KMAG 20250115 Open Thread / False Flags, Pedos & Satanists

I first want to say, PLEASE at least skim this article. Gunderson documents the false flags the US government has used to control us for decades. I have run out of time, so please excuse my mistakes.

Continuing from last week, now on to the meaty subject of Ted L. Gunderson. He is a whistle-blower & was Agent in Charge of FBI field offices in Los Angeles, Memphis, and Dallas. He is quite interesting, especially given he was poisoned with arsenic powder sprinkled in his home and car after he retired. (1 hour)


I was going to include Colonel Tower’s videos about Operation Gladio since it gives you the WHY but I will do that next week. In a nutshell, to fund Operation Gladio (Color Revolutions and such) the CIA uses ‘off the books’ money from drug running, arms trafficking, — from guns and ammo to fighter jets and helicopters — and human trafficking — from slaves to child sex workers. Drugs and sex are also used to control politicians, the media, judges and such. If that doesn’t work??? Well there is always threats, entrapment, imprisonment and assassination.


And speaking of assassinations, that was Ted Gunderson’s fate.

FBI Chief Ted Gunderson’s Affidavit


[Left click on page and open image in new tab. You can then enlarge the print using [Ctrl] [+] — GC]

Theodore L. Gunderson was poisoned with Arsenic to death a few months after writing this affidavit…

Ted L Gunderson, former head of FBI in Los Angeles, Memphis, and Dallas, was poisoned with arsenic says Dr Ed Lucidi who saw Ted’s body before and after he passed away. Dr. Ed treated Mr Gunderson, who suffered bladder cancer and died as a result of its spread at age 82. LINK

For the science go to the paper:

Aggregated cumulative county arsenic in drinking water and associations with bladder, colorectal, and kidney cancers...

At 9 minutes in that video, Dr Lucidi talks of Gunderson’s arsenic poisoning and the signs [Black nails and body turning black after death.] Also that Ted found arsenic dust in his apartment & locked car.(18 min)

Dr Lucidi then goes into WHY Doctor MacDonald was targeted. The CIA was shipping cocaine back to the States via the body cavities of the Dead soldiers.

Dr MacDonald, as an army doctor became aware of this drug pipeline and thus was framed for the murder of his family. This ties directly into the CIA and their method of funding Operation Gladio coups. So we now, with the recent New Years False Flags, have several interesting links to Fort Bragg, including the 4th Psy Op group that Badlands Media loves. And speaking of Psy-ops, at around 29 minutes in the video, Ted says, “…the MK Ultra program has been very actively administered not only at Offutt  Air Force Base [but] at Fort Brag North Carolina, the place where Dr MacDonald’s family was slaughtered in 1970…”— GC

>>>>>>>>>>>>>>>>>>>>>>>>>>


ADDENDUM: I just found this clean transcript of the GUNDERSON PRESENTATION, MAY 12, 2005, LINK

>>>>>>>>>>>>>>>>>>>>>>>>>>

Another, transcript of one of Ted’s one hour videos with added information can be found at:

The Most Disturbing Story Never Told – Truth Mafia

It is a similar video but goes more in depth into the child trafficking. It is not surprising to see, that since I started work on this article, this video, posted by Truth Mafia, has been taken down.

I am going to take their summary and add my own bits and pieces from the video I have link above, that is still up. I am using most of the transcript from You-tube with a bit of clean up and editing by me. Since this summary does not cover all the cases I am going to insert missing information in the same order as Ted presented it. I am also going to include links and other information that cover the cases Ted Gunderson talks about. I will use the labels “Summary” and “Video” to differentiate between the two sources.

Summary

➡ This text tells the story of Ted Gunderson, a former FBI official who exposed a child abuse ring involving powerful figures in America. Despite facing threats and obstacles, Gunderson revealed a network of child trafficking that extended beyond Nebraska and involved high-ranking officials. His investigations echo in recent scandals involving Jeffrey Epstein and P. Diddy, showing a pattern of powerful elites exploiting their influence to commit heinous acts and avoid accountability. Gunderson’s courage reminds us that truth, no matter how deeply buried, will always surface.

FBI & CIA

As part of the video intro, ted says:

…. I do have credentials…. Believe me if you read the Internet you may not think so because there are some heavy duty FBI informants out there like Stu, Webb, and Barbara Hartwell, who are MK Ultra mind control victims. CIA mind control victims who are making all kinds of disparaging remarks about me.

So right off the bat, he connects the CIA to the FBI and both to the control of information. Because without that control of information the Cabal’s grip on the world slips.

…..

Rothschilds & Adam Weishaupt.

If you use Yandex.com to search those 2 names together it gets into some really bizarre areas. Expose News and Order of the Illuminati are just two examples Yandex brings up. Ted source of information is Commander Carr’s Pawns in the Game (Link to the actual book)

Report on this book:

Pawns in the Game – William Guy Carr

This book was written by a high ranking Canadian naval officer with connections in both military and intelligence agencies. He identifies a group of ‘International Bankers’ as the “secret power” behind world revolutions, and documents the history of their activities as they fund wars and upheavals from Cromwell to WWII. He covers wars and revolutions throughout Europe from 1640 to 1940, but of special interest are his insights into the Spanish Civil War (1936) and events leading to WWII, since these are not well covered in most other accounts…

William Guy Carr died in 1959 of unexplained causes four years after publishing “Pawns in the Game”. He was 64. His son published one of his other important books “Satan, Prince of this World”, after his death.


The book, Satan, Prince of this World in PDF format

PREFACE

When the author of this book, Commander W.J.G. Carr died on October 2, 1959, he left this book in manuscript form along with many scribbled notes, reference books, half formulated thoughts, etc. His last wish was that the book be finished and published in order that all men might know of the plot which exists to wipe out every trace of decency in the world and all civilizations as we know them now. Such a task is manifestly beyond ordinary means. I, his oldest son, have been asked to try and edit, revise and correct the manuscript as best possible before publication. This I have done to the best of my limited ability.

I have not added anything to the original draft or changed anything except where requested to do so in marginal notes in my father’s own handwriting. I found the work frustrating because it was far beyond the scope of my ability. At the same time, I found it extremely interesting and rewarding as I tried to sort out the thoughts and ideas of a man who died almost seven years ago.

At some points in the manuscript I found notes such as: “Check the accuracy of such and such a point” or “dig out more information on such and such a person”. On each occasion, I deleted the point queried completely, for it was always my father’s strong belief that nothing should ever be written until completely proved out in the light of existing knowledge. Since I do not have the necessary sense of values to decide what information should or should not be used in such cases, I felt safest by leaving the information out completely.

The fact that there are only thirteen chapters in this book will annoy some people and frustrate others: I think all who read it will be left in a state of restlessness. “The Unfinished Symphony” has never been completed and this book will not be completed either, except as each reader finishes it for himself in the future by personal experience as the story unfolds. Many of you will scoff at the statements made in this book; many will toss it aside as the ravings of a madman; some will be unable to finish the book because it will arouse anxieties and fears that cannot be faced. But many others, and I hope that they will be in the majority, will find in this work the answers to some of the most perplexing of the problems that have faced men since the beginning of time and provide material for pondering possible solutions to the future….

Please also read the forward by Commander Carr. (pg 6)

….

As I said last week, this is not a rabbit hole it is a a rabbit warren, a network of interconnected burrows. And what a mess it is!

From the video:

Let’s go back to 1776 May the 1st.. Adam Weishaupt  was commissioned by the Rothchild family to set up the goals to control and the final goal was the take over of the world with a One World Government.

Adam Weishaupt came up with 25 goals. Among these goals were control the Press, corrupt the youth through sex and drugs, elect our own people, our own people meaning the Illuminati, to key positions in all levels of the government. City, County, State and Federal and it goes on. The final goal was to take over the world with a One World Government.

[The] information is very well documented by William Guy Carr in his magazine excuse me, in his book Pawns in the Game.

To me this is a critical point. The ‘Cabal’ goes back CENTURIES, not decades and is deeply entangled in not just the USA but everywhere. At the end of the video Ted also mentions satanism — 4 million practicing in America today… 50,000 to 60,000 human sacrifices a year.

1970 Green Beret Murder.

More info:

‘Green Beret’ Murders & Army/Police Complicity in Cover-up

In the video Ted starts off with his first case as a private investigator. It ties drug running from South East Asia (Vietnam) to military bases; a cover-up by military intelligence at Fort Bragg; the involvement of sons and daughters of military personnel in the Satanic Cult who actually committed the murders; all to protect that CIA drug pipeline. Note that these same Cult members were the distributors of the drugs up and down the east coast.

As of 2014, I still do not know if Dr Jeffrey R McDonald has finally been released from prison.

Dr. Jeffrey MacDonald: Innocence, and the Future of Habeas Corpus (Sept. 16, 2014)

This sums up our Just-Us system:


The Tragic Case of Dr. Jeffrey MacDonald 1/15/2021

“We discovered how the defense, the jury, and the judge were prevented by prosecutors from seeing the extensive evidence of outside assailants collected at the crime scene as revealed in CID laboratory notes. This critical material – my entire defense, if you will – remained hidden. As later proven in documents acquired through the Freedom of Information Act, the critical CID lab notes had been carefully collected by prosecutor Murtagh, who left the Army to build his career on my case. He had kept the lab notes in his briefcase in the courtroom throughout my seven-week trial.” Dr. MacDonald wrote,

Murtagh’s fellow prosecutor, James Blackburn, repeatedly told the court, ‘Where is the evidence of outside assