Dear KMAG: 20230807 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

deranged

adjective

  • Disordered; especially, disordered in mind; crazy; insane.
  • Disturbed or upset, especially mentally.
  • Insane.

Used in a sentence

Rep. Jamie Raskin, D-Md., slammed former President Donald Trump’s legal defense in his criminal case over the 2020 election as “deranged.”

Used in a Truth Social post

“Do you think that A.G. Garland, and Deranged Jack Smith, understand that we are in the middle of a major political campaign for President of the United States? Have they looked at recent poll numbers?” Trump wrote.

Used in a theory

I’ve been wondering why Trump keeps referring to “deranged” Jack Smith, when the history of John (his real name) Smith shows no indication of ever being deranged in any way, or even having ever been a mental patient, unstable, etc.

And yet – well – when this allegedly sane person Jack Smith read off the weird crap charges against Trump, with utter seriousness, he sounded to me like a nutcase.

HOLD THAT THOUGHT.

I believe that Smith is an “MK ULTRA” subject, and that Trump is hinting at this. It is my contention that MK ULTRA leads to a variety of forms of brain damage, as side effects of the process of mental manipulations.

Among the people who I suspect have been conditioned by MK ULTRA (see many earlier posts), for a variety of purposes:

  • Whitey Bulger
  • Robert Mueller
  • Loretta Lynch
  • Merrick Garland
  • Christine Blasey “Two-Door” Ford

Whitey Bulger was likely used to test MK ULTRA’s capacity to carry out murder.

Robert Mueller’s sad dementia and wrecked brain seem very post-MK to me. Recall Mueller’s close relationship with Bulger during Bulger’s work as an “informant” who was murdering other criminals (likely under MK ULTRA).

Merrick Garland likewise shows damage from tampering, IMO.

Loretta Lynch had nearly complete amnesia about critical events when she had to testify. IMO she would pass a lie detector test about any items in her “selective memory” – because of MK ULTRA.

Christine Blasey Ford is a powerful example of the derangement resulting from MK ULTRA. She is a human puppet who can be made to say anything. Clearly this is “deranged”.

I believe that MK ULTRA was used to take over DOJ. “They” literally brainwashed critical people in DOJ and FBI.

Bottom Line:

Jack Smith is “deranged” = brainwashed = MK ULTRA

https://www.newsweek.com/donald-trump-deranged-jack-smith-election-interference-1814772


More “country” music! (as in THIS country)

And some epic Two Steps From Hell for Wheatie….


I am getting used to the local work. I’m getting stronger.

THINK globally.

ACT locally.

TWO can play that game.

Hope you’re STILL having a great summer!


ENJOY THE SHOW

W

Wolf’s Statement on the End of Affirmative Action


I have tried to write this several times.

I have decided to be short, blunt, and to the point.

Here it is, very simply.

I was part of the cover-up of the early failure of Affirmative Action.

And when I say EARLY, I mean it failed during the alleged TESTING – meaning the very first year they put AA students on campus, which was supposed to be a test, but was really an unstoppable, unchangeable, unarguable implementation, that was going to happen, no matter what.

Let me be crystal clear.

Affirmative Action failed RIGHT OUT OF THE GATE.

I was there, and was an integral part of the disaster and the cover-up. And, quite frankly, I’m lucky I’m still alive. But I learned to keep my mouth shut for a very long time, and how to stay ahead of the people who needed me “gone” in some legal, plausible, and useful fashion.

Here is a bullet list of what happened. It’s long, but it gets the point across quickly, how the failure of Affirmative Action became known, and was then covered up.

  • I was working on an advanced science degree at a very fancy university
  • The university was informed that we would be getting Affirmative Action students
  • There were only a few of these students
  • This was supposed to be some kind of test, but it really was more of a “done deal”
  • I was warned by a friendly superior to steer clear of these students, and I did, but I didn’t realize why
  • One AA student in my professor’s class was caught cheating
  • I got the scoop from the teacher involved – the cheating was stupid and desperate – it was almost a cry for help
  • The student was clearly out of their depth
  • The failure was likely to mean the student would fail the course
  • AT THIS POINT, AFFIRMATIVE ACTION WAS IN TROUBLE – if this was really a “test”
  • It was obvious to me that Affirmative Action would require a “fix” to actually work
  • I was an idiot and thought I could help Affirmative Action work
  • I suggested the idea of a remedial program, which had worked for unprepared math students at my previous university
  • That was it – I just mentioned this to the professor
  • TIME GOES BY – we hear nothing
  • The next thing I know, this same student was placed into our research laboratory, as an undergraduate researcher, by orders from the university
  • This was absolutely insane, dangerous, and utterly backwards to all common sense – only the BEST students are normally allowed into undergrad research in any university
  • The professor could not stop this – it came from too high up the chain
  • As one might predict, there was a DISASTER involving this student.
  • The disaster resulted in a lawsuit
  • The next five parts are very important – it’s about LAWFARE
    • (1) The lawsuit conveniently prevented the university from reporting anything about the student to the government, due to “conflict of interest”
    • (2) The lawsuit therefore prevented the university from reporting anything bad for Affirmative Action
    • (3) The lawsuit prevented the university from taking any public position regarding Affirmative Action
    • (4) The lawsuit created leverage on everybody involved, to hide what happened
    • (5) The lawsuit resulted in NDAs on everybody involved, to silence them on what happened
  • Bottom line, the “forced disaster” protected the truth about Affirmative Action from ever being known

However, that’s just the superficial, top-level view.

I was close enough on this sucker, and paying enough attention, that I realized things were EVEN WORSE THAN THAT.

This disaster didn’t just happen because putting a deficient student in a dangerous place is a dangerous idea.

SOMEBODY MADE SURE THERE WAS A PROBLEM.

Yes. This was a scam – an engineered accident. And the technology used to pull it off was astounding. So much so, that it was unbelievable, and I had to hide it. I simply could not testify to something that people could not believe.

For a long time I thought that the money of the lawsuit was the driving force behind SOMEBODY deciding to use cutting-edge technology, but the economics just were not there. Nope – it was the millions, and then billions, and eventually TRILLIONS of dollars at stake.

Once I realized that this was really a deep-state thing for billions and trillions of dollars, and not just a lawsuit for measly low millions, it all started making sense.

Now, I don’t want to get any deeper into how they pulled this off, than what I’ve already revealed, because I like keeping a few nukes handy, in case somebody wants to make this into a big deal. They want to go there, I can REALLY make this a big deal.

If you want to know more details than that, just read this earlier post I wrote about the topic.


Déjà Woo

This post is rather long, and it ultimately leads to VALIDATE what Q said about MK. And beyond. WAY beyond. I’m choosing to spill enough now that no matter what happens, or what happens to me, they will no longer be able to keep using MK for murders and getting away clean. People will SPOT …


Now, let me be clear – I’m not saying that all Affirmative Action students can’t handle the rigor of the universities they are pumped into, over more qualified students. But we are lying to ourselves to think that there is no downside to lowering standards of admission. I encountered that downside in the very first Affirmative Action student to come through our department’s classes.

An interesting debate on the topic is this one, which involves Michelle Obama. She was, if I’m dating things properly, admitted in the second year of Affirmative Action.

In my opinion, both sides arguing in the linked article are “right and wrong” about things. There were definitely VERY FEW Affirmative Action students in the first year, and not that many in the second year, if I remember things correctly. Bear in mind – not all black students were Affirmative Action cases. Eventually, though, the effect on the student population was very noticeable. The timing, IMO, isn’t all that important.

Nevertheless, I would not be surprised if Michelle Obama really felt isolated on campus, despite likely being among perhaps a few hundred other AA-admitted students.

But much of what the rabbi is saying is quite right. Students who are not qualified to enter these schools were being prioritized over students who were qualified, due to race, and it was eventually a very big deal, that caused a LOT of problems.


So what’s the point, in the end? We know the Deep State does what it wants. They make their money in the name of some good thing that they inevitably lie about and FAKE.

The Deep State can and will roll over anybody that they need to roll over. We’ve seen what they did to Trump.

But yet, all that is not what matters.

Thanks to all this stuff, I found God. I mean, not like I did when I was a kid. I mean deeply, and in a big way, and as an adult.

It’s DIFFERENT when you walk through the Valley of the Shadow of Death, and you LEARN the hard way that GOD is your only real ally. And it’s not just magic, or the belief in magic, but the reality of how one deals with the universe, and how the universe deals back. God is a very “complex” thing, with both “real” and “imaginary” components. I am grateful for ending up with the understanding that I eventually got.

I lost a lot of things IN THIS WORLD, but in many ways that was purifying. I was stripped of much corruption and my worldly idols, and was left with GOD and the best teacher of all, the LORD JESUS CHRIST, the carpenter who dared to speak truth in a world of lies.

Affirmative Action was a noble cause, for those who believed in its truth, just as the response to 9/11 was a noble cause, for those who believed in its truth.

The problem is, neither one was completely true. Affirmative Action was never meant to be a logical reality. It was Hollywood. It was a story. It was Potemkin. It was fake. It was a societal version of “fake it until you make it”. They had no intention of doing it right.

I still believe in the “ends” of Affirmative Action – that Martin Luther King, Jr.’s dream can and will be achieved. But that end will NOT be achieved through these means – through deception and lies. It can only be achieved through truths. Sometimes those truths will be painful. Sometimes they will be joyous. But in the end, they will be part of the story – the TRUE story – that makes America great.

God bless you, and thank you for listening.

W


Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With a little help from our “friends in high places”!

Oh, yeah – we’re headed back to the WHITE HOUSE!

HANG ON for the ride of your life!


Dedication

Image: https://i.pinimg.com/originals/d5/e5/ad/d5e5ad861f1fc08b93a6d511ed5ff19f.jpg

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655

Our heroine in high definition!


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Never talk about committing violence in a reply to Wolf or in response to anything Wolf has said, or you may get put into moderation so that your comments can be screened. This is ONLY because DHS is now playing door-knock Gestapo with people who have spoken at school board meetings, made public comments, etc. DHS regime jackboots are knocking on doors of school board mama bears and stupidly insinuating potential violence from things people say or don’t say on social media. A guy in Ohio pointed his FINGER at the school board, and they went after him, armed with pictures of the pointing, and screen captures of online comments. Yeah.

SO – give the Nazis ZERO ammo. Keep any mention of violence, even joking, away from Wolf, so that he doesn’t have to “explain” humor to humorless jackboots who pretend not to know things.

As for discussion of “violent humor” among yourselves (e.g., “#TeamHeadsOnPikes”), just use whatever discretion you think is appropriate for yourselves. I will only put you in moderation if your comments create problems for ME or THIS SITE, but not if they only impact you.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.

A bit of a paraphrase, I’ll admit, but it makes a few key points!


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Here is Wheatie’s selection from just over 2 years ago!

“For your listening enjoyment, I offer this uplifting composition from Andreas Kübler of Really Slow Motion, titled ‘Save Me’:”

Wheatietoo

LINK: https://www.theqtree.com/2021/01/25/20210125-joe-biden-didnt-win-daily-open-thread/


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

This is the weirdest set of “data joins” in my history of researching things, but it is all starting to make sense – so I’m going to invite you into the story.

The story starts recently, when this tweet appeared in my timeline:

Weirdly, I cannot find this tweet in context in Elena’s tweets or replies on Twitter. If you check out her Twitter, she is a solid retweeter of a lot of great stuff – but I have no clue where she found this.

Anyway, after I saw it, it led to THIS post:


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


If you have not read that, please at least read a bit of it, including the “TL;DR” part, so that you can make sense of the rest of THIS post.

I did some posting about this yesterday on Twitter. Surprisingly there was no traction. This thread still has barely over 100 views on the first tweet.

I moved from the normal posting strategy, to “replying to the bigs”. Same problem – no traction.

It’s even worse today. All day I have been trying to get people to pay attention to this, and my Tweets go nowhere. However, a few examples will show you the core message, almost better than a TL;DR would.

I dumped an entire thread on a long response to ChiefNerd…..

I started replying about this stuff everywhere!

I found ONE other person tweeting about the paper – and he had almost zero engagement. And I only found the guy because I searched on the special sequence, PRRARSV.

Eventually, I even tried “mystery” to get engagement, and to get past any censorship.

No dice.

Anyway, later, THIS happened with Aubergine, from my earlier speculation about a Codemonkey Tweet.

LONG THREAD.


SO – anyway – I started a thread on Twitter…..


[We will see where this goes today. I will add more thoughts as we go on. Publishing now, for the midnight unofficial deadline….]



Wolfie’s Wheatie’s Word of the Day Year Week:


translocation

noun

  • a change of location.
  • a transfer of a chromosomal segment to a new position, especially on a nonhomologous chromosome. Also called chromosomal translocation.
  • a chromosomal segment that is translocated.

Sub-types:

  • chromosomal translocation: see above.
  • reciprocal translocation: balanced, 2-way exchanges of material between chromosomes.
  • non-reciprocal translocation: unbalanced, one-way movement between chromosomes.
  • Robertsonian translocation: a special type of chromosome rearrangement merging long arms of a chromosome and eliminating the short arms.
  • nuclear translocation: movement of genetic material into or out of the cell nucleus.

Used in an Abstract:

Although the S [spike] protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.

Shown in an Image:

Figure 4. Colocalization between S mRNA and S protein inside infected cells. The images (see Figure 3) were analyzed by using the surface rendering and colocalization features of IMARIS. S protein and S mRNA distribution and colocalization in the cytoplasm (top panel), on the nuclear surface (middle panel) and inside the nucleus (bottom panel). The specific region of colocalization is indicated by a white spot. Scale bar 0.5 μm.

ENJOY THE SHOW

Have another great week!

W

A Tactical Analysis of Trump’s Speech to the GOP in North Carolina

NOTE: Colorful language warning. I’ve got my reasons.


In my opinion, Trump’s speech to the North Carolina GOP on the evening of June 5, 2021 was BIG COMMS.

As I was watching it, I realized that it’s IMPORTANT.

The first step is to LISTEN TO IT. If you have not done so, then please REMEDY THE SITUATION.

I will give you TWO OPTIONS.

Option 1 – Listen to a video of Trump’s speech

The speech is not quite an hour and a half – more like an hour and 15 minutes. The video contains a good chunk of time AFTER it was finished.

Option 2 – Read a transcript of Trump’s speech

https://www.rev.com/blog/transcripts/donald-trump-speech-transcript-at-north-carolina-gop-convention-dinner-june-5

The transcript is surprisingly good, although there are some minor errors.


The Big Context & Why Trump Lauds the Vaccine

Before we get started, I need to put this stuff in context. Some very BIG context. I may get a bit “drill sergeant” on you, but YOU NEED IT.

The fact of the matter is that we have been CUT OFF FROM TRUMP for – depending upon how you measure it – between 4 and 7 months. Social media attempted to BAN Trump to stop what’s coming, but as Q said, “nothing can stop what’s coming”. Nevertheless, they tried.

Trump has successfully USED this time of enforced semi-silence to get a lot of things done. You may not realize that, but it will become more and more apparent as the world which opposes Trump, MAGA and America First, CRUMBLES BEFORE US.

Some of the crumbling is beginning. This video, posted yesterday by Scott, tells you about the ALLOWED CRUMBLE. So does this post by Political Moonshine.

THIS part of the downfall is what the “cabal” WANTS.

You probably never heard of this “DRASTIC” group which is now being set up by the mainstream media as some kind of crowd-source Woodward and Bernstein.

Let’s start right here with that. Woodward and Bernstein were CHUMPS. They were USED. They found what they were supposed to find. PART of the story. Nixon was brought down by a SET-UP SCANDAL – a scandal created by the REAL scandal – just like OBAMAGATE tried to bring down Trump with a created scandal of RUSSIAGATE.

Halper was there. What do you think he was doing?

You understand?

Ask yourself – why are the members of “DRASTIC” – who have been monitored on Twitter by the CIA and DNC this whole time, without being banned – allowed to stay there, while feminist author Naomi Wolf is suspended for cautioning about the vaccine?

Likewise, you are seeing nothing on the mainstream media about the Pfizer documents released by Japan, showing that the scientists at Pfizer KNEW the vaccine was PERSISTING LIKE A DEMON and HEADING STRAIGHT FOR THE OVARIES LIKE A BAT OUT OF HELL.

Only taking enough time – way too much time – so that almost anything was possible.

Suddenly the idea of a persistent lipid nanoparticle, handily schlepping mRNA, seemingly designed to migrate throughout the body over DAYS, and actually DOING SO, therefore ALSO being secreted in SKIN LIPIDS, didn’t sound like science fiction. “Shedding” is now not just a theory – it’s a natural consequence of this data. It would take a NOVEL THEORY to say why it should NOT happen.

As we say in science, “HOLY FUCKING SHIT! LOOK AT THOSE NUMBERS!”

And we didn’t just have what I had speculated – SPIKE PROTEIN shedding evidence – as powerful as that TOXIC spike protein is. We have both theory and evidence of VACCINE SHEDDING.

Oh – and speaking of snake protein toxicity – we now know that several research groups spotted the snake protein relationship to the spike protein early and submitted their discovery in April and May of 2020, in one case less than a month after what looks like a “targeted MK murder” of one of the researchers.

None of this stuff is coming out. What is coming out is a CHANGE IN SCRIPT that lets CHINA act out, and CHINA JOE respond predictably. The Wuhan lab stuff – obvious as it always was – is suddenly being admitted, both to gain media credibility, and to create a political sandbox for the DNC, the globalists, the media, and China to CONTROL THE NARRATIVE.

It is quite easy, right now, to predict that, in the end, China will “admit” that it had a lab leak, and because the WORLD didn’t provide enough money to CHINA, to have better labs, BAD THINGS HAPPENED. Robber Joe will then send BILLIONS TO CHINA.

Get the picture? This is ALL bullshit of the highest order.

NONE of the stuff about contraception, population control, spike protein toxicity, vaccine persistence and shedding – NONE of that stuff will be admitted, or even discussed.

FAKE INVESTIGATIONS MAKE STUFF GO AWAY.

Now, I’m not going to get into exactly WHY they all did this, because they ALL have different motivations. But just bear in mind, that when I heard Melinda Gates say that (let’s play their caps game backwards) blacks and amerinds needed to take the vaccine FIRST – yeah. When the contraceptive nature of the spike protein appeared, Gates & Gates sure went running for the MONEY EXITS, with the mainstream media helping sow the Epstein angle as the reason.

LOL. Can’t fool EITHER Wolf.

It should now be clear that there is SOME collapse of the COVID narrative that are going to be allowed, or even promoted and TIMED, and others that are NOT ALLOWED. Even within the allowed parts, the RELATIVE RATES of REVELATION and PUBLIC UNDERSTANDING will have all kinds of effects on the POLITICAL OUTCOMES, and in particular WHO SURVIVES and WHO DOESN’T.

Take a HINT from skiing, surfing, mountain-biking, parachuting, “dirt-surfing” down a mountain, falling on a rope, and a lot of other things which are a balance between gravity and artful resistance.

The key to survival, and better still, GRACEFUL SURVIVAL, is to LET IT HAPPEN BEAUTIFULLY.

SO – back to Trump – and some reality.

The vaccine is not going to kill everybody who takes it. Don’t fall for extreme predictions. Anybody predicting that idea is pushing far beyond what we can know now – to say it kindly. Yeah, if everybody keeps taking the same terrible wrong mRNA spike protein vaccines or new, changed ones, for a long time, maybe we end up with a Marek’s situation, or more likely a small percentage of cancers or immune problems, but again, we are not sure any of that will happen. In the meanwhile, most of my neighbors take the vaccine, and little or nothing apparent happens to them.

I do appreciate the various “vaccine whistleblowers” who have WISELY stepped up to point out RISKS that the industry is FAILING to tell us about.

But the truth is, the vaccines that Trump pushed almost undoubtedly SAVED LIVES overall. Yeah, the CDC lied like crazy, and a lot of people died who didn’t have to, because Trump was no longer in a place where he could modulate the vaccine administration. People who should never have gotten the vaccine got it, because the contraindications – easily GUESSED, but moreover KNOWN and FULLY UNDERSTOOD – did NOT appear on those BLANK circulars included in the boxes with the vaccines.

They PUSHED the vaccines for POLITICS, not MEDICINE, and that, my friends, is STALINISM.

CDC LIED – PEOPLE DIED – and Rod Rosenstein’s sister, Nancy Messonnier, has quietly LEFT CDC.

Yeah. DAMAGE CONTROL.

Trump is going to tout the BIG PICTURE – that the vaccine – (bad as it was, but don’t say that) – worked. It was, by and large, like a mildly lethal form of cowpox would have been as a smallpox vaccine. Thanks to Democrats, big pharma, eugenicists, China, and a pantheon of allied evil, things were not as optimal as they would have been with TRUMP in the White House. But as far as what Trump was ABLE to do, it WAS optimal.

As Cthulhu likes to say, Trump pushed through the ambush, and it WORKED. The vaccines were never REQUIRED, except belatedly, by every smaller, devious, corporate-mediated and state-mediated means that the EVIL DEMS can think of. But the vaccines are still basically not required, thank God.

Now – that is only part of the context.

THERE IS A BIGGER CONTEXT. FAKE ELECTIONS.

You will see, Trump is headed STRAIGHT INTO THAT BATTLE.

Here is a secret. The other side will do ANYTHING to stop the undoing of fake elections, and in particular the unseating of Joe Biden. They would create a “whole ‘nuther scandal” – a really big one – to distract from the scandal of fake elections. They would even push a phony conflict with China.

Are you getting the picture?

Good.

We are headed into a beautiful storm. Prepare to STORM-SURF.


The Messages from Trump’s Speech

I went BACK through Trump’s speech, and took notes. You can READ those notes at the end, as an appendix.

What I will do here is present my biggest-picture impressions from looking over those notes.


Biden is destroying America – are we going to take this?

It was a simple question, but this is a message to YOU.

If YOU resolve that we do NOT get to the 2022 election without SOLVING the 2020 election – and I mean YOU REALLY RESOLVE – that THEY REALLY SOLVE – well, things could get very interesting.

I’ve made my peace. I’m ready. Are you?

Catastrophic inflation is coming – get ready.

We lived through it before, but we will live through it again.

WHY, you might ask.

Because inflation is a weapon of FEAR, and it’s ALL THEY HAVE NOW.

Expect inflation. They are going to throw EVERYTHING at us to keep Robber Joe in the White House.

China owes US, and the world, trillions of dollars in reparations.

This is HUGE. Screw puny BLM reparations.

Do you know that they now have a way to image COVID damage to lungs? As in MY LUNGS?

Yeah. Wait long enough, and the TRUTH comes to YOU.

Now you know why I took a lesson from the Sioux and never gave up, and never relented from alleging WHAT THEY DID. And my CHURCHILL PAPERWEIGHT.

“NEVER, NEVER, NEVER QUIT.”

100% tariff across all products from China needs to be imposed.

Trump noted that Biden has NOT removed the tariffs. Now Trump also notes that China will send it’s stuff through other countries to beat the tariffs, and China Joe will use that to give China an out, but who knows.

But I think it’s coming. If not soon, then soon enough.

Cancelling ALL debt to China by ALL countries is a down payment

This got huge cheers, and hell yes. DO IT.

Trump is king-maker – and he is using it.

Trump was reveling in his power to SHIFT THE BATTLE.

But at the same time, Trump emphasized that his endorsements are a WIN FOR THE GOP.

Wake up, RINOs.

Trump also sent some HINTS about running in 2024. Interesting.

Dems are not letting illegals in for voting – it’s something else.

This is VERY intriguing. I’m still thinking about this.

Terror? Spies? Something is up.

Endless wars are ending, and even Robber Joe is going along with it.

Trump really spent a lot of time on this. He thinks its important. We are NOT going back to endless war.

We need to STAY on that message. They will ALWAYS try to come back with a WAR to snake us.

Critical race theory must be banned everywhere

This got massive cheers.

Critical race theory is DEMOCRAT POLITICS. It’s CHINA politics. Get it the FUCK OUT. Of EVERYTHING.

School choice must be passed to get out of insane public schools

This just makes so much sense now. We need to CLEAN HOUSE to get this PASSED.

Prosecutorial misconduct will continue until November 2024

Do you have a plan if Trump is arrested?

You should.

You don’t have to tell anybody what it is. You don’t even have to tell anybody that you have one. It can be VERY subtle. But PLAN for how YOUR WORLD CHANGES – and how THEIR WORLD CHANGES – when they pull that final fuckage.

Make sure they RUE THE DAY for the REST OF THEIR LIVES.

The Arizona audit will be done in 3 or 4 weeks

Likewise, prepare.

Be prepared to NOT BACK DOWN. No matter what the Communist Democrats and CHINA do.

I’m not kidding.

THE DIAMONDS MUST BE RETURNED.

Zuckerberg and Facebook broke the law, including drop-boxes

Trump GETS the insanity of MAGIC DROP BOXES.

There is a reason magicians use what are essentially drop boxes. I have described how I witnessed this, when I dropped off OUR ballots at a Democrat-wo-manned drop-box. It was not pretty.

Zuckerberg knew this. He’s EVIL. He’s a LIAR. He’s a CON ARTIST. He deserves JAIL.

After a nice fair trial that humiliates him before the world.

Expect to see things we have not seen before RE election & audits

Like I said, get ready. In a few weeks, things start getting sketchy.

Prepare to say FUCK YOU to the other side. We want JUSTICE.

The country, and many states, are not actually “50:50”

This is a powerful concept. There is NO WAY that half the electorate wants defunding the police, open borders, fewer jobs, sanctuary cities, and all these things Democrats are pushing.

The implication if clear. Democrats DEPEND on cheating to stay in the game in a winning way.

Trump even thinks some nominal blue states are not actually blue – and indeed, this would explain the massive cheating.

Our movement is far from over – it is just starting!

Yup. And if you look around, and see the WALLS FALLING, you know the truth.

We’re winning. Slowly. Painfully. UGLY. But we’re winning.

SMILE through the GRIT and the PAIN, because….

W


Appendix: My notes of the speech, re-watching it

America First – right up front.

Our country is being destroyed before our eyes.

Democrats are destroying America – BUT THEY STICK TOGETHER.

We’re going to have a TREMENDOUS 2022 – just like 2020 (note hint about election fraud).

“We had a great election. Bad things happened, but we had a great election.”

Lists off all the bad that Democrats are doing, including TOXIC CRT “and illegal discrimination into our children’s schools”. NEW ATTACK ON DEMS!!!

After the long list……“Now, you tell me – do we take this?”

He talks about the radical Democrats, but then gets a misspelling on the teleprompter, at almost exactly 5:00 minutes.

“Together, we’re going to defund our freedoms…..” at which point he STOPS using the teleprompter – something is wrong.

He goes into a little spiel where he says both “defend” and “defund” a few times, and IMO he was sending a message about the misspelling back to the crew – then he talks about how bad things are, and that we’re going to see how bad things are – it’s clearly very repetitive – looks like there is some kind of PROBLEM with the script or the teleprompter and he is stalling.

It’s FIXED in under a minute, and he moves on.

Next, big kudos from Trump to Lieutenant Governor Mark Robinson. Then an endorsement for Virginia Fox. Then thanks to David Rouser. Then Dan Bishop (big cheers). Then Richard Hudson. Then Madison Cawthorne (lots of Trump compliments). Then Greg Murphy. Then very nice thanks to Ted Budd.

Then – Deb Meadows and Mark Meadows – and an interesting tale on the dynamic there – SHE being a Trump supporter before HE was.

Then a Trump “age well” statement – 2022 is going to be a banner year for North Carolina Republicans.

He then goes into an extended spiel about how, together, “we” and “you” (NCGOP) pushed back against a “blue North Carolina” destiny and turned it red.

He mentions the NC GOP senator who was just added, and predicts that there will be 2 or even 3 new GOP House members (presumably from NC) in 2022, and that we’re going to take over from Pelosi.

Then he mentions that we will be adding a Senator from NC, and winning the state in 2024, to big cheers.

Then, he makes subtle references to us seeing things like we’ve never seen before, in rejecting Joe Biden and the radical socialist Democrats – vague but interesting.

Then, in the process of inviting up Lara Trump (Eric’s wife and NC native), he mentions that Baron is now 6 feet 7 inches at 15 years old!

Lara lets us know that she is NOT running for the Senate seat, but that PDJT will be endorsing who IS running for it, AND that she is not ruling out a future run, but that this is a family (child-raising) decision. She also hints about 2024 being “3 and 0” for Trump/Republicans – thus implying a possible Trump run in 2024.

Then Trump segues into a somewhat surprise announcement of his endorsement of Ted Budd for the Senate seat, and invites Budd up to the microphone. “Complete and total endorsement.”

Afterwards, he comments about how he surprised Budd just before the speech with the news, and also mentions the press in the back, and chides them a bit.

After this a BIG defense of how he made a big bet on the vaccine, and WON – not only saving many lives, but also ending the crisis.

Next, he moves to the border – how terrible it is now – how GREAT it was before Biden destroyed it.

Trump notes that THOUSANDS of MS-13 were removed – and how he had to fight to get the countries to take them back.

But now, he switches gear and talks about the ASTOUNDING 1000% increase in illegal immigrants at the border thanks to Biden.

“Nobody ever thought they could do this much destruction to our country so quickly.”

“They’ve been abolishing ICE through agency directives.” – this is a killer argument.

“But the border is just the beginning of the Biden disasters.” (PLURAL)

Trump then goes into the economic stuff, contrasting American energy independence with gas prices. Among the boilerplate, he makes a prediction that “inflation will cause a catastrophe in the near future”.

Wedged in there – a reminder about the success with therapeutics against the pandemic.

Trump then goes into an extended recounting of how badly the employment situation is now, under Biden – how all that the Trump administration worked for is being wasted away – even quoting the New York Times.

He goes through a litany of disastrous Biden policies – just blood-boiling stuff – and then comes the switch….

“AND THAT BEGINS WITH STANDING UP TO COMMUNIST CHINA…..”

He then tags China with inflicting 16 TRILLION DOLLARS of damage onto the United States with COVID.

(Which gets interrupting applause when he calls it the CHINA VIRUS.)

Interesting point – Trump states that without the vaccines, we would have had a “1916 Spanish Flu number” of fatalities.

Then he goes to the lab origin point – the big TOLDJASO. This is then followed by lots of clarification about his relationship with Fauci, and Fauci’s love of the media. But then Trump points out how Fauci kept calling things OPPOSITE OF TRUMP, including border closures and masks – noting that Fauci said “no masks” at first, but then became a “radical masker”. Trump also joked about adding goggles and then “let’s wear them for another 5 or 6 years” – clearly what the Dems wanted.

“But Fauci has perhaps never been more wrong, than when he denied the virus and where it came from.”

And that is when he drops the big one.

REPARATIONS.

Huge cheers and applause.

“China must pay – they MUST pay.”

More huge applause.

Trump then calls for an immediate 100% tariff on all goods coming in from China. (And Trump notes that Biden hasn’t taken the tariffs off, either.)

Trump notes that not only would the tariffs bring jobs back to the United States – China would stop building its military.

Trump then notes that he had no desire to do trade deals with China after the virus. He takes pride in the deal they did for the farmers, but says he just didn’t care about a deal with China after the virus.

He mentions reinvesting the tariff money in bringing back jobs and factories from China and elsewhere, and gets into a one-sided “talking” conversation with a furniture maker in the audience. Trump tells the guy to “stay tuned” because they were planning to “bring it all back”. IMO, this is where things are going, once the FAKE ELECTION is taken care of.

Trump then says that China needs to be presented with a BILL from the world for 10 trillion dollars, which he says is a very low number.

Then another kicker. ALL COUNTRIES should collectively cancel all debt to China as a DOWN PAYMENT.

And RIGHT THEN is when he goes after this administration being TIMID with China, and “frankly, corrupt”, mentioning all the Chinese money going to Hunter Biden.

After a long recounting of Biden family corruption with China, and the press and social media hiding it for the election, he mentions IRAN.

Then North Korea. At this point, it really seems clear to the listener that the Democrats are up to something with all this money they send to our enemies. Trump makes a great joke about how he was able to deal with Kim Jong Un.

Trump keeps talking about Biden’s foreign policy nightmare, including criticizing Israel while it was under attack from missiles….. FROM IRAN. No mincing of words here.

Trump then segues into the TRAVEL BAN.

It will be lifted off, even after Trump won in SCOTUS. Then Trump talks about legal refugee admission caps going up – first 700% – then later 2000% (incredible!) – but then Trump makes a FASCINATING point.

“I don’t know what they’re doing [Democrats]. They don’t need them for voting. People say they need them for voting, but they don’t need them – they cheat so much for the voting, you don’t have to go through this process, OK?”

Something to think about.

Trump goes into a great comparison about how the press doesn’t report on Biden actually falling on the steps up to the plane, versus how they reported on him walking “gingerly” down the ramp at West Point.

He even jokes about “maybe that was a booby trap”, but (this is me talking) we know that’s no more possible than the teaching of critical race theory at West Point.

Trump then goes into stories about all the positives of his administration on military matters, including Germany and NATO. South Korea – making them pay.

Space Force – then ending the “endless wars” – then talks about wounded vets. Then he goes into the story about the bodies coming back. Definite tear-jerker. He spends a LOT of time on this. A LOT of time. He gets to the climax about the mother jumping on the coffin while it’s being carried, and segues that into WHY – these coffins coming back from “these places where so many mistakes were made – where we shouldn’t be”, and it just finishes it, on how they’re coming home now.

“And we haven’t lost one single soldier in Afghanistan since January of last year – not one single soldier has been lost.”

Then Trump notes that Biden has NOT stopped bringing the soldiers home – even questions whether stopping it would be possible – but finishes by saying he’s honored that they’re continuing to bring the soldiers home.

And then Trump gets into a very interesting section about bringing the soldiers home – “and we have other things to possibly get ready for” and then “we have to be respected as a military power” referring to “other bigger countries”, and then “they will take advantage of us, and you know what I mean by that”.

It all sounds very interesting, but just a HINT of what might be going on.

He then gets into a long section about what the Democrats are trying to take away from us. BIG APPLAUSE for RKBA (the right to keep and bear arms).

Next, he gets into Democrat indoctrination, and gets MASSIVE applause about BANNING critical race theory in schools.

BAN IT IN SCHOOLS.
BAN IT IN WORKPLACES.
BAN IT IN OUR STATES.
BAN IT IN THE FEDERAL GOVERNMENT.
AND IT SHOULD BE DONE IMMEDIATELY.

Then Trump notes that Democrats are trying to pass legislation to spend billions of dollars giving phony academic credits to students for going to protests. (Note – this is STRAIGHT OUT OF CHINA).

Then, Trump makes a HUGE link here, to SCHOOL CHOICE.

“If government-run schools are going to indoctrinate children with radical ideas, then Republicans must immediately pass legislation (basically school choice to get out of government schools)”.

“TO OPT OUT OF THE INSANITY”

Trump then gets into a really good and long section about the perversion of justice, and the weaponization of the law, using in part the fishing expeditions against him, including particularly within that, the handing of the attack to the radicals in New York.

“Prosecutorial misconduct.”

Then, a load of “where’s Durham?”

“Has anybody seen Durham?”

Talking about the Democrats:

“”All of this for nothing. It’s a shame.”

But then at the end…..

“We’ll never let it happen again.”

And then, after some more about the New York prosecutors….

“They won’t stop until November of 2024.”

This is where Trump gets into the election fraud in a HUGE way.

“The 2020 Election HOAX.”

And then he gets into the Time Magazine “confession”.

“They had to brag about what they did.”

Big cheers about people SEEING THE FRAUD.

Absolutely NO backing down.

Trump says the Arizona audit will be done in 3 or 4 weeks.

He talks about other states, and how they’re looking at it, too.

“Zuckerberg broke the law.” AMEN!!!

Followed by an interesting recounting of Zuckerberg and his wife coming for dinner at the White House.

Then Trump gets into one of the absolute best arguments he has ever made – that there is NO WAY the country is divided “50:50” on stuff like open borders, sanctuary cities, defund the police, and other issues like that.

This is brilliantly putting a disturbing thought in people’s minds. Let them “solve the problem”, because we know how it will solve.

Fake elections make all kinds of sense.

He then comes out and basically says that he does NOT believe the results of “some of these elections where Democrats have the advantage”. He argues that some of the blue states “just aren’t blue”. It’s VERY powerful.

“There is something going on, and we have to be very, very careful with our election process, because I don’t believe that we are a 50-50 nation.”

He then makes a great point about not only dead people voting, but dead people APPLYING to vote.

This is where he slides into one of his greatest lines, about how with stolen elections and open borders, we could have a dictator. But then….

“I don’t even think Biden is the dictator. If anybody knows who’s running that operation, could you let us know? Because I don’t think it’s Joe, but who the hell knows? Maybe it is.”

Back to the prosecutorial misconduct. And then:

“I’m not the one trying to undermine American democracy. I’m the one trying to save it. Please remember that.”

“We all know what happened with the election – and we can never, ever, let that happen again.”

Trump then goes into election integrity, and how important it is. He takes Biden’s attack on election reforms as “un-American”, and flips it right back on China Joe.

“Joe Biden called these common-sense reforms un-American, but the thing that is really un-American is an election scam.”

What’s interesting is that Trump puts CHINA at the top of the list of nations “happy” about the election theft. He mentions RUSSIA next, and then Iran, and he then puts them in order, with China at the top, and Iran next.

He then states that if HR1 passes, there will never be another fair election in our country.

But then, after going through a litany of needed reforms, including protection of poll watchers, Trump absolutely NAILS the “drop-boxes” and ZUCKERBERG.

“And we cannot have drop boxes paid for by Facebook and Zuckerberg – where, by the way, massive numbers – 95, 96% of the vote, is for Joe Biden – doesn’t happen.”

Trump then wraps up on election reform.

“Our movement is far from over – in fact, it is just getting started.”

He then goes into his end speech – WE WILL FIGHT FOR – family, jobs, made in America.

You need HIS WORDS.

https://www.rev.com/blog/transcripts/donald-trump-speech-transcript-at-north-carolina-gop-convention-dinner-june-5

Here in North Carolina, across the country, the Republican party will continue to fight for strong families, safe communities, and secure and sovereign borders. We will fight for more jobs, lower taxes, and pro-American trade deals that result in more North Carolina workers, forging more products, stamped with beautiful, beautiful phrases, but in particular made in the USA, Mr. Furniture Manufacturer. We will shut down outsourcing, bring back our supply chains, crack down on trade cheaters and violators, and ensure that America, not China, dominates the future of the world. We will protect innocent life. We will defend our glorious Constitution and we will uphold the Judaeo-Christian values and principles of our nation’s founding.

Donald Trump: (02:28)
We will break up the big tech monopolies, reject left-wing cancel culture, restore free speech in America, and demand free, fair and honest transparent elections. We will strengthen our military, support our great police, and always take care of our amazing veterans. Do you know that we got a 92% approval rating with respect to the VA? They rated us 92% approval rating. It’s never been anywhere even near that number. Very proud of that. With the American pride that fills our souls, we will teach our children to love their country, honor our history, and always respect our great American flag.

Donald Trump: (03:23)
Tomorrow marks the 77th anniversary of one of the most epic military trials in the history of the world, the allied invasion of Normandy on D-Day. As we remember this incredible achievement, let us summon the spirit of generations of Americans before us who gave their blood, sweat, and tears for our beloved country. All of us in this room inherit the legacy of the selfless patriots who won the battles, crossed the oceans, forged the steel, made the breakthroughs, climbed the summits, these great, beautiful summits, tamed the frontiers and seized the victories that built America into the single greatest nation in the history of the world. That’s where we want to keep it. That is our magnificent American inheritance, and there is nothing like it anywhere in the world, and there never will be. Let us go forward tonight, moved by their sacrifice, motivated by their example, inspired by their resolve, committed to their values and more determined than ever to make America prouder, freer, stronger, and greater than ever before. Thank you, North Carolina. God bless you, and God bless America. Thank you very much. Thank you.

The Spike Protein’s Purpose Betrayed By Its Own Superiority

TL;DR – you MUST listen to a short podcast of a scientist revealing the latest research on the spike protein vaccines. The VACCINE ITSELF (not just the spike protein – the mRNA vaccine itself) is persistent and is not only concentrating in ovaries – THE VACCINE ITSELF IS EXCRETED – e.g., in breast milk. Meaning – “shedding” of *VACCINE ITSELF* is real. And then it gets worse. That COVID researcher, Bing Liu, who was murdered? He was a member of one of the first groups to discover the “snake protein” analogy – LONG BEFORE THE VACCINES WERE RELEASED.


The Snake Protein – whoops – I mean Spike Protein – it’s all blowing up now.

The information is coming so fast I can barely get it into here before some NEW thing blows up.

Let’s start here.

BIG THANKS to DP for putting me on this trail.

That link is to an interview HERE:

https://omny.fm/shows/on-point-with-alex-pierson/new-peer-reviewed-study-on-covid-19-vaccines-sugge

This is really worth listening to. The doctor WARNS that what he’s going to say is a bit scary.

This is 9 minutes and 11 seconds you NEED TO HEAR.

This leads to his point about concentration in the ovaries.

Follow the above tweet to THIS tweet:

Which retweets THIS tweet:

And you can look at the animal data.

Observe how it persists for a long time. Look how it concentrates in the ovaries over that long period of time. Those numbers are SHOCKER and HUGE and stand out like a SORE THUMB.

THEY KNEW.

This same tweet is just a gold mine in the replies. Let’s start off with the SNAKE protein. You remember my last post about that?


Spike Protein = Spike Protein ≈ Snake Protein

Using Principles of Protein Equivalence and Analogy as Predictive Tools for Coronavirus Understanding Surely you’ve heard of the BROWN RECLUSE SPIDER. The brown recluse is related to several other recluses, and a couple of other families of spiders, that all have a similar venom – a protein called sphingomyelinase D. This is an enzyme that …


OMG, I was so much righter than I thought. Look at this REPLY to the tweet above.

Let’s just blow up those images.

First, some snake protein motifs in the spike protein (direct evidence). There is also correlation to rabies neurotoxin.

This comes from a French lab and was received in April of 2020.

Reçu le : 2020-04-16
Accepté le : 2020-04-18
Publié le : 2020-06-05
DOI : https://doi.org/10.5802/crbiol.8

ARCHIVE: https://archive.is/THeQ7

The second, referenced tweet, brings in Bing Liu, the murdered researcher.

Who was actually one of TWO murdered COVID-19 researchers:

LINK: https://www.strategic-culture.org/news/2020/05/17/new-pandemic-two-trailblazing-covid-19-researchers-dead-in-month/

ARCHIVE: https://archive.is/CgoeH

So what was this Bing guy’s lab working on?

Here is a sample:

This means they discovered the SNAKE PROTEIN ANALOGY. Before May 2020 was out. Bing was killed on May 2, 2020.

That comes from THIS paper, sent for review on May 26, 2020.

https://www.pnas.org/content/117/41/25254

Here is an archive of the paper, just in case:

https://archive.is/VdjE9

The author of the tweet, “alberto silva”, archived a tweet showing that he figured this out in November of 2020, before the vaccines were released.

ARCHIVE: https://archive.is/OfcuG


OK? Look – I’m sorry – this is such extreme bullshit, that I am finally starting to understand WHY “people” are pulling out all the stops here.

They have a PLAN.

They have an AGENDA.

I suspect that Bing Liu was mouthing off about the protein analogy in ways that threatened the WHOLE SPIKE PROTEIN VACCINES – or more likely the REAL PURPOSES of the vaccines.

Sure, there was money involved, but I think there was also a lot of AGENDA.

I mean – let’s just say that I know a certain researcher who didn’t die in a lab accident that used MK to pull it off, which lab accident was very convenient to both money and agenda, and would have been even more convenient had both injured parties DIED.

And now we’ve got what looks like TWO MK murders – one of a COVID researcher who spotted the problems with the full spike protein vaccines – the second an Army doctor connected to the origins of the pandemic in Wuhan. In these cases, MK was likely used on third-party violence-prone individuals.

This is WAY bigger than Fauci. And THAT is likely why the Democrat media is setting Fauci on fire.

It’s a FIREBREAK. It’s a CUOMO KISSING SCANDAL DIVERSION.

It’s WAY, WAY, WAY bigger than Fauci.

DO NOT SETTLE FOR FAUCI.

THIS BRINGS DOWN THE WHOLE CABAL.

I am not kidding.

W

PS – From this information, one can see how luciferase actually matters – it’s used to report on WHERE THE VACCINE GOES in the crucial hidden data on the vaccines. This is potentially another reason why “luciferase disinformation” was distributed to vaccine opponents, through a variety of means, including early information about the Moderna vaccine itself, which was not true, but served as attractive chaff to keep opponents from discovering the REAL problems with and purposes of the vaccines. There are multiple reasons why this was done, but one of them is obvious now – obscuring THIS critical work. In any case, it may be possible to use the distribution of disinformation to vaccine opponents as a way to figure out who in the industry KNEW what was being covered up.


References

Deplorable Patriot’s tip that put me onto this stuff:

LINK: https://www.theqtree.com/2021/05/30/dear-kmag-20210530-open-topic/#comment-746375

Tweet on spike protein problem study:

LINK: https://twitter.com/pc_432/status/1399087077392674817

Alex Pierson interview with immunologist about spike protein:

https://omny.fm/shows/on-point-with-alex-pierson/new-peer-reviewed-study-on-covid-19-vaccines-sugge

Tweet on ovarian concentration:

LINK: https://twitter.com/pc_432/status/1399087079393415168

Tweet with ovarian concentration data:

LINK: https://twitter.com/cov19treatments/status/1398971745483251716

Tweet on spike protein / snake protein correlation:

LINK: https://twitter.com/amicocolorido/status/1399105106562457600

Earlier Tweet on spike protein / snake protein correlation (Nov. 3, 2020):

LINK: https://twitter.com/amicocolorido/status/1323671478395699200

Thread reader archive of spike protein / snake protein tweet:

https://threadreaderapp.com/thread/1323671478395699200.html

Article on murdered COVID researchers:

https://www.strategic-culture.org/news/2020/05/17/new-pandemic-two-trailblazing-covid-19-researchers-dead-in-month/

Archive of article on murdered COVID researchers:

https://archive.is/CgoeH

Snake protein correlation first identified in this paper:

https://comptes-rendus.academie-sciences.fr/biologies/item/CRBIOL_2020__343_1_33_0/

Archive of snake protein paper 1:

https://archive.is/THeQ7

Snake protein correlation also first identified in this paper:

https://www.pnas.org/content/117/41/25254

Archive of snake protein paper 2:

https://archive.is/VdjE9

Archive of tweet showing understanding of problem and murder by November 2020:

https://archive.is/OfcuG

The Wuhan Murders

Something is going on, and it ain’t pretty.

George Webb seems to believe that the AMERICAN MILITARY was behind COVID-19.

I tend to think that CHINA and its AMERICAN ALLIES (DS, DNC, CIA) were behind it.

But I will bet we both agree on one thing.

WHOEVER KILLED THE MARRIED ARMY DOCTORS HAS SKIN IN THAT GAME.


MORE: https://heavy.com/news/brenda-edward-mcdaniel-jr/


Let me back up a bit, so that this comes into focus.

Aubergine was the one who alerted me to this case HERE.



Now, if you go to that Western Journal article, HERE, you are given, without elaboration, THIS TWEET.

This account on Twitter is way overdue for being suspended to hide their stuff – let’s just save an image of that tweet.

While we’re at it, let’s archive that Western Journal article that got us to that tweet.

ARCHIVE: https://archive.fo/fYVYN

NOW – what is that tweet linked to? An article in People magazine!


Va. Couple Shot on Front Lawn in ‘Brutal’ Double Murder, Police Say: ‘They Did Nothing Wrong’

Police identified the victims as Edward McDaniel Jr., 55, and Brenda McDaniel, 63, of Springfield, Virginia, both of whom had military backgrounds

By Benjamin VanHoose

May 27, 2021 10:33 AM


Nothing about the Wuhan connection. THAT is what we are looking for. This alleged connection could be pure bullshit, but yet something stinks.

That article doesn’t really do anything other than to reinforce the connection between the murders and the attempted burglary at the same residence earlier in the week on the MONDAY – and that the police were certain these were connected. For all that’s worth, it’s sketchy as hell. Burglary?

The People Magazine article is linked to THIS local WTOP news report, which included this critical information about the “cover murder motive”:

Police said they believe the shooting Wednesday on the 8000 block of Flint Street near Redman Street was a “follow-up and related to the interactions Monday,” when police responded to a call for service and conducted an active burglary investigation.

Police Chief Kevin Davis said they know that at least one of the two men was at the home on Monday.

Davis said the motive is currently believed to be a dispute, and police are working to figure out what it was about.

Maj. Ed O’Carroll, bureau chief of Major Crimes Cyber and Forensics for Fairfax County police, said the investigation is ongoing.

“As of this moment, we have not located the firearm, but we have a lot of work to do. I mentioned the vehicle that’s now in our possession. We got a lot of things to follow up on. We want that firearm … This case does not close with these two arrests and these multiple charges. In some aspects, it’s just beginning,” O’Carroll said.

He’s asking anyone with information on what happened to call police at 703-246-7800

The McDaniels were both military doctors and colonels, and Edward McDaniel was still active with the Army.

https://wtop.com/fairfax-county/2021/05/fairfax-co-police-1-in-custody-in-fatal-double-shooting-2nd-suspect-sought/

OK – so we know that one of the killers was at the residence on Monday in connection to the “burglary”.

Now, here is MORE information about the “motive” via Axelrod-Alinsky media, NBC Washington (something like the commie media equivalent of the Washington Field Office). Note that the narrative motive actually gets recorded (very important to establish “facts”) – this is from other local coverage:

Officers were called to the home Monday about an altercation and potential burglary in progress, Davis said.

On a dispatch call to responding officers, a dispatcher can be heard saying the caller and her husband were upstairs with a shotgun in their home. “The subject” was in the basement.

“Caller is advising the subject is after her son and that he is with them upstairs,” the dispatcher said.

Two days later, the parents, not the son, were killed.

The deaths mark the ninth and 10th homicides in Fairfax County this year so far, in an increase from the count last year at this time.

A $10,000 reward for information is being offered in this case.

Stay with NBC Washington for more details on this developing story.

https://www.nbcwashington.com/news/local/northern-virginia/husband-wife-killed-outside-springfield-home-search-for-car-underway/2683774/

In my opinion, the parents were ALWAYS the MK target of the pliable “Seth Rich MS-13 type” “dull as a sawed nail” shooters. You Know Who is already off the charts on this one.

You will note at this point that everybody is pushing the “dispute” angle. More references (not cited here) included at the end of this post.

Running out of leads, I did some searches on the name of the deceased, the name of his hospital, and “Wuhan Games”. THAT got interesting. I found nothing direct, but I did find TWO very interesting leads, BOTH of which pointed to research by George Webb.

First, an article in Veterans Today, a very shady “John Kerry” type operation which is routinely sided with Russia and China, hiding behind the Vet Card.

This is basically supporting the Chinese counter-narrative to the earlier Wuhan Games theory that CCP spread the disease via the Wuhan games. The Chinese counter-theory, that the US started the virus at the Wuhan Games, launches off George Webb disinformation that COVID came from here. Well, yeah, it did, but that’s a little more complicated than China’s “malign blame-shifting conspiracy theory”.

LINK: https://www.veteranstoday.com/2020/03/26/us-athlete-intelligence-officer-in-china-games-named-as-patient-zero-for-covid-debunking-trump-rhetoric-updating/

George Webb is cited several times, including multiple tweets, but now that his old account on Twitter was REMOVED and then taken over by an anti-Webb Democrat troll, there is no official record to be found. However, the TEXT of the tweets remains in this article, and it’s useful to look at them. E.g.:


Patient Zero from Wuhan, Maatje Benassi, is a Dutch American woman cyclist. Her husband is also a cyclist in the US Atmed Forces (SPAWAR) and believe you be in Wahan in October of 2019. Benny Benassi is Patrient Zero in Holland, and has already made a rap video about Coronavirus pic.twitter.com/u1Z5VuYCaG— TruthLeaks – Investigative Journalist George Webb (@GeorgWebb) March 22, 2020


Webb’s basic theory is that the virus was spread from Fort Detrick to China via a US military cyclist in the games, who has State Department (i.e., CIA) connections. This is where it all gets really messy, not the least of which reasons being that I suspect that at this point, Webb was being fed disinformation.

That woman cyclist is Dutch and an Italian citizen, yet is somehow in the US Army as an intelligence operative. WTF. She comes back from Wuhan and gives COVID to her relative in the Netherlands. That Webb tweet link still works, although the Instagram link to proof that her relative got the disease does not.

LINK: https://dancingastronaut.com/2020/03/benny-benassi-stuck-in-italy-due-to-nationwide-quarantine-cancels-upcoming-north-american-tour/

Because this woman was a cyclist, the cycling world took note of this theory, particularly once CHINA started using it to enlarge THEIR theory that the US spread the disease at the Wuhan games.

Here is the link to some excellent coverage of that whole angle by a cycling site:

LINK: https://road.cc/content/news/us-cyclist-patient-zero-wuhan-covid-19-outbreak-272251

Now, at this point, I tried to go BACK to the original tweet and see if I could find some kind of link to Wuhan through Twitter. THAT paid off.

Here was that original tweet:

He has a BUNCH of tweets after that which link things back to George Webb. I will just dump them here.

So Max Wells appears to have made that connection. Here are his tweets:

Let me stop here quickly and save all this stuff for when Twitter takes it down.

Bear in mind that requests for sources from these guys in the replies are not getting answers. Yeah, I get that, too, but just sayin’.

Now – go back to the timeline of “Grinch the Uncancelable” and some awesome stuff from Webb pops up.

This might be worth saving:

And yeah, I’ve talked about the Army’s ferritin-based vaccine, which should avoid some of the problems of the full spike protein, by only using PART of the spike protein attached to ferritin – in many ways like the Novavax technology. Yet I am really thinking this Magnet Challenge stuff is a high-quality disinformation meme.

But might the Army have decided to protect its people being sent to Wuhan, if they had intel that the ChiComs were going to infect their people? Sure might be smart to vaccinate them.

https://twitter.com/JSO_Kula/status/1398364893758230535

Tons of good stuff.

At this point, I think we are in a vortex of both information and disinformation. But something interesting is going on.

I encourage everybody to research this topic, bearing in mind that there is much trickery abounding.

W

PS – pay special attention to their new hobby.


References

Aubergine’s comment:

Aubergine’s original reference:

Archive of original reference:

https://archive.fo/fYVYN

People Magazine coverage:

https://people.com/crime/husband-wife-killed-cold-blood-front-yard-double-murder-virginia/

Paywalled WaPo article:

https://www.washingtonpost.com/local/public-safety/springfiled-va-multiple-shooting/2021/05/26/c6abf3d4-be2d-11eb-83e3-0ca705a96ba4_story.html

HEAVY Dot Com coverage:

https://heavy.com/news/brenda-edward-mcdaniel-jr/

WTOP local coverage:

LINK: https://wtop.com/fairfax-county/2021/05/fairfax-co-police-1-in-custody-in-fatal-double-shooting-2nd-suspect-sought/

FOX News coverage (fluffy and null):

https://www.foxnews.com/us/virginia-police-arrest-suspects-shooting-veterans-dead

Fairfax County Police Department Blog:

International Business Times:

https://www.ibtimes.com/husband-wife-military-doctors-fatally-shot-front-yard-suspects-charged-3210917

American Military News:

Manhunt: Army husband, vet wife both shot, murdered outside VA home – manhunt underway

Fox 5 DC local coverage:

https://www.fox5dc.com/news/springfield-shooting-leaves-husband-and-wife-dead-in-what-police-call-vicious-attack

Veterans Today coverage of George Webb theory:

https://www.veteranstoday.com/2020/03/26/us-athlete-intelligence-officer-in-china-games-named-as-patient-zero-for-covid-debunking-trump-rhetoric-updating/

Benny Benassi coverage:

Cycling site coverage of George Webb theory:

https://road.cc/content/news/us-cyclist-patient-zero-wuhan-covid-19-outbreak-272251

Nanoferritin vaccine:

https://www.news-medical.net/news/20210330/Researchers-develop-broadly-neutralizing-SARS-CoV-2-ferritin-nanoparticle-vaccine.aspx

Dear New York Times – You Tipped Your Hand, And Now It's Time To Talk About Violent Extremists

(Original Title: “Who Are The New Bernie-Killers?”)

In Which Timing, and Timelines, are Everything

SEE: https://www.huffpost.com/entry/hillary-clinton-supports-death-penalty-for-dylann-roof_n_57507737e4b0c3752dccde7c

AND IF I WAS Y’ALL, I WOULDN’T TRY IT AGAIN!

FROM: https://armandsrancho.blogspot.com/2016/02/new-hampshire-primary-drudge-report.html

As a “dangerous conspiracy theorist”, it is now my duty to do my job, and post a rather startling conspiracy theory. However, there needs to be a bit of context here.

This post – “done” and ready to go – sat in the can on my heavily FISA-monitored WordPress account for almost a week, allowing time for people of various kinds to see it and react to it. I chose NOT to publish it immediately. In fact, I am now CHANGING THE INTRO substantially to make allowances for the effects of having let people – both GOOD and BAD – see it.

I’m not changing the important parts – just this introduction. You will see why shortly.

Sometimes, you just have to let the other side make a move as a form of confirmation.

Originally, this post was framed from the viewpoint of “HOW ARE THEY GOING TO TAKE OUT BERNIE THIS TIME?” But NOW it seems like the forces of darkness and injustice are actually back to the same old problem they had before, and which became extremely clear to me as I researched the political context timeline of Dylann Roof…..

“HOW ARE THEY GOING TO TAKE OUT *BOTH* TRUMP AND BERNIE THIS TIME?”

How do I know that I got their goat?

Look what dropped today. It ain’t all me, but trust me – I helped. “BASELESS.”

Yeah, right. SUCKAS!

Oh, REALLY. But wait – there’s MOAR.


There’s no “potential for violence”. Stop LYING, New York Times. YOU are on the side of murderers who have ABUSED the entire mechanism of government, and you will pay dearly for it, but NOT by the hands of your victims.

You will pay THIS WAY.

3849
Justice
Q
!!Hs1Jq13jV6
9 Feb 2020 – 4:33:49 PM

Justice.
Q

Lisa blasted back at them.

https://twitter.com/LisaMei62/status/1226655909084049408

Funny that I am unable to access her tweet on Twitter, but the WordPress Twitter plugin API can do it. New York Times? No problem. But not Lisa.

It’s called censorship, folks. They feed us their communist Russia! Russia! Russia! hoax bullshit for 3 years, and then they DARE to call US the “conspiracy theorists”, as justification to SQUELCH OUR VOICES.

PREPARE FOR JUSTICE, NEW YORK TIMES. We do not need your fake news. You’re GOING DOWN.

And PEACEFULLY, you PRECIOUS PRICKS.

So let’s begin. Let’s look at what they’re SO AFRAID OF.


Part 1. The Background. Targeted Killings Hidden Under Psychological Trauma Events. THE PAST.

In 2015 and 2016, I saw many dirty tricks deployed against Bernie Sanders by the Hillary Machine, both in the news and in my community (broadly speaking). There is a “deep blue Hillary zone” nearby, which I was able to observed closely, and I was quite shocked how efficiently they put out the “Bernie burns” that would flare up. Posters ripped down. Chalking washed away. Hillary’s city employees were ALL OVER IT.

However, there was ONE slick move against Bernie that VERY few people saw. And even the people who saw it, were overwhelmed and instantly defeated by the unique and powerful psychology of “traumatic death unquestionability” – something which makes psychological trauma events so delicious to the highly conspiratorial, as dependably safe ways to murder problematic people like witnesses.

I have NEVER believed that the Dylann Roof murders – the Charleston church shooting – was anything less than an act of Bolshevik murder and blood hoaxing, using controlled and guided opposition. But it goes WAY, WAY beyond mere cui bono.

The reason is that I always had the murder in the correct context – deep suspicion – due to my intense interest in the 2016 Presidential Election, and all things affecting the 2015-2016 Presidential PRIMARY PROCESS.

Sundance, over at CTH, identified the Deep State / GOPe plan to – AT BEST – elect Jeb Bush, and – AT LEAST – remove Donald Trump. This “Roadmap” proved extremely useful in predicting most of the sneaky and downright malevolent moves made *by Republicans* against CANDIDATE Donald J. Trump.

There was, however, a similar but smaller-casted bit of kabuki theater going on in the Democrat party. I watched it with great interest, as all the intellectual Bernie lovers I knew from my old career days were thrown to the wolves by the DNC. Less politically astute – many of them being “self-unaware socialists”, they had no idea how badly Bernie was getting screwed. But in the same way that I could see TRUMP getting screwed, I could also see BERNIE getting screwed.

In the Democrat “roadmap”, “excused white guy” Bernie Sanders was to be USED as the “old white guy” to keep Hillary-phobic voters from fleeing the plantation for the left end of Trumpsville. This is not a bad ploy, actually. In fact, it’s pretty ingenious. The PRICE for whites and/or males to stay utterly unaccusable within the PC-DNC, was to move just a smidgen to the left, while still keeping all their guns and their now-unassailable white skin and/or testicles.

However, Bernie was NOT supposed to win. He was supposed to tag along in the slow lane, keep Democrats voting Democrat – to lose graciously – and to send his support afterwards to HILLARY CLINTON.

The problem? Hillary Clinton was such an incredibly and intrinsically terrible candidate, that Sanders actually polled very well against her. Too well. And worse still, Bernie was designed to work well for Hillary against wishy-washy, low-energy Jeb Bush – not stake-in-the-ground, high-energy Donald Trump. A “fake center” could not be created with Bernie Sanders, who Trump even referred to as a “communist” very early in the process.

Bernie Sanders became more of a liability than an asset to Hillary Clinton. SEE SETH RICH.

Candidate Sanders was probably “shields down” to Hillary Clinton’s spying, even in 2014, thanks to her strong Deep State support, but when Bernie announced his candidacy publicly on April 30, 2015, the fight was ON. The reactions to this choice were NOT what Hillary Clinton hoped to hear.

Bernie started raking in SUPPORT and MONEY. All of the BADNESS of Hillary Clinton – the YEARS of KARMA that had built up, were sending support to the most credible alternative – BERNIE.

In the immediate aftermath of the Charleston shooting, which happened 48 days later on June 17, 2015, I was able to find online evidence – multiple sources – that black political leaders in South Carolina, including Rev. Clementa Pinckney, the most important victim of the shooting, were still holding “pro-Obama, anti-Hillary” views, and were WELCOMING THE CHOICE of Bernie Sanders. One of the quotes I read was almost taunting Hillary and the DNC with the possibility of Bernie support. These black religious leaders – who have POWERFUL influence over the votes of “the black bloc” in South Carolina – were asserting leverage on Hillary’s campaign. They were part of the FORGOTTEN AMERICANS that President Trump loves to talk about – using the ONLY leverage they thought they had – their VOTES IN THE PRIMARY.

By the way, I dare anybody to find these articles now. I’ve tried many times. As far as I can tell, it all went down a classified memory hole. I should have taken screenshots. But I wasn’t yet schooled on the utter mendacity of not just FAKE NEWS but BAD COPS in June of 2015.

This was internal Democrat politics, which can be EXTREMELY ugly.

Remember when the communist wing of the DNC, aligned behind Tom Perez as candidate for DNC chair, and against Islamist-wing candidate Keith Ellison, actually used several black and brown radicals to topple Jewish gravestones, and a young hacker in Israel to phone in hoax bomb scares to Jewish community centers?

Oh, we remember.


Tips on Stopping Hoax Calls

Did you notice that they let people with Q shirts and gear into the same Trump rally where there was a REALLY WEIRD Q post just a couple of hours earlier?  I think there may be a connection.  I know this is a much different (and less catastrophic) interpretation than a lot of them – …

https://wqth.wordpress.com/2018/10/06/tips-on-stopping-hoax-calls/

Remember – these little media-saturating hoaxes were just minor, post-election ugliness. Nobody died. 2020 was a LONG ways off, and control of the DNC was not absolutely essential to save the possibility of Hillary 2020.

In contrast, when Bernie announced in late April 2015, there was a significant chance that he could overtake Hillary’s campaign as the “Obama inheritor”. The FUNDRAISING by Bernie was beginning.

It helps to look at a TIMELINE of Bernie’s campaign – HERE:

https://www.timetoast.com/timelines/bernie-sanders-campaign

The big gap on the left is the time between when Bernie announced (04/30/2015) and the FIRST Democratic Debate (10/13/2015).

What happened in between these times? Well, during the time prior to 06/17/2015 – the date of the Charleston shooting, Bernie Sanders was already threatening to become the “Obama successor” over Hillary Clinton. More on that below.

And – oh – funny coincidence – ONE DAY BEFORE THE SHOOTING – on 06/16/2015 – guess who announced HIS bid for the Presidency?

https://youtu.be/Ab9AnZaLL1U

Yes. It was NO ACCIDENT – IMO – that the ANNOUNCEMENT of the Trump candidacy was LOST in the WIND of Charleston. By design. You will see more proof shortly.

My read of this is that the Dylann Roof shooting – possibly coordinated with anti-Trump CIA embeds in the FBI and “elsewhere” – was designed to deal with BOTH the Sanders problem and the Trump problem.

If you are having trouble with this concept – that politically useful “wing-nuts” under FBI surveillance might be not just USED but GROOMED for political gain rather than simply stopped, please read my own experience with the way that the Comey FBI seemed to try to groom hopeful shooters and other “left-politically useful” bots, and to some extent still does.


Red Flag Poster Boy – Another Fine Product of the Murderous Comey FBI

LINK: https://wqth.wordpress.com/2019/09/06/red-flag-poster-boy-another-fine-product-of-the-murderous-comey-fbi/


Based on the TIMING, Dylann Roof’s murderous act was far more than needed to take out Sanders, but it was potentially “not enough” to deal with Trump – hence the close timing to Trump’s announcement of candidacy. And, on February 19, 2016, that thinking was indeed proven correct. Roof was enough to take out Sanders – but not enough to stop Trump.

Notice that Trump’s very astute failure to eliminate “Little Marco” Rubio early on, gave him the edge in South Carolina, by keeping Rubio votes from going to Cruz. Rubio polled very well in Pinckney’s district – see full details here:

LINK: https://www.nytimes.com/elections/2016/results/primaries/south-carolina

That support would have gone to CRUZ, had Rubio been no longer viable.

Notice how STRONGLY Hillary defeated Bernie in South Carolina. Bernie actually did somewhat BETTER in Pinckney’s district (State Senator, 45th district, Charleston), probably because of lingering distrust of Hillary Clinton.

Now – stop for a second and re-read what I just wrote.

STATE SENATOR. Where did THAT come from? I thought this was just the killing of 9 worshipers. Sure, one was a Reverend if you read through to the end of the article – but – wow – a State Senator, too?

Clementa C. Pinckney, South Carolina State Senator, 45th District, 2001-2015. Prior to that, for 4 years, he was a State Representative.

Notice that the Fake News media AVOIDED characterizing this as being, in any way, potentially POLITICAL, or even directed toward a politician, or even directed toward a political leader. If you watched the fake news positioning of the man and the incident, Pinckney was a churchgoer victim first, a reverend second, a political activist third, a politician fourth, an elected official fifth, a former state representative sixth, and a CURRENT STATE SENATOR last.

This is how LOOK SQUIRREL works. Very subtly.

In fact, I found it remarkable that the media tried to concentrate on all victims EXCEPT Pinckney. The Fake News sure seemed to want to talk about the oldest lady, or the bravest woman victim, or the two who hugged each other, but they seemed LOATH to talk about the Reverend, or to single him out in any way.

FAKE NEWS. They truly are the enemy of the People. Even when they’re being “nice” and sympathetic.

So WHY did the media frame this as a CHURCH SHOOTING, when in reality, the most important person to die there was not just a Reverend, but a STATE SENATOR?

When the whole affair REEKS of POLITICAL ASSASSINATION – NOT MERELY HATE?

Let’s look at that in detail.


If you don’t understand how the Dylann Roof shooting worked, to secure Hillary Clinton the Democratic 2016 Presidential nomination, I will spell it out completely.

The MOTIVE is clear. If Clementa Pinckney wasn’t solidly behind Hillary, she was WOBBLY. If he was behind Bernie, she was GONE. Fundraising was already beginning – more on that later. A BERNIE win in South Carolina – right around the time that people regard Iowa and New Hampshire FLUKES as being washed out – would DEVASTATE Hillary’s chances to get back into the White House.

South Carolina was a classic bottleneck. Hillary had to go through it, and Clementa Pinckney was the GATEKEEPER. He was the QUEENMAKER.

Or the KINGMAKER.

Pinkney KNEW he had good cards. But he had no idea how much of a CHEATER he was playing against, in Hillary “Ma Cankles” Clinton. And it was worse than that. Hillary had forces behind her which had killed PRESIDENTS. He didn’t stand a chance. NONE. Wiped off the map as a HERO. The easiest way to remove him.

Stalinism – Maoism – they don’t take prisoners when DEATH serves their interests better.

So what about MEANS and OPPORTUNITY?

Yeah. Now THAT part is interesting.


Mass shootings are PSYCHOLOGICAL TRAUMA. They are designed to HIT YOU – and hit you HARD. What you THINK later is not as important as what your GUT tells you right away. Your GUT REACTION will echo in your head for the rest of your life. Your logical thoughts may actually change. Your gut response won’t. And it will be STUCK to any later mention of the event.

The immediate message of Dylann Roof to normal people – even those who logically understand the ERROR of the thinking, is as follows:

  • Oooooh. Gotta do something about those guns.
  • Oooooh. Gotta do something about the hate.
  • Oooooh. It was a church. This is just wrong. No guns in church.
  • Oooooh. White man bad. Even the young ones. Can’t be trusted.
  • Oooooh. Poor black woman good. Black good. Woman good.

Psychological trauma events don’t care about your logic. That is why they work so well. They just override all that. And that is why the Cankles Left loves them so much.

And yet, psychological trauma events – especially TERRORISM – are SO USEFUL for targeted attacks at the same time, “because random”, and as I mentioned earlier, because they have a certain “unquestionability” which arises out of the psychological trauma itself.

People begins ADAPTING to the psychological trauma immediately. It’s like poured concrete. It just starts setting immediately. NOBODY wants to UNDO that – to PICK THE SCAB – to BREAK AND RESET BONE – just because there’s something wrong underneath. They just want to get back to normal in what looks like the easiest way possible.

Thus, the social psychological response to terrorism is usually stuck on the first and most obvious explanation. And THAT means that all other reasoning will adapt to it.

Bury an otherwise suspicious potentially targeted killing in a terrorist event, and “RANDOM” will simply be applied to it, no matter what.


For Whom The Bell Tolls

And more recently…..

See how that works? It’s so brilliant.

Back to the BERNIE KILLERS. Yeah, let’s take out that old white guy’s campaign. Dig the psychology.

Bernie Sanders and Donald Trump were both OLD WHITE GUYS who support – more or less – the Second Amendment. Bernie’s support for RKBA is really QUITE abysmal, now typically getting a “D-” from the NRA. In fact, I think he may even be “going for broke” by matching the confiscation talk of his opponents. HOWEVER, among “Bernie bros”, the fact that Bernie will make clumsy, waffling defenses of the Second Amendment, is actually enough to make a difference to those on the left who own guns. Bernie is within THEIR Overton window on guns. And sure enough, Hillary repeatedly used Bernie’s limited defense of the Second Amendment to attack him.

But Bernie wasn’t the ONLY person who Hillary was attacking, early in the primary season, immediately AFTER the Dylann Roof Operation:

You need TWO URLs here – one for the original article, and one in case “they” do some cleanup here, similar to what “they” did with Clementa Pinckney’s critical comments about Hillary.

ARTICLE: https://reason.com/2015/06/19/hillary-clinton-blames-charleston-shooti/

ARCHIVE: https://archive.fo/DDmUe

You need to read the article, but THIS MUCH is key. AND I QUOTE:

Behold, Hillary Clinton somehow blaming Dylann Roof killing nine people on the stupid crap that comes out of Donald Trump’s mouth. Via Politico:

“We have to have a candid national conversation about race and about discrimination, prejudice, hatred,” Clinton said in an interview with KNPB’s Jon Ralston. “But unfortunately the public discourse is sometimes hotter and more negative than it should be, which can, in my opinion, trigger people who are less than stable.”

“For example,” the former secretary of state added, “a recent entry into the Republican presidential campaign said some very inflammatory things about Mexicans. Everybody should stand up and say that’s not acceptable. You don’t talk like that on talk radio. You don’t talk like that on the kind of political campaigns.”

There is much more in this amazingly short article, including TWO LINKS (one and two) to Hillary Clinton’s support for a constitutional amendment to prohibit crowd-funding of political media (meaning the results of Citizens United, such as the Tea Party). Yeah, let that sink in. She wants a “First-Killer” amendment.

But let’s get back to the timeline. There is some REALLY interesting stuff here.

“FR” = attending fund-raisers (from THIS LINK)

There is so much here, it’s easy to get overwhelmed.

For starters, you may not have internalized ANYTHING after your JAW DROPPED while reading that Hillary was in Charleston the SAME DAY that the church was hit and the Bernie holdout was assassinated. But yes, she was.

WHAT ARE THE ODDS?

If you click on this speech – which is not easy to find – it obviously has NOTHING to do with any issues which Hillary is going to be able to fire up her voters with. This is BORING. There is no way that she is going to fire up her base over jobs.

Another link, just in case you don’t believe me. Also dated 06/17/2015.

SECOND VIDEO: https://www.yahoo.com/news/video/hillary-clinton-stopped-charleston-special-233732996.html

And now check out THIS coverage, confirming why she was REALLY there.

LINK: https://www.politico.com/story/2015/06/hillary-clinton-south-carolina-bernie-sanders-119117

Notice that Hillary was on the NORTH side of Charleston in the AFTERNOON, with the article posted at 2:46 PM EDT, and updated at 4:47 PM EDT.

Dylann Roof’s murders were THAT NIGHT – at 9:05 to 9:11 PM EDT. He had last modified his manifesto website at 4:44 PM EDT, presumably before leaving for Charleston, saying “at the time of writing I am in a great hurry.”

Roof apparently left Columbia at 6:13 PM EDT, per the lead FBI investigator, and arrived in Charleston around 7:45 PM. He walked into the Church around 8:16 PM, and walked out at 9:06 PM (some disagreement with numbers above are noted).

Dylann Roof Timeline: https://www.cbsnews.com/news/dylann-roof-charleston-church-shooting-prosecutors-give-timeline-actions/

It is very interesting to read the Wikipedia entry for the shooting, and these words about James Comey from that entry:

Roof had a prior police record consisting of two arrests, for trespassing and drug possession, both made in the months before the attack.[56][57] According to then FBI Director James Comey, a police report detailing Roof’s admission to a narcotics offense should have prevented him from purchasing the weapon used in the shooting. An administrative error within the National Instant Criminal Background Check System (NICBCS) excluded Roof’s admission (though not the arrest itself) from appearing on his mandatory background check.[58][59]

https://en.wikipedia.org/wiki/Charleston_church_shooting

I simply have to wonder if Hillary had a bad meeting with Pinckney, or if Pinckney had actually stood up a meeting with Hillary. North Charleston was part of his political stomping ground, by the way.

The church’s senior pastor, the Rev. Clementa C. Pinckney, had held rallies after the shooting of Walter Scott by a white police officer two months earlier, in nearby North Charleston. As a state senator, Pinckney pushed for legislation requiring police to wear body cameras.[22]

Several commentators noted a similarity between the massacre at Emanuel AME and the 1963 16th Street Baptist Church bombing of a politically active African-American church in Birmingham, Alabama, where the Ku Klux Klan (KKK) killed four black girls and injured fourteen others, during the civil rights movement. This attack created support for federal civil rights legislation.[21][23]

https://en.wikipedia.org/wiki/Charleston_church_shooting

But enough about this strange coincidence, at which point Hillary no longer had to give boring speeches about jobs for young millennials and black people – speeches that she knew damn well nobody would believe anyway.

The next point in the timeline is the next day. Hillary Clinton has LITERALLY left the scene of the crime, and is now in Las Vegas.

Just listen to Hillary’s speech.

It’s even more uncomfortable to watch her “telepromptering” from a distance in this version.

Something bothers me about this, but it’s subtle, so I’m going to let others figure it out themselves, and we’ll compare notes.

Now we move forward to the NPR interview with Hillary Clinton, where she began linking Roof to Trump, also on the 18th, and the media which picked it up on the 19th and 20th.

Note that Hillary didn’t use Trump’s name in her remarks, but made it extremely obvious who she was talking about, and the media then supplied Trump’s name in many of the headlines the next day.

Observe.

LINK: https://www.politico.com/story/2015/06/hillary-clinton-donald-trump-racist-speak-119210

ARCHIVE: https://archive.fo/XIzUD

This is the perfect example of the “wrap-up smear” that Nancy Pelosi spoke of so fondly. Only it’s worse, because it’s very clear to me that SOMEBODY backing Hillary Clinton killed a FLOCK OF BIRDS with ONE STONE.

  • removed the problem of Clementa Pinckney and other black leaders playing hard-to-get
  • sucked all the oxygen out of the Trump “escalator ride” entrance into the race
  • began attaching a VIOLENCE MEME to the Trump campaign from DAY TWO
  • began psychologically conditioning black voters on WHITE MALES AND GUNS
  • made it impossible for Bernie to win the support of South Carolina’s black bloc
  • opened up a cultural Marxist front on “Confederate statues”
  • created the Charleston precursor event for Charlottesville psychological operation

Oh, and don’t forget how JIM COMEY helped on the little “background check” accident.

Yeah. THAT Jim Comey.

Once one realizes what was going on here – how blacks were actually treated in this scenario – while the Democrat old-guard then sucked up to the survivors with their “who cares for you, baby” lines, in a way that matches up beautifully with Malcolm X and what happened to HIM when he stood up to the Democrat party – it’s not all that hard to understand why Q, the Oathkeepers, Dinesh D’Souza, and others with deep psychological insight on the Hillary Left, tend to view them as closer to Nazis than Bolsheviks. Indeed, this makes great historical sense – particularly if one views NATIONAL SOCIALISM as simply a watered-down and more “patriotically acceptable” version of INTERNATIONAL SOCIALISM.

But now for the grand finale. A FANTASTIC link with many images of the funeral of State Senator Clementa Pinckney, where Hillary Clinton, of course, shows up on 06/26/2015.

LINK: https://still4hill.com/2015/06/26/hillary-clinton-joins-the-obamas-and-bidens-at-funeral-for-clementa-pinckney-in-charleston/

ARCHIVE: https://archive.fo/NiGDe

You have simply GOT to take a look at those pictures.

SO. Now you see why I never bought the FAKE NEWS story on Dylann Roof. NO WAY.

NEXT – let’s get back to the present.


Part 2. Bernie The Troublemaker Is Back And Making Himself Unelectable. THE PRESENT.

This is where Flep and Q clued me in to how much of a PEST Bernie is making of himself. I will copy liberally from both so that you see my point.

First, FLEP.

Flep has two great recent posts that spell it all out:

LINK 1: https://wqth.wordpress.com/2020/02/03/news-roundup-why-am-i-covering-the-democrat-primaries-the-des-moines-register-holds-back-their-final-poll-john-kerry-is-nervous-about-bernie-sleepycreepy-joe-is-beginning-to-free-fall-in-south-car/

LINK 2: https://wqth.wordpress.com/2020/02/02/news-roundup-six-new-countries-added-to-the-travel-ban-dnc-plotting-to-bring-back-superdelegates-to-stop-bernie-dnc-change-the-debate-rules-for-michael-bloomberg-democrats-have-an-economy-im/

Here is just SOME of what Flep is seeing. This is all FLEP talking.

LINK 2:


More and more evidence is coming out that shows the Establishment Democrats and MSM are petrified that Bernie Sanders will be the Democrat nominee. They will claim it is because Bernie can’t beat our President. That is not the number one motivating factor. It is the fact that the Democrat Party will belong to Bernie and his crazy disciples (AOC, Talib, Ilhan etc.) going forward.

The loss of power is what scares them the most.

From the article linked above:

Members of the Democratic National Committee (DNC) have reportedly started discussing the implementation of a plan aimed at harming Democrat presidential candidate Sen. Bernie Sanders (I-VT), a socialist, in hopes of derailing his campaign.

“In conversations on the sidelines of a DNC executive committee meeting and in telephone calls and texts in recent days, about a half-dozen members have discussed the possibility of a policy reversal to ensure that so-called superdelegates can vote on the first ballot at the party’s national convention,” Politico reported. “Such a move would increase the influence of DNC members, members of Congress and other top party officials, who now must wait until the second ballot to have their say if the convention is contested.”

Failed far-left Green Party presidential candidate Jill Stein responded to Politico’s report by writing on Twitter: “Desperate DNC members consider rule change to let superdelegates vote on 1st ballot to stop Sanders. If the DNC rigs another election against its voters, it’ll be asking for biggest #DemExit yet by those who want an actually democratic party. #DNCRigging”

Dave Wasserman, U.S. House editor of the non-partisan Cook Political Report, wrote: “Yeah, this is going to end well.”

Another move to try and stop Bernie from becoming the nominee occurred the other day when the DNC changed their rules to assure Bloomberg being on the debate stage in a state he won’t even be on the ballot in.

From the article linked above:

The Democratic National Committee is drastically revising its criteria to participate in primary debates after New Hampshire, doubling the polling threshold and eliminating the individual donor requirement, which could pave the way for former New York City Mayor Mike Bloomberg to make the stage beginning in mid-February.

Candidates will need to earn at least 10 percent in four polls released from Jan. 15 to Feb. 18, or 12 percent in two polls conducted in Nevada or South Carolina, in order to participate in the Feb. 19 debate in Las Vegas. Any candidate who earns at least one delegate to the national convention in either the Iowa caucuses or New Hampshire primary will also qualify for the Nevada debate.

The new criteria eliminate the individual-donor threshold, which was used for the first eight debates, including next week’s debate in New Hampshire. Bloomberg, the self-funding billionaire, has refused to take donations from other individuals, which has thus far precluded his participation in any of the debates since he joined the race late last year.

https://twitter.com/Breaking911/status/1223712178047541249

Larry is absolutely right! The Democrats are screwed on both ends of the sword.


But it gets better, if you’re Bernie. Again, FLEP talking.

Link 2:


I truly believe that we are in the mist of watching the Democrat Party collapse right in front of our eyes. The 2020 Democrat Primaries are exposing that fact for us. The Democrats will have two parties coming out of the 2020 election. The Establishment Democrats and the Progressive/Socialist/Communist Democrats.

The problem for the Establishment Democrats and MSM is that they represent the old guard. The Progressive Democrats represent the new guard. By having the Progressive Democrats win the nominee will guarantee TRUMPISM reigning for the next 50+ years. There is no way that either party can beat the Trump Republican Party.

Bernie Sanders guarantees not only our President getting re-elected but he will win with over 350+ electoral votes and he will win the popular vote as well. He is a pure communist. Yes 30% of Americans love him and will vote for him. 55% of Americans LOVE our President and will vote for him.

The remaining 15% is what I consider the Establishment Democrats. Many will vote for our President or will sit out the election. Our President will not only win every state that he won in 2016, he will also win Virginia, Minnesota, New Mexico and New Hampshire. I also wouldn’t be surprised if he wins Nevada, Colorado and my long shot, Oregon.

From the article linked above:

These Democrats are feeling Berned out.

Democratic donors and party insiders are warning that large swaths of their voters could stay home — or even defect to Trump — if Vermont Sen. Bernie Sanders snags the nomination.

“I’ll still put a Bernie Sanders bumper sticker on my car, but a lot of people won’t,” said Jim Kessler, executive vice president for policy at Third Way, a Democratic think tank not aligned with any candidate. “They’ll say ‘I don’t like Donald Trump, but I don’t like Sanders either. We survived four years of Trump, maybe we’ll survive another four years.’ They’ll stay home, vote third party, or vote for Trump.”

With all that being said, the Establishment Democrats and MSM realize that Bernie is going to be the nominee.

It’s a tradition for The Des Moines Register to publish the final poll of the campaign season on the Sunday before the Iowa caucuses.  Except this year, they refused to publish the results citing a “polling problem“.

The CNN/DMR cover story is that one pollster may have pronounced Buttigieg name incorrectly. The real reason…. Bernie has a big lead.

They even tried to float another balloon on Sunday. John POS Kerry sent out a tweet (which he deleted) before the Mullahs and the entire Iranian government could emphatically back his run.

From the article linked above:

Former Secretary of State John Kerry — one of Joe Biden’s highest-profile endorsers — was overheard Sunday on the phone at a Des Moines hotel explaining what he would have to do to enter the presidential race amid “the possibility of Bernie Sanders taking down the Democratic Party — down whole.”

Sitting in the lobby restaurant of the Renaissance Savery hotel, Kerry was overheard by an NBC News analyst saying “maybe I’m f—ing deluding myself here” and explaining that in order to run, he’d have to step down from the board of Bank of America and give up his ability to make paid speeches. Kerry said donors like venture capitalist Doug Hickey would have to “raise a couple of million,” adding that such donors “now have the reality of Bernie.”

The fear is wonderful to watch! Even in the one state SleepyCreepy Joe is suppose to win, things are heading in the wrong direction for him, the Establishment Democrats and MSM.

“New South Carolina Poll is a Disaster for Joe Biden”

https://twitter.com/Baba9773/status/1224112583965380609

From the article linked above:

Joe Biden may have just received the worst news of his campaign, as a new poll shows his support in his firewall state of South Carolina collapsing along with his once-dominant support among black voters, with Vermont Sen. Bernie Sanders and Tom Steyer closing the gap.

Biden’s support in South Carolina had held steady all campaign season, and the hope was that it was strong enough to allow him to survive early defeats in Iowa and New Hampshire and pull off a big win ahead of Super Tuesday when the largest single-day haul of delegates is available. If the new Post and Courier-Change Research poll is right and his lead is evaporating, then it puts much more pressure on him to win either Iowa or New Hampshire.

While the poll shows Biden still in the lead, he’s at just 25%, with Sanders at 20% and Steyer (who has carpet-bombed the state with TV ads) at 18%. Biden once led in the poll by as high as 31 points.

Especially alarming for Biden is that he’s down to 30% support among black voters, who make up two-thirds of the South Carolina electorate and are a crucial voting bloc in the later states. Last summer, Biden captured half of black voters. Steyer is now at 24% among black voters, with Sanders at 16%.

California has 416 delegates up for grab on Super Tuesday. Biden once again is in a free fall.

If you want a taste of where it went from here – to the caucuses in Iowa that were SABOTAGED by some sketchy defective app designed by HILLARY ASSETS (yes – can you believe it?), then check out Flep’s NEXT round-up!

LINK 3: https://wqth.wordpress.com/2020/02/04/news-roundup-the-democrats-are-a-disaster-sleepycreepy-joe-downplays-iowa-bernies-crazies-are-calling-out-the-dnc-there-is-no-democrat-enthusiasm-brad-parscales-press-conference-pdjt-just-br/comment-page-1/#comment-386333

https://twitter.com/SaysSimonson/status/1224547952636628992

And you MUST check out that THIRD FLEP LINK – there is so much more, and the comments are hysterical!!!

https://twitter.com/LVNancy/status/1224697417099968514

Well, that was something else. I am trusting Flep on this. Bernie is appearing to be a BIGGER problem for the DNC than he was in 2015 and 2016. But worse still (for the DNC), we are already into 2016, and there is no “Bernie-killer” in sight. This isn’t like June of 2015, when the NUKE for Bernie had already been delivered in Charleston.

Now, Q

This is the CLINCHER. This is the question to ask yourself when it’s ALL OVER.

Look at it again. REMEMBER – it started the moment that Bernie holdout Clementa Pinckney died, and Hillary flew away to Las Vegas, to speak to that Latina organization.

Trump announced, and the operation to take him down began, taking out Bernie in the same stroke.

https://twitter.com/michaelbeatty3/status/1214427316866011136

It is very simple – and Q keeps referring to it as the D-CON, because that is what it is – a CON JOB.

How the Division / Demoralization Circus Works

  • to skin type A, offer sympathy which requires acceptance of ideology and victimhood status
  • to skin type B, offer repentance which requires acceptance of ideology and victimizer status
  • secretly support real cross-type victimizers of both types, to create victims of both types
  • stoke mutual blame and recrimination, both publicly and secretly
  • ideology creates division through self-consciousness and required perception of difference

So how do we fight back? By understanding what they are doing, and not allowing it to complete.

  • “they want you divided” – spot their division memes and refuse to play along
  • “endless war” – spot the scams and refuse to get sucked in
  • “let’s you and him fight” – hit the “referee” instead of each other
  • “they are keeping you down on the farm” – don’t accept “one’s place”
  • “assertions of privilege” – refuse to accept or perform self-criticisms
  • “sweet lies with trade-offs” – just walk away
  • “societal rewards for accepting status” – refuse to accept either
  • “implicit superiorities in accusations” – accept NEITHER

The most important overall rule is simply NOT TO PLAY THEIR GAMES.

PUSH BACK.

YOU are not Dylann Roof.

And even more importantly, YOU are not one of the sick people who sent Dylann Roof to kill Reverend Clementa Pinckney, so that Hillary Clinton would be President of the United States.

But you might be somebody who will help me pick up the sword of justice, so that we can bring the “killers behind the killers” TO JUSTICE.


Part 3. Stopping The Race-Igniting Killers, And The Killers Behind The Killers, Who Use Violence And Psychological Trauma To Change Our Elections And Our Country. THE FUTURE.

Most people are utterly unable to “go there” and raise suspicions that Dylann Roof – who turned out to be SO politically useful to the Clinton Machine – was somehow PUSHED to do exactly WHAT HE DID, WHEN HE DID.

Hey – I have nothing to gain or lose. There are many things I know are FACTS that others simply don’t believe. I am happy to be there. Adding some strong suspicions that others see as “conspiracy theories” bothers me not in the slightest.

However, I believe that publishing these thoughts is going to INHIBIT the Clinton Machine and their dubious and dangerous allies from trying this sort of thing again. EVERY TIME they use these “MK Killers” to pull a job, they are closer to the WHOLE SHEBANG blowing up in their faces.

This is exactly why I posted this article. SUNSHINE makes people think twice about doing things that do NOT bear scrutiny.

Right now, the Clinton-Biden-Buttigieg-CIA Cabal “wing” of the DNC is clearly trying to take out Bernie using “unethical but not illegal” means. At some point, it’s going to be clear that they need stronger and not necessary legal means, where the “normal” litmus test of Democrat ethics will be applied – the question of “will we get caught?

If people are WATCHING for the scam, it’s much less likely they will USE THE SCAM.

So let’s WATCH FOR THE SCAM.

However, watching for the scam is not enough.

This is where I need to give some LOVE TO THE ENEMY.

Yes. If you are a follower of Christ on this principle – no matter what your religion – then you can’t just sit there and say “good, good, good” while those lovably DUMB Bernie Bros fall into nasty traps, thereby making sure that our wonderful VSG has FOUR MORE YEARS.

FOR EXAMPLE – what about all those Bernie Bros who give people the impression that VIOLENCE is OK?


https://nypost.com/2017/06/14/shooter-posted-cartoons-about-steve-scalise/

https://townhall.com/tipsheet/mattvespa/2020/01/14/bernie-bro-says-liberal-democrats-get-the-wall-first-in-new-project-veritas-vid-n2559493

https://townhall.com/tipsheet/leahbarkoukis/2020/01/29/project-veritas-reveals-more-radical-sanders-staffers-n2560303

I mean, it’s time to be really honest. The Clinton people tried to dump the “violence” rap on the TRUMP supporters, but if anybody out there has a problem with “pushable yahoos” – well, it’s gotta be the Bernie Bolsheviks.

The Gambino Family “QAnon Hit Man”? Spare me! That was CA3 and Reagan-Hinckley cover-up, I’m very certain. There was “Staten Island” and Gambino all over that one. Very bad hoax plus discreditation operation. A lot of internal Mafia hit, too.

Nope – a QAnon rap ain’t gonna stick, because it’s gonna be very obviously BOGUS.

Bernie is the guy who’s “at risk” here.

Most of these Bernista yahoos who are being busted by Project Veritas are really just embarrassing, mouthy, simplistic dopes. They are not only a problem for the left – they are EVERYWHERE – on the right AND the left. The Alt-Right is full of similar yahoos, with the same tattoos and piercings.

Mouthy yahoos who say dopey extremist things are not – in my opinion – significantly dangerous in a stable political environment like we live in now – meaning the TRUMP administration. These people DO BECOME MUCH MORE DANGEROUS under a socialist regime, like the Soviets or the Nazis, because they WILL carry out extreme, cold-blooded acts, when the STATE OR PARTY ASKS THEM. As long as the STATE is benign, and the PARTY is forced to be benign, THEY are – more or less – benign.

Thus, it is very legitimate for Project Veritas to “expose the Bolsheviks”. But they are not the really severe threat that I want to talk about. They are a slight danger to the possibility of Bernie winning the general election, but let’s be honest – THAT is already NOT GOING TO HAPPEN, in my opinion.

No – it is the Congressional baseball shooter – James Hodgkinson – and people like Dylann Roof – who are the real danger. These are the unstable boulders that can be pushed to roll down on the innocent at the right time and place, by unscrupulous intelligence agencies and others who are in possession of advanced tools descended from CIA’s MK ULTRA toolkit.

They can provide the PSYCHOLOGICAL TRAUMA that shifts votes by DOUBLE DIGITS.

