases.”

YUP. That’s the way CRISIS MECHANICS works. The “crisis” is just going to CHANGE, to get people to do a NEXT NEW WRONG THING.

My advice to Hiroshi Kiyono would be WATCH OUT – you are going to be subjected to many pressures that bring mucosal vaccines TOWARD viability as spike protein contraceptives. There will be pressure AWAY FROM doing what is best for the PATIENT, and TOWARD doing what is best for the SCIENCE and the RESEARCH, and that “better” will just happen to be better for surreptitious social or even sociobiological manipulations, too.

This is just a HEADS UP.

I’ve been there. Fake Science is not a very nice place to be when billions or trillions of dollars are on the line, and YOU’RE IN THE WAY.

At this point, the article goes into the HISTORY of intranasal vaccines, intranasal being one of the very best routes for respiratory virus vaccines. I’m going to SKIP over all that, even though there are some very interesting aspects to that history. I don’t really see any smoking guns of obstruction or sabotage, but it’s pretty clear that intranasal was a bit of a black sheep, and fended for itself.

Now, HERE is what’s interesting. Which intranasal vaccines are “in the pipeline”?

TURN YOUR NOSE UP

More than a dozen intranasal vaccines are in development for COVID-19. Here are several to keep an eye on.

Phase 1

Altimmune
▸ Adenoviral vector

AstraZeneca and University of Oxford
▸ Adenoviral vector

Beijing Wantai Biological Pharmacy, University of Hong Kong, and Xiamen University
▸ Live attenuated influenza virus vector

Bharat Biotech and Washington University in St. Louis
▸ Adenoviral vector

Codagenix and Serum Institute of India
▸ Live attenuated SARS-CoV-2

Laboratorio Avi-Mex and Icahn School of Medicine at Mount Sinai
▸ Live Newcastle disease virus vector

Meissa Vaccines
▸ Live attenuated respiratory syncytial virus vector

Preclinical

AuraVax and University of Houston
▸ Recombinant spike protein with adjuvant

HanaVax and University of Tokyo
▸ Recombinant spike protein with adjuvant

TheraVectys and Pasteur Institute
▸ Lentiviral vector

University of Eastern Finland and University of Helsinki
▸ Adenoviral vector

Sources: Companies, World Health Organization.

Now, that may not look like much, but there is a TON to unpack, because we not only have OLD “new” technologies in a NEW route – we have NEW “new” technologies to explain – and in a new route.

If you don’t think the other side can cause trouble with their spike protein attack through the nose, you are sorely underestimating the ability of those who CONTROL SCIENCE to “get there first” and mislead the rest of the pack.

Remember – if you think like me, then you know people have been doing this crap for billions of years in THIS universe alone. We’re just “rediscovering reality under supervision” on one more planet. The lies are OLD. Very, very OLD. And as I like to say, “Satan weaponizes everything.”

The adenoviral vectors we’ve seen. That’s AstraZeneca, Johnson+Johnson, Sputnik V, and others. The only difference is that they’re going through the nose, where these viruses are actually supposed to go.

There is a LOT of possibility that this move could solve the biggest problems with these vaccines. IF the nasal delivery route is a kind of highly evolved and intelligent natural “attenuation gauntlet” for viruses, then the outcomes for these vaccines could be uniformly improved.

IF that is indeed the case, then I’m going to be a “toldjaso” asshole and use this as part of my explanation of why “they” have divided us in the specific way they have, over the topic of evolution, separating the “intelligence” side from the “evolutionary science” side, thus pushing the latter to view evolution as DUMB instead of “cautiously and obsessively path-checking”, which looks dumb to localized intelligence that doesn’t know how to keep its biases in its own lane.

These vaccines also introduce lentiviral vectors – pretty much the same thing as the adenoviral vectors, just a different virus. Again, this is new, so it could be interesting.

Another returning technology is Recombinant spike protein with adjuvant. That is basically Novavax, which we have not really had a chance to deconstruct, because there is not yet much public information on safety or efficacy. So a big QUESTION MARK on that one. In principle this should be safer than genetic technologies, both because there are ZERO risks of genomic incorporation (see Jaenisch for SARS-CoV-2 incorporation), and because there are no possibilities of unmetered “fountaining” of spike protein.

First up in technologies we have NOT seen yet: Live attenuated SARS-CoV-2.

We have already used INACTIVATED SARS-CoV-2 – that would include the Chinese Sinovac vaccine, which is rebranded as CoronaVac in the West. I’ve been cautioning that I believe “bad lots” of CoronaVac, which are incompletely inactivated, have been passed off, which would explain why there is typically a surge in cases right when countries start using CoronaVac. Obviously that’s good for business, and we know how Chinese business works. The only other explanation would be that PCR is picking up vaccine during rollout, and I’m half-way thinking that’s a better explanation, were I not so familiar with ChiComs and the corruption they spread.

However, we have NOT yet seen live attenuated virus. This could be GREAT – or it could have a whole NEW bag of problems. I’m very “wait and see” on this.

The real BIGGIES of the new intranasal vaccines are these:

  • Live attenuated influenza virus vector
  • Live Newcastle disease virus vector
  • Live attenuated respiratory syncytial virus vector

Unlike the adenoviral vector vaccines, which are basically “working but dead mRNA in a dead skin suit of a different virus that’s easy to work with”, these vectors are LIVE VIRUSES with “something extra” (like the spike protein) inserted into their genes, making them chimeric at the genetic level, not just the vector level.

These vaccine viruses are actually designed to “run a bit”. They INFECT YOU with instructions to crank out spike protein.

This is where things start getting weird, and it’s hard to trust a world which contains both THIS technology AND the CCP.

You know what I’m sayin’?

But now let’s look at all these. We suddenly have a LOT of vaccines to keep track of.

It’s gonna take some work – but we have to do it. We cannot let them keep experimenting on us like they did, while CHINA did almost NO “experimentation” on its people.

Understand what I’m sayin’?

Good.

Now – the rest of the article is basically the HOPES and the NOPES of the intranasal route. Some of the possibilities here are MIND-BOGGLINGLY GOOD.

Mucosal immune cells constantly make an antibody called secretory immunoglobulin A (IgA), which gets released into the mucous membranes of the nose, mouth, airways, and gut. Pound for pound, we produce more IgA than any other antibody, Russell says, although most of it is broken down and sneezed, coughed, or pooped out within a few days.

And critically, while injected vaccines induce only systemic immunity, vaccines delivered to mucosal sites can induce both systemic and mucosal immunity, he says.

That fact is evident in animal studies of a vaccine being developed by David T. Curiel and Michael Diamond at Washington University in St. Louis. Both the injected and intranasal forms of their vaccine triggered the production of IgG antibodies, but only the intranasal route triggered mucosal immune cells to secrete IgA that blocked the virus from replicating in the nose. A day after they published preprint data demonstrating as much in July 2020, the Indian vaccine company Bharat Biotech contacted the university’s technology-transfer office to license the intranasal vaccine in India, where it is being tested in a clinical trial. “How that will play out clinically remains to be seen,” Curiel says. “But this animal model finding suggests, qualitatively, that we have some additional benefit.”

It is very clear that – for a respiratory disease – there is an advantage to having “naturally obtained” respiratory mucosal immunity.

All that said, we’re still talking spike protein. But if the intranasal route can keep it out of the ovaries, testicles, and placenta – GREAT.

And THAT brings me to another great C&EN report by Ryan Cross – everything you want to know and need to know about those damned lipid nanoparticles.

Without these lipid shells, there would be no mRNA vaccines for COVID-19

Fragile mRNA molecules used in COVID-19 vaccines can’t get into cells on their own. They owe their success to lipid nanoparticles that took decades to refine

by Ryan Cross
March 6, 2021

LINK: https://cen.acs.org/pharmaceuticals/drug-delivery/Without-lipid-shells-mRNA-vaccines/99/i8

Without doing any “gotcha” journalism, Cross reveals the GOOD, the BAD, and the UGLY about these lipid nanoparticles.

The impression I get is that this field was dogged with problems, most of which were overcome, but not all.

So, without getting into the details, all these criticisms of the lipid nanotech that you are hearing are NOT “conspiracy theories” – the scientists are TALKING ABOUT THEM as real problems they’re trying to solve, with various degrees of success, in this report.

To me, it was very clear that people WAY above these scientists needed to PUSH this LNP (lipid nanoparticle) technology, necessary for GENE THERAPY, into acceptance using the phony plague.

If you don’t want to take this stuff, STAND UP for your rights. Otherwise, it’s over the hill, the horses are OUT OF THE BARN, the fence is open and the cattle are GONE.

BUT – I think that if we keep pushing the REALITIES of these vaccines, we can make the “mandate martinets” crawl back into their Fuehrer Bunkers and leave us alone.

And THAT is worth it.

W

PSSSST – hey, DOJ and FBI. Want to see some audit results?

THEY’RE EXPLOSIVE!

Seriously, you injustice-perpetuating assholes deserve to be trolled. Your phony allegations of “violence” or even potential violence by the QAnon “believers” are an affront to Americans. They’re a SICKNESS coated with a patina of professionalism. You should be ashamed of yourselves.

A Tactical Analysis of Trump’s Speech to the GOP in North Carolina

NOTE: Colorful language warning. I’ve got my reasons.

In my opinion, Trump’s speech to the North Carolina GOP on the evening of June 5, 2021 was BIG COMMS.

As I was watching it, I realized that it’s IMPORTANT.

The first step is to LISTEN TO IT. If you have not done so, then please REMEDY THE SITUATION.

I will give you TWO OPTIONS.

Option 1 – Listen to a video of Trump’s speech

The speech is not quite an hour and a half – more like an hour and 15 minutes. The video contains a good chunk of time AFTER it was finished.

Option 2 – Read a transcript of Trump’s speech

https://www.rev.com/blog/transcripts/donald-trump-speech-transcript-at-north-carolina-gop-convention-dinner-june-5

The transcript is surprisingly good, although there are some minor errors.

The Big Context & Why Trump Lauds the Vaccine

Before we get started, I need to put this stuff in context. Some very BIG context. I may get a bit “drill sergeant” on you, but YOU NEED IT.

The fact of the matter is that we have been CUT OFF FROM TRUMP for – depending upon how you measure it – between 4 and 7 months. Social media attempted to BAN Trump to stop what’s coming, but as Q said, “nothing can stop what’s coming”. Nevertheless, they tried.

Trump has successfully USED this time of enforced semi-silence to get a lot of things done. You may not realize that, but it will become more and more apparent as the world which opposes Trump, MAGA and America First, CRUMBLES BEFORE US.

Some of the crumbling is beginning. This video, posted yesterday by Scott, tells you about the ALLOWED CRUMBLE. So does this post by Political Moonshine.

THIS part of the downfall is what the “cabal” WANTS.

You probably never heard of this “DRASTIC” group which is now being set up by the mainstream media as some kind of crowd-source Woodward and Bernstein.

Let’s start right here with that. Woodward and Bernstein were CHUMPS. They were USED. They found what they were supposed to find. PART of the story. Nixon was brought down by a SET-UP SCANDAL – a scandal created by the REAL scandal – just like OBAMAGATE tried to bring down Trump with a created scandal of RUSSIAGATE.

Halper was there. What do you think he was doing?

You understand?

Ask yourself – why are the members of “DRASTIC” – who have been monitored on Twitter by the CIA and DNC this whole time, without being banned – allowed to stay there, while feminist author Naomi Wolf is suspended for cautioning about the vaccine?

Likewise, you are seeing nothing on the mainstream media about the Pfizer documents released by Japan, showing that the scientists at Pfizer KNEW the vaccine was PERSISTING LIKE A DEMON and HEADING STRAIGHT FOR THE OVARIES LIKE A BAT OUT OF HELL.

Only taking enough time – way too much time – so that almost anything was possible.

Suddenly the idea of a persistent lipid nanoparticle, handily schlepping mRNA, seemingly designed to migrate throughout the body over DAYS, and actually DOING SO, therefore ALSO being secreted in SKIN LIPIDS, didn’t sound like science fiction. “Shedding” is now not just a theory – it’s a natural consequence of this data. It would take a NOVEL THEORY to say why it should NOT happen.

As we say in science, “HOLY FUCKING SHIT! LOOK AT THOSE NUMBERS!”

And we didn’t just have what I had speculated – SPIKE PROTEIN shedding evidence – as powerful as that TOXIC spike protein is. We have both theory and evidence of VACCINE SHEDDING.

Oh – and speaking of snake protein toxicity – we now know that several research groups spotted the snake protein relationship to the spike protein early and submitted their discovery in April and May of 2020, in one case less than a month after what looks like a “targeted MK murder” of one of the researchers.

None of this stuff is coming out. What is coming out is a CHANGE IN SCRIPT that lets CHINA act out, and CHINA JOE respond predictably. The Wuhan lab stuff – obvious as it always was – is suddenly being admitted, both to gain media credibility, and to create a political sandbox for the DNC, the globalists, the media, and China to CONTROL THE NARRATIVE.

It is quite easy, right now, to predict that, in the end, China will “admit” that it had a lab leak, and because the WORLD didn’t provide enough money to CHINA, to have better labs, BAD THINGS HAPPENED. Robber Joe will then send BILLIONS TO CHINA.

Get the picture? This is ALL bullshit of the highest order.

NONE of the stuff about contraception, population control, spike protein toxicity, vaccine persistence and shedding – NONE of that stuff will be admitted, or even discussed.

FAKE INVESTIGATIONS MAKE STUFF GO AWAY.

Now, I’m not going to get into exactly WHY they all did this, because they ALL have different motivations. But just bear in mind, that when I heard Melinda Gates say that (let’s play their caps game backwards) blacks and amerinds needed to take the vaccine FIRST – yeah. When the contraceptive nature of the spike protein appeared, Gates & Gates sure went running for the MONEY EXITS, with the mainstream media helping sow the Epstein angle as the reason.

LOL. Can’t fool EITHER Wolf.

It should now be clear that there is SOME collapse of the COVID narrative that are going to be allowed, or even promoted and TIMED, and others that are NOT ALLOWED. Even within the allowed parts, the RELATIVE RATES of REVELATION and PUBLIC UNDERSTANDING will have all kinds of effects on the POLITICAL OUTCOMES, and in particular WHO SURVIVES and WHO DOESN’T.

Take a HINT from skiing, surfing, mountain-biking, parachuting, “dirt-surfing” down a mountain, falling on a rope, and a lot of other things which are a balance between gravity and artful resistance.

The key to survival, and better still, GRACEFUL SURVIVAL, is to LET IT HAPPEN BEAUTIFULLY.

SO – back to Trump – and some reality.

The vaccine is not going to kill everybody who takes it. Don’t fall for extreme predictions. Anybody predicting that idea is pushing far beyond what we can know now – to say it kindly. Yeah, if everybody keeps taking the same terrible wrong mRNA spike protein vaccines or new, changed ones, for a long time, maybe we end up with a Marek’s situation, or more likely a small percentage of cancers or immune problems, but again, we are not sure any of that will happen. In the meanwhile, most of my neighbors take the vaccine, and little or nothing apparent happens to them.

I do appreciate the various “vaccine whistleblowers” who have WISELY stepped up to point out RISKS that the industry is FAILING to tell us about.

But the truth is, the vaccines that Trump pushed almost undoubtedly SAVED LIVES overall. Yeah, the CDC lied like crazy, and a lot of people died who didn’t have to, because Trump was no longer in a place where he could modulate the vaccine administration. People who should never have gotten the vaccine got it, because the contraindications – easily GUESSED, but moreover KNOWN and FULLY UNDERSTOOD – did NOT appear on those BLANK circulars included in the boxes with the vaccines.

They PUSHED the vaccines for POLITICS, not MEDICINE, and that, my friends, is STALINISM.

CDC LIED – PEOPLE DIED – and Rod Rosenstein’s sister, Nancy Messonnier, has quietly LEFT CDC.

Yeah. DAMAGE CONTROL.

Trump is going to tout the BIG PICTURE – that the vaccine – (bad as it was, but don’t say that) – worked. It was, by and large, like a mildly lethal form of cowpox would have been as a smallpox vaccine. Thanks to Democrats, big pharma, eugenicists, China, and a pantheon of allied evil, things were not as optimal as they would have been with TRUMP in the White House. But as far as what Trump was ABLE to do, it WAS optimal.

As Cthulhu likes to say, Trump pushed through the ambush, and it WORKED. The vaccines were never REQUIRED, except belatedly, by every smaller, devious, corporate-mediated and state-mediated means that the EVIL DEMS can think of. But the vaccines are still basically not required, thank God.

Now – that is only part of the context.

THERE IS A BIGGER CONTEXT. FAKE ELECTIONS.

You will see, Trump is headed STRAIGHT INTO THAT BATTLE.

Here is a secret. The other side will do ANYTHING to stop the undoing of fake elections, and in particular the unseating of Joe Biden. They would create a “whole ‘nuther scandal” – a really big one – to distract from the scandal of fake elections. They would even push a phony conflict with China.

Are you getting the picture?

Good.

We are headed into a beautiful storm. Prepare to STORM-SURF.

The Messages from Trump’s Speech

I went BACK through Trump’s speech, and took notes. You can READ those notes at the end, as an appendix.

What I will do here is present my biggest-picture impressions from looking over those notes.

Biden is destroying America – are we going to take this?

It was a simple question, but this is a message to YOU.

If YOU resolve that we do NOT get to the 2022 election without SOLVING the 2020 election – and I mean YOU REALLY RESOLVE – that THEY REALLY SOLVE – well, things could get very interesting.

I’ve made my peace. I’m ready. Are you?

Catastrophic inflation is coming – get ready.

We lived through it before, but we will live through it again.

WHY, you might ask.

Because inflation is a weapon of FEAR, and it’s ALL THEY HAVE NOW.

Expect inflation. They are going to throw EVERYTHING at us to keep Robber Joe in the White House.

China owes US, and the world, trillions of dollars in reparations.

This is HUGE. Screw puny BLM reparations.

Do you know that they now have a way to image COVID damage to lungs? As in MY LUNGS?

Yeah. Wait long enough, and the TRUTH comes to YOU.

Now you know why I took a lesson from the Sioux and never gave up, and never relented from alleging WHAT THEY DID. And my CHURCHILL PAPERWEIGHT.

“NEVER, NEVER, NEVER QUIT.”

100% tariff across all products from China needs to be imposed.

Trump noted that Biden has NOT removed the tariffs. Now Trump also notes that China will send it’s stuff through other countries to beat the tariffs, and China Joe will use that to give China an out, but who knows.

But I think it’s coming. If not soon, then soon enough.

Cancelling ALL debt to China by ALL countries is a down payment

This got huge cheers, and hell yes. DO IT.

Trump is king-maker – and he is using it.

Trump was reveling in his power to SHIFT THE BATTLE.

But at the same time, Trump emphasized that his endorsements are a WIN FOR THE GOP.

Wake up, RINOs.

Trump also sent some HINTS about running in 2024. Interesting.

Dems are not letting illegals in for voting – it’s something else.

This is VERY intriguing. I’m still thinking about this.

Terror? Spies? Something is up.

Endless wars are ending, and even Robber Joe is going along with it.

Trump really spent a lot of time on this. He thinks its important. We are NOT going back to endless war.

We need to STAY on that message. They will ALWAYS try to come back with a WAR to snake us.

Critical race theory must be banned everywhere

This got massive cheers.

Critical race theory is DEMOCRAT POLITICS. It’s CHINA politics. Get it the FUCK OUT. Of EVERYTHING.

School choice must be passed to get out of insane public schools

This just makes so much sense now. We need to CLEAN HOUSE to get this PASSED.

Prosecutorial misconduct will continue until November 2024

Do you have a plan if Trump is arrested?

You should.

You don’t have to tell anybody what it is. You don’t even have to tell anybody that you have one. It can be VERY subtle. But PLAN for how YOUR WORLD CHANGES – and how THEIR WORLD CHANGES – when they pull that final fuckage.

Make sure they RUE THE DAY for the REST OF THEIR LIVES.

The Arizona audit will be done in 3 or 4 weeks

Likewise, prepare.

Be prepared to NOT BACK DOWN. No matter what the Communist Democrats and CHINA do.

I’m not kidding.

THE DIAMONDS MUST BE RETURNED.

Zuckerberg and Facebook broke the law, including drop-boxes

Trump GETS the insanity of MAGIC DROP BOXES.

There is a reason magicians use what are essentially drop boxes. I have described how I witnessed this, when I dropped off OUR ballots at a Democrat-wo-manned drop-box. It was not pretty.

Zuckerberg knew this. He’s EVIL. He’s a LIAR. He’s a CON ARTIST. He deserves JAIL.

After a nice fair trial that humiliates him before the world.

Expect to see things we have not seen before RE election & audits

Like I said, get ready. In a few weeks, things start getting sketchy.

Prepare to say FUCK YOU to the other side. We want JUSTICE.

The country, and many states, are not actually “50:50”

This is a powerful concept. There is NO WAY that half the electorate wants defunding the police, open borders, fewer jobs, sanctuary cities, and all these things Democrats are pushing.

The implication if clear. Democrats DEPEND on cheating to stay in the game in a winning way.

Trump even thinks some nominal blue states are not actually blue – and indeed, this would explain the massive cheating.

Our movement is far from over – it is just starting!

Yup. And if you look around, and see the WALLS FALLING, you know the truth.

We’re winning. Slowly. Painfully. UGLY. But we’re winning.

SMILE through the GRIT and the PAIN, because….

W

Appendix: My notes of the speech, re-watching it

America First – right up front.

Our country is being destroyed before our eyes.

Democrats are destroying America – BUT THEY STICK TOGETHER.

We’re going to have a TREMENDOUS 2022 – just like 2020 (note hint about election fraud).

“We had a great election. Bad things happened, but we had a great election.”

Lists off all the bad that Democrats are doing, including TOXIC CRT “and illegal discrimination into our children’s schools”. NEW ATTACK ON DEMS!!!

After the long list……“Now, you tell me – do we take this?”

He talks about the radical Democrats, but then gets a misspelling on the teleprompter, at almost exactly 5:00 minutes.

“Together, we’re going to defund our freedoms…..” at which point he STOPS using the teleprompter – something is wrong.

He goes into a little spiel where he says both “defend” and “defund” a few times, and IMO he was sending a message about the misspelling back to the crew – then he talks about how bad things are, and that we’re going to see how bad things are – it’s clearly very repetitive – looks like there is some kind of PROBLEM with the script or the teleprompter and he is stalling.

It’s FIXED in under a minute, and he moves on.

Next, big kudos from Trump to Lieutenant Governor Mark Robinson. Then an endorsement for Virginia Fox. Then thanks to David Rouser. Then Dan Bishop (big cheers). Then Richard Hudson. Then Madison Cawthorne (lots of Trump compliments). Then Greg Murphy. Then very nice thanks to Ted Budd.

Then – Deb Meadows and Mark Meadows – and an interesting tale on the dynamic there – SHE being a Trump supporter before HE was.

Then a Trump “age well” statement – 2022 is going to be a banner year for North Carolina Republicans.

He then goes into an extended spiel about how, together, “we” and “you” (NCGOP) pushed back against a “blue North Carolina” destiny and turned it red.

He mentions the NC GOP senator who was just added, and predicts that there will be 2 or even 3 new GOP House members (presumably from NC) in 2022, and that we’re going to take over from Pelosi.

Then he mentions that we will be adding a Senator from NC, and winning the state in 2024, to big cheers.

Then, he makes subtle references to us seeing things like we’ve never seen before, in rejecting Joe Biden and the radical socialist Democrats – vague but interesting.

Then, in the process of inviting up Lara Trump (Eric’s wife and NC native), he mentions that Baron is now 6 feet 7 inches at 15 years old!

Lara lets us know that she is NOT running for the Senate seat, but that PDJT will be endorsing who IS running for it, AND that she is not ruling out a future run, but that this is a family (child-raising) decision. She also hints about 2024 being “3 and 0” for Trump/Republicans – thus implying a possible Trump run in 2024.

Then Trump segues into a somewhat surprise announcement of his endorsement of Ted Budd for the Senate seat, and invites Budd up to the microphone. “Complete and total endorsement.”

Afterwards, he comments about how he surprised Budd just before the speech with the news, and also mentions the press in the back, and chides them a bit.

After this a BIG defense of how he made a big bet on the vaccine, and WON – not only saving many lives, but also ending the crisis.

Next, he moves to the border – how terrible it is now – how GREAT it was before Biden destroyed it.

Trump notes that THOUSANDS of MS-13 were removed – and how he had to fight to get the countries to take them back.

But now, he switches gear and talks about the ASTOUNDING 1000% increase in illegal immigrants at the border thanks to Biden.

“Nobody ever thought they could do this much destruction to our country so quickly.”

“They’ve been abolishing ICE through agency directives.” – this is a killer argument.

“But the border is just the beginning of the Biden disasters.” (PLURAL)

Trump then goes into the economic stuff, contrasting American energy independence with gas prices. Among the boilerplate, he makes a prediction that “inflation will cause a catastrophe in the near future”.

Wedged in there – a reminder about the success with therapeutics against the pandemic.

Trump then goes into an extended recounting of how badly the employment situation is now, under Biden – how all that the Trump administration worked for is being wasted away – even quoting the New York Times.

He goes through a litany of disastrous Biden policies – just blood-boiling stuff – and then comes the switch….

“AND THAT BEGINS WITH STANDING UP TO COMMUNIST CHINA…..”

He then tags China with inflicting 16 TRILLION DOLLARS of damage onto the United States with COVID.

(Which gets interrupting applause when he calls it the CHINA VIRUS.)

Interesting point – Trump states that without the vaccines, we would have had a “1916 Spanish Flu number” of fatalities.

Then he goes to the lab origin point – the big TOLDJASO. This is then followed by lots of clarification about his relationship with Fauci, and Fauci’s love of the media. But then Trump points out how Fauci kept calling things OPPOSITE OF TRUMP, including border closures and masks – noting that Fauci said “no masks” at first, but then became a “radical masker”. Trump also joked about adding goggles and then “let’s wear them for another 5 or 6 years” – clearly what the Dems wanted.

“But Fauci has perhaps never been more wrong, than when he denied the virus and where it came from.”

And that is when he drops the big one.

REPARATIONS.

Huge cheers and applause.

“China must pay – they MUST pay.”

More huge applause.

Trump then calls for an immediate 100% tariff on all goods coming in from China. (And Trump notes that Biden hasn’t taken the tariffs off, either.)

Trump notes that not only would the tariffs bring jobs back to the United States – China would stop building its military.

Trump then notes that he had no desire to do trade deals with China after the virus. He takes pride in the deal they did for the farmers, but says he just didn’t care about a deal with China after the virus.

He mentions reinvesting the tariff money in bringing back jobs and factories from China and elsewhere, and gets into a one-sided “talking” conversation with a furniture maker in the audience. Trump tells the guy to “stay tuned” because they were planning to “bring it all back”. IMO, this is where things are going, once the FAKE ELECTION is taken care of.

Trump then says that China needs to be presented with a BILL from the world for 10 trillion dollars, which he says is a very low number.

Then another kicker. ALL COUNTRIES should collectively cancel all debt to China as a DOWN PAYMENT.

And RIGHT THEN is when he goes after this administration being TIMID with China, and “frankly, corrupt”, mentioning all the Chinese money going to Hunter Biden.

After a long recounting of Biden family corruption with China, and the press and social media hiding it for the election, he mentions IRAN.

Then North Korea. At this point, it really seems clear to the listener that the Democrats are up to something with all this money they send to our enemies. Trump makes a great joke about how he was able to deal with Kim Jong Un.

Trump keeps talking about Biden’s foreign policy nightmare, including criticizing Israel while it was under attack from missiles….. FROM IRAN. No mincing of words here.

Trump then segues into the TRAVEL BAN.

It will be lifted off, even after Trump won in SCOTUS. Then Trump talks about legal refugee admission caps going up – first 700% – then later 2000% (incredible!) – but then Trump makes a FASCINATING point.

“I don’t know what they’re doing [Democrats]. They don’t need them for voting. People say they need them for voting, but they don’t need them – they cheat so much for the voting, you don’t have to go through this process, OK?”

Something to think about.

Trump goes into a great comparison about how the press doesn’t report on Biden actually falling on the steps up to the plane, versus how they reported on him walking “gingerly” down the ramp at West Point.

He even jokes about “maybe that was a booby trap”, but (this is me talking) we know that’s no more possible than the teaching of critical race theory at West Point.

Trump then goes into stories about all the positives of his administration on military matters, including Germany and NATO. South Korea – making them pay.

Space Force – then ending the “endless wars” – then talks about wounded vets. Then he goes into the story about the bodies coming back. Definite tear-jerker. He spends a LOT of time on this. A LOT of time. He gets to the climax about the mother jumping on the coffin while it’s being carried, and segues that into WHY – these coffins coming back from “these places where so many mistakes were made – where we shouldn’t be”, and it just finishes it, on how they’re coming home now.

“And we haven’t lost one single soldier in Afghanistan since January of last year – not one single soldier has been lost.”

Then Trump notes that Biden has NOT stopped bringing the soldiers home – even questions whether stopping it would be possible – but finishes by saying he’s honored that they’re continuing to bring the soldiers home.

And then Trump gets into a very interesting section about bringing the soldiers home – “and we have other things to possibly get ready for” and then “we have to be respected as a military power” referring to “other bigger countries”, and then “they will take advantage of us, and you know what I mean by that”.

It all sounds very interesting, but just a HINT of what might be going on.

He then gets into a long section about what the Democrats are trying to take away from us. BIG APPLAUSE for RKBA (the right to keep and bear arms).

Next, he gets into Democrat indoctrination, and gets MASSIVE applause about BANNING critical race theory in schools.

BAN IT IN SCHOOLS.
BAN IT IN WORKPLACES.
BAN IT IN OUR STATES.
BAN IT IN THE FEDERAL GOVERNMENT.
AND IT SHOULD BE DONE IMMEDIATELY.

Then Trump notes that Democrats are trying to pass legislation to spend billions of dollars giving phony academic credits to students for going to protests. (Note – this is STRAIGHT OUT OF CHINA).

Then, Trump makes a HUGE link here, to SCHOOL CHOICE.

“If government-run schools are going to indoctrinate children with radical ideas, then Republicans must immediately pass legislation (basically school choice to get out of government schools)”.

“TO OPT OUT OF THE INSANITY”

Trump then gets into a really good and long section about the perversion of justice, and the weaponization of the law, using in part the fishing expeditions against him, including particularly within that, the handing of the attack to the radicals in New York.

“Prosecutorial misconduct.”

Then, a load of “where’s Durham?”

“Has anybody seen Durham?”

Talking about the Democrats:

“”All of this for nothing. It’s a shame.”

But then at the end…..

“We’ll never let it happen again.”

And then, after some more about the New York prosecutors….

“They won’t stop until November of 2024.”

This is where Trump gets into the election fraud in a HUGE way.

“The 2020 Election HOAX.”

And then he gets into the Time Magazine “confession”.

“They had to brag about what they did.”

Big cheers about people SEEING THE FRAUD.

Absolutely NO backing down.

Trump says the Arizona audit will be done in 3 or 4 weeks.

He talks about other states, and how they’re looking at it, too.

“Zuckerberg broke the law.” AMEN!!!

Followed by an interesting recounting of Zuckerberg and his wife coming for dinner at the White House.

Then Trump gets into one of the absolute best arguments he has ever made – that there is NO WAY the country is divided “50:50” on stuff like open borders, sanctuary cities, defund the police, and other issues like that.

This is brilliantly putting a disturbing thought in people’s minds. Let them “solve the problem”, because we know how it will solve.

Fake elections make all kinds of sense.

He then comes out and basically says that he does NOT believe the results of “some of these elections where Democrats have the advantage”. He argues that some of the blue states “just aren’t blue”. It’s VERY powerful.

“There is something going on, and we have to be very, very careful with our election process, because I don’t believe that we are a 50-50 nation.”

He then makes a great point about not only dead people voting, but dead people APPLYING to vote.

This is where he slides into one of his greatest lines, about how with stolen elections and open borders, we could have a dictator. But then….

“I don’t even think Biden is the dictator. If anybody knows who’s running that operation, could you let us know? Because I don’t think it’s Joe, but who the hell knows? Maybe it is.”

Back to the prosecutorial misconduct. And then:

“I’m not the one trying to undermine American democracy. I’m the one trying to save it. Please remember that.”

“We all know what happened with the election – and we can never, ever, let that happen again.”

Trump then goes into election integrity, and how important it is. He takes Biden’s attack on election reforms as “un-American”, and flips it right back on China Joe.

“Joe Biden called these common-sense reforms un-American, but the thing that is really un-American is an election scam.”

What’s interesting is that Trump puts CHINA at the top of the list of nations “happy” about the election theft. He mentions RUSSIA next, and then Iran, and he then puts them in order, with China at the top, and Iran next.

He then states that if HR1 passes, there will never be another fair election in our country.

But then, after going through a litany of needed reforms, including protection of poll watchers, Trump absolutely NAILS the “drop-boxes” and ZUCKERBERG.

“And we cannot have drop boxes paid for by Facebook and Zuckerberg – where, by the way, massive numbers – 95, 96% of the vote, is for Joe Biden – doesn’t happen.”

Trump then wraps up on election reform.

“Our movement is far from over – in fact, it is just getting started.”

He then goes into his end speech – WE WILL FIGHT FOR – family, jobs, made in America.

You need HIS WORDS.

https://www.rev.com/blog/transcripts/donald-trump-speech-transcript-at-north-carolina-gop-convention-dinner-june-5

Here in North Carolina, across the country, the Republican party will continue to fight for strong families, safe communities, and secure and sovereign borders. We will fight for more jobs, lower taxes, and pro-American trade deals that result in more North Carolina workers, forging more products, stamped with beautiful, beautiful phrases, but in particular made in the USA, Mr. Furniture Manufacturer. We will shut down outsourcing, bring back our supply chains, crack down on trade cheaters and violators, and ensure that America, not China, dominates the future of the world. We will protect innocent life. We will defend our glorious Constitution and we will uphold the Judaeo-Christian values and principles of our nation’s founding.

Donald Trump: (02:28)
We will break up the big tech monopolies, reject left-wing cancel culture, restore free speech in America, and demand free, fair and honest transparent elections. We will strengthen our military, support our great police, and always take care of our amazing veterans. Do you know that we got a 92% approval rating with respect to the VA? They rated us 92% approval rating. It’s never been anywhere even near that number. Very proud of that. With the American pride that fills our souls, we will teach our children to love their country, honor our history, and always respect our great American flag.

Donald Trump: (03:23)
Tomorrow marks the 77th anniversary of one of the most epic military trials in the history of the world, the allied invasion of Normandy on D-Day. As we remember this incredible achievement, let us summon the spirit of generations of Americans before us who gave their blood, sweat, and tears for our beloved country. All of us in this room inherit the legacy of the selfless patriots who won the battles, crossed the oceans, forged the steel, made the breakthroughs, climbed the summits, these great, beautiful summits, tamed the frontiers and seized the victories that built America into the single greatest nation in the history of the world. That’s where we want to keep it. That is our magnificent American inheritance, and there is nothing like it anywhere in the world, and there never will be. Let us go forward tonight, moved by their sacrifice, motivated by their example, inspired by their resolve, committed to their values and more determined than ever to make America prouder, freer, stronger, and greater than ever before. Thank you, North Carolina. God bless you, and God bless America. Thank you very much. Thank you.

The Spike Protein’s Purpose Betrayed By Its Own Superiority

TL;DR – you MUST listen to a short podcast of a scientist revealing the latest research on the spike protein vaccines. The VACCINE ITSELF (not just the spike protein – the mRNA vaccine itself) is persistent and is not only concentrating in ovaries – THE VACCINE ITSELF IS EXCRETED – e.g., in breast milk. Meaning – “shedding” of *VACCINE ITSELF* is real. And then it gets worse. That COVID researcher, Bing Liu, who was murdered? He was a member of one of the first groups to discover the “snake protein” analogy – LONG BEFORE THE VACCINES WERE RELEASED.

The Snake Protein – whoops – I mean Spike Protein – it’s all blowing up now.

The information is coming so fast I can barely get it into here before some NEW thing blows up.

Let’s start here.

BIG THANKS to DP for putting me on this trail.

That link is to an interview HERE:

https://omny.fm/shows/on-point-with-alex-pierson/new-peer-reviewed-study-on-covid-19-vaccines-sugge

This is really worth listening to. The doctor WARNS that what he’s going to say is a bit scary.

This is 9 minutes and 11 seconds you NEED TO HEAR.

This leads to his point about concentration in the ovaries.

Follow the above tweet to THIS tweet:

Which retweets THIS tweet:

And you can look at the animal data.

Observe how it persists for a long time. Look how it concentrates in the ovaries over that long period of time. Those numbers are SHOCKER and HUGE and stand out like a SORE THUMB.

THEY KNEW.

This same tweet is just a gold mine in the replies. Let’s start off with the SNAKE protein. You remember my last post about that?

Spike Protein = Spike Protein ≈ Snake Protein

Using Principles of Protein Equivalence and Analogy as Predictive Tools for Coronavirus Understanding Surely you’ve heard of the BROWN RECLUSE SPIDER. The brown recluse is related to several other recluses, and a couple of other families of spiders, that all have a similar venom – a protein called sphingomyelinase D. This is an enzyme that …

OMG, I was so much righter than I thought. Look at this REPLY to the tweet above.

Let’s just blow up those images.

First, some snake protein motifs in the spike protein (direct evidence). There is also correlation to rabies neurotoxin.

This comes from a French lab and was received in April of 2020.

Reçu le : 2020-04-16
Accepté le : 2020-04-18
Publié le : 2020-06-05
DOI : https://doi.org/10.5802/crbiol.8

ARCHIVE: https://archive.is/THeQ7

The second, referenced tweet, brings in Bing Liu, the murdered researcher.

Who was actually one of TWO murdered COVID-19 researchers:

LINK: https://www.strategic-culture.org/news/2020/05/17/new-pandemic-two-trailblazing-covid-19-researchers-dead-in-month/

ARCHIVE: https://archive.is/CgoeH

So what was this Bing guy’s lab working on?

Here is a sample:

This means they discovered the SNAKE PROTEIN ANALOGY. Before May 2020 was out. Bing was killed on May 2, 2020.

That comes from THIS paper, sent for review on May 26, 2020.

https://www.pnas.org/content/117/41/25254

Here is an archive of the paper, just in case:

https://archive.is/VdjE9

The author of the tweet, “alberto silva”, archived a tweet showing that he figured this out in November of 2020, before the vaccines were released.

ARCHIVE: https://archive.is/OfcuG

OK? Look – I’m sorry – this is such extreme bullshit, that I am finally starting to understand WHY “people” are pulling out all the stops here.

They have a PLAN.

They have an AGENDA.

I suspect that Bing Liu was mouthing off about the protein analogy in ways that threatened the WHOLE SPIKE PROTEIN VACCINES – or more likely the REAL PURPOSES of the vaccines.

Sure, there was money involved, but I think there was also a lot of AGENDA.

I mean – let’s just say that I know a certain researcher who didn’t die in a lab accident that used MK to pull it off, which lab accident was very convenient to both money and agenda, and would have been even more convenient had both injured parties DIED.

And now we’ve got what looks like TWO MK murders – one of a COVID researcher who spotted the problems with the full spike protein vaccines – the second an Army doctor connected to the origins of the pandemic in Wuhan. In these cases, MK was likely used on third-party violence-prone individuals.

This is WAY bigger than Fauci. And THAT is likely why the Democrat media is setting Fauci on fire.

It’s a FIREBREAK. It’s a CUOMO KISSING SCANDAL DIVERSION.

It’s WAY, WAY, WAY bigger than Fauci.

DO NOT SETTLE FOR FAUCI.

THIS BRINGS DOWN THE WHOLE CABAL.

I am not kidding.

W

PS – From this information, one can see how luciferase actually matters – it’s used to report on WHERE THE VACCINE GOES in the crucial hidden data on the vaccines. This is potentially another reason why “luciferase disinformation” was distributed to vaccine opponents, through a variety of means, including early information about the Moderna vaccine itself, which was not true, but served as attractive chaff to keep opponents from discovering the REAL problems with and purposes of the vaccines. There are multiple reasons why this was done, but one of them is obvious now – obscuring THIS critical work. In any case, it may be possible to use the distribution of disinformation to vaccine opponents as a way to figure out who in the industry KNEW what was being covered up.

References

Deplorable Patriot’s tip that put me onto this stuff:

LINK: https://www.theqtree.com/2021/05/30/dear-kmag-20210530-open-topic/#comment-746375

Tweet on spike protein problem study:

LINK: https://twitter.com/pc_432/status/1399087077392674817

Alex Pierson interview with immunologist about spike protein:

https://omny.fm/shows/on-point-with-alex-pierson/new-peer-reviewed-study-on-covid-19-vaccines-sugge

Tweet on ovarian concentration:

LINK: https://twitter.com/pc_432/status/1399087079393415168

Tweet with ovarian concentration data:

LINK: https://twitter.com/cov19treatments/status/1398971745483251716

Tweet on spike protein / snake protein correlation:

LINK: https://twitter.com/amicocolorido/status/1399105106562457600

Earlier Tweet on spike protein / snake protein correlation (Nov. 3, 2020):

LINK: https://twitter.com/amicocolorido/status/1323671478395699200

Thread reader archive of spike protein / snake protein tweet:

https://threadreaderapp.com/thread/1323671478395699200.html

Article on murdered COVID researchers:

https://www.strategic-culture.org/news/2020/05/17/new-pandemic-two-trailblazing-covid-19-researchers-dead-in-month/

Archive of article on murdered COVID researchers:

https://archive.is/CgoeH

Snake protein correlation first identified in this paper:

https://comptes-rendus.academie-sciences.fr/biologies/item/CRBIOL_2020__343_1_33_0/

Archive of snake protein paper 1:

https://archive.is/THeQ7

Snake protein correlation also first identified in this paper:

https://www.pnas.org/content/117/41/25254

Archive of snake protein paper 2:

https://archive.is/VdjE9

Archive of tweet showing understanding of problem and murder by November 2020:

https://archive.is/OfcuG