However, another disconnected mock-up / frame-up creation like Roof is NOT going to stop either Trump OR Bernie. NOPE. It will have to be another James Hodgkinson – somebody STRONGLY linked to Bernie – THAT is what can stop Bernie.

In my opinion, Bernie can protect himself against these sorts of dirty, bloody con jobs by engaging in the same kinds of preventative measures which have helped the Trump base STAY COOL. “Base pacification” is possible, and it’s a good thing.

COLD ANGER is the way to get hot-tempered people off the highly poisonous diet of hot anger.

From cold anger, LOVE isn’t that far away.

Will the Bernie Bros listen? Who knows. But even if they don’t, WE can watch out for them, because even though they may be across the political spectrum, WE can choose to be our brothers’ keeper.

Hey – we know ALL ABOUT being PUT DOWN by the HILLARY MACHINE.

Stay VIGILANT, my brothers and sisters. On everybody’s behalf.

W

Q up, Maggie.

Seeking QTreeper Counsel on Active Shooter Training and Sketchy Scheduling Thereof

This is a bit of a strange post, and I won’t go into all of the details here and now. Maybe never. However, I am deciding how I’m going to deal with exactly what is in the title, and I want the have maximum information at hand when I do. You folks are a wealth of information. The more good data I have in hand, the more likely I can finesse my way through this little “event bottleneck”.

I am also trying to CHANGE the future by TALKING about it. It’s a neat trick.

Here we go.

I have been invited – in a very voluntary way – to an event in the future which “has my name on it”, so to speak. It’s not about ME, but it’s about something which is important to me. Others know this. It’s a “handle” on me – a manipulator. One that others are well aware of.

If I do NOTHING, I will never end up there. But it would be like Daughn or Big T getting invited to attend a meeting about B&Bs in their town. How can either say no?

I should also say that I AM WORRIED it’s a bit like Barbara Olson getting invited to talk about her book.

Now – even if I DON’T go there, certain bad things can happen ANYWAY. That is partly why I’m making this post. But if I go there, they are more LIKELY to happen, in my opinion. I think that many of you would agree.

I did not put 2 and 2 together when I got this invitation, but I did later. And it was THAT recognition which slightly blew my mind.

You see, this event is being held in the exact same location, at the exact same institution, where 3 days earlier, there will have been “active shooter training” – which even MORE curiously, I have strongly considered attending. It will use said location and said institution – the exact same rooms, I’m sure – for the training.

Most people don’t pay attention to this stuff. But WE DO.

Sorry – I cannot get certain images of ROOMS in New Zealand out of my mind. The ones where we see in videos both obvious training and supposed mass murder.

The institution is a bit of a micro blue zone, by the way. Not as big as New Zealand, but it behaves in a predictable manner, like New Zealand and other blue zones. Nobody would ever question anything.

I was not individually invited to the training, but I did pick up a copy of an invitation to a group I belong to. Because I have taken a variety of first aid and emergency training classes, I thought “Hey, this might be a good thing!”

This institution has never had active shooter training. This will be a first.

Now – more about the “event” which follows the “active shooter training” by 3 days.

There will be a government official there, who works for a governor under extreme media and political pressure on gun control. That official is actually taking part in the program.

It’s a gun-free zone, although there may or may not be any armed security.

It would be a propaganda gold mine for gun control if somebody shot up that event, which I expect would have had low or inadequate security until I just made this post and presumably set off a few alarm bells. #NeverTrump would be clamoring to ban AR-15s, and the governor would HAVE to take action against AR-15s. This event will be loaded with virtue signals to both right and left. Any attack upon these symbols – well, clearly we have to do something about guns.

And then there is the little question of one of the VERY FEW “inconveniently remembering” and extremely detailed, fairly credible witnesses to MK ULTRA interrogation and programming being present.

And we must remember that WITNESSES have been having certain PROBLEMS lately.

But then, if such a witness were to say anything about the whole sketchy thing – such as right now – that witness might be discredited. “Paranoid“, they might say. I mean, it all sounds a bit paranoid to me, too.

And yet, when I asked my dearly departed mother WHY and HOW she managed to live through Hitler, she had a one-word answer. “Paranoia.”

That answer has worked REMARKABLY well for me, too.

Are any of you bothered by this? I need a reality check here.

Something just seems extraordinarily sketchy about all of this. It sets off ALL my alarms and ALL my red flags. After ALL the things that have happened to me – after ALL the things that have happened to WE THE PEOPLE – there just seems to be something wrong here.

I could simply trust in God, but sometimes trusting in GOD really means trusting in OURSELVES, and then trusting in GOD to give us STRENGTH – and that would include the strength to speak up.

So what do you folks think?

Is it time for me to hunker down and just say “Look, kiddo – this is weird – trust your gut – it has saved you a million times – stay the hell away.

Of should I go to either or both of these events now, and just say “You saw something (in your head), you said something – your duty to warn is done. Go and have a good time. They will NEVER pull any crap now. The white hats know everything. The black hats know you know. There will be adequate security.

Or should I say “Look, kid – they still have TIME to repair their scheme and figure out a new way to make it work. Some of these white hats ain’t so white. Stay the hell away from this. LISTEN TO YOUR MOTHER. And if you won’t listen to her, listen to your friends.

So here we are, friends.

LAY IT ON ME. Every instance of sketchy training + mass murder / gun control, what you think about my situation, and what the former means for the latter.

I appreciate your thoughts.

W

PS – I may or may not tell anybody what I eventually do. I need some operational uncertainty.

Whitey Bulger's Hot Date with Sidney Gottlieb and MK ULTRA

I keep shilling this book that I love to criticize as a CIA cover-up, but my motivation isn’t just because if you read it backwards and inside-out, it’s like a roadmap to REAL MK, and its amazing tale of [re]discovery.

It is also a testament to the GENIUS of Sidney Gottlieb, who scapegoated his brilliant early project to save the final result.

And if only the socialist ASSHOLES who inherited it hadn’t killed 58 people in Las Vegas using this stuff, I would not be enlightening everybody as to what the heck is going on.

But then, it is rapidly becoming apparent to me that Kinzer’s book, STRAIGHT OUT OF THE FAILING NEW YORK TIMES, is a desperate attempt at CYA by the socialist / “whatever” Deep State to cover up recent ABUSES of MK ULTRA, in their DESPERATE attempts to remove President Trump.

DON’T. TURN. AWAY.

Yes. Courtesy of those who very soon “won’t be able to walk the streets”, as SOMEBODY PUT IT.

So let’s get back to the topic at hand.


I was at 25% of the way through this book when I made my LAST update. Well, guess what – I am now at 28% and I’ve got another huge post.

I keep telling people – GET THIS BOOK!

So what is the big deal here? What is in the magical “3%” that blew my mind?

THREE THINGS.

First off, this.

It is becoming clear to me that, FAR from some hodgepodge program of desperate grabs for anything “mind control”, MK ULTRA was SMART SHOPPING by a SMART SCIENTIST.

Now, why would I come to this assessment, against all the disinformation and shill messaging to the contrary?

Well, mostly because (1) I’ve been inside scientific research, so I know how quality investigation looks from the inside, but (2) I’ve been OUTSIDE of scientific research, thus able to LOOK IN, and (3) I’m a huge devotee of the HISTORY OF MODERN SCIENCE, and view it as not just worthy in itself, but essential for young scientists, to develop a healthy and moral outlook, understanding the need for openness and honesty above all else.

EVERY TIME that Kinzer points out some new subproject of MK ULTRA, I just have to marvel at how SMART Sidney Gottlieb was in going after what MK ULTRA would eventually become.

It’s ALL RATIONAL, FOLKS. It all makes SENSE.

Yes, if you take any one of his highly compartmentalized, funded projects by itself, it may look like a bit of a WTF in the pursuit of MK. The thing is, *I* know what the final product looked like – remarkably similar to exactly what Sidney Gottlieb was pursuing. So I look at all the pieces, and I see that they are SMART PIECES.

The kind of mental dissociation I experienced – exact as a scalpel – precise as a laser – part of a complex whole that allowed a fantastic “surgery of the mind” – in frigging 1981 – I mean I can see every part of MK ULTRA research leading RIGHT TO IT. If it were not for a “medical error” – or more truthfully a compounding of them – ONE TIME – we would not be having this conversation.

ONE FRIGGING MOLECULE – a stray thought that I had, as part of an “error of subject consciousness” – was all it took to eventually reveal Sidney Gottlieb’s genius achievement.

Second point.

It is clear to me that Kinzer is relying on leftist, NYT, Deep State, CIA, Fake News memes and viewpoints in his interpretation of this stuff. We are talking what might be called “Charlottesville narrative viewpoint”. This is where you show people two hoops, black and white, and they jump through black “because black”. You show them male and female and they jump through female “because wymyn”. You show them whatever the left has said – possibly without openly saying – is the preferred hoop, and they jump through it.

CONDITIONED RESPONSE.

It is impossible to see the world clearly if you have conditioned PC blind spots of right or left. It takes PRACTICE to get around them – to RESIST them.

This is something that makes true free speech a real gift.

I can THINK all sorts of possibilities because of it. Many of which ALMOST NOBODY can think of.

Most of you out there will agree with the idea that Israel’s future and well-being depend on AMERICA. But how many of you can see that AMERICA’S future and well-being depend on ISRAEL?

Most of you will automatically look at the MK ULTRA criminal drug volunteers in prison as victims. I can do that, easily. But how many of you can view them as heroes?

Most of you, whether you will admit it or not, have been so bombarded with the idea that black people are less intelligent than whites, using all sorts of metrics, that you undoubtedly suspect at some level that it might be true. But I will assure you – if you start looking to discover why it might not be true – and I don’t mean in a virtue signal way – NONE of the stuff that the Deep State and controlled left offer on this – you will be led to SHOCKING realizations on the nature of intelligence itself, and how it is defined, expressed, perceived, and how it perceives US. You may at first by disturbed by things, but – trust me – you will eventually be comforted. This stuff was well-designed at the most basic levels. There is CONSERVATION and SYMMETRY that make it all work out BEAUTIFULLY.

FREEING YOUR MIND TO SEE ALL SIDES TOGETHER IS TOUGH. But that is the only way to have a MORE GODLY [notice I did not say “god-like”] view of the universe.

SO – with that hopeful MIND JOLT, let’s go on.

Third point.

Whitey Bulger was an MK ULTRA volunteer.

Yes.

In 1957, when Bulger was just a twenty-something armed robbery thug, but not yet a murderer, imprisoned in the Atlanta federal penitentiary, he was RECRUITED to be an MK ULTRA volunteer. He thought it was ONLY a medical project looking for a cure for schizophrenia. It may have been that, but we now know so much more about it.

The details are interesting, as are details from other volunteers. It is clear that there was a lot of wheedling done to get people to stay in these mind-bending programs. One participant endured terrible high doses of LSD just to get a promised shot of HEROIN.

Bulger was told he was one of the best subjects. However, I get the impression that all the docs told that to all the boys, so to speak. Bet the nurses were pretty fine-lookin’ ladies, too.

Hey – I’ve been around the block. I wasn’t born yesterday, either.

Bulger’s own previous memoirs are cited by Kinzer, so this is totally confirmed stuff.

This is an astounding bit of information, but it makes sense. Maybe it’s been out there for a while, but it was news to me.

And HERE is where I get to thank “principles” from history which first connected Adolph Hitler with Saddam Hussein, and ultimately with Barack “By The Book” Obama.

I believe LEGAL CONSENT and LEGALISMS are part and parcel of the CHOOSING of people to study, test, use and abuse (and then get utterly lost in) the “MK world of human bottery”.

SO – just because Bulger is known to have been part of the LSD experimentation, does NOT mean that it all ends there. I may find out more in the remaining 72% of the Kinzer book. Or I may find out more from other sources.

REMEMBER – part of the overall MK project – which we KNOW from Sidney Gottlieb – was the desire to know if people could do things, up to and including KILLING PEOPLE – maybe OTHER PEOPLE – maybe THEMSELVES.

Can you think of a BETTER reason to get rid of Whitey Bulger NOW? What information might he have revealed – in a BELIEVABLE WAY – about MK ULTRA and its GOALS?

If you read Kinzer’s book, then you may very well ask yourself if these goals ever went away.

If you read my posts here, then you may very well ask yourself if these goals were achieved.

More to come. 72 / 28 = 2.571428…

W


References:

Previous MK Post: https://wqth.wordpress.com/2019/09/30/triangulating-real-mind-control-individual-surreptitious-mk/

My MK Experience: https://wqth.wordpress.com/2019/01/18/deja-woo/

Recent Book Reviews re MK and ET: https://wqth.wordpress.com/2019/09/12/five-books-that-will-set-us-free/

Disclosure Becoming Pop-Sci: https://wqth.wordpress.com/2019/09/15/roll-out-the-sport-model/

QAnon, MK & Tavistock: https://wqth.wordpress.com/2019/01/14/preparing-for-the-mk-reveal-tavistock-basics/

Bob Lazar, Phil Corso, & Exo: https://wqth.wordpress.com/2019/08/22/grey-swan-event-flock-why-nothing-can-stop-whats-coming/

Loretta Lynch and MK: https://wqth.wordpress.com/2019/03/06/the-unbelievable-convenience-of-amnesia/

Discussions of MK Shooters: https://wqth.wordpress.com/2019/01/07/m-k-ultraman/

More Discussions: https://wqth.wordpress.com/2019/08/06/f5-fbi-false-flag-failure-forum/

Still More Discussions: https://wqth.wordpress.com/2019/09/06/red-flag-poster-boy-another-fine-product-of-the-murderous-comey-fbi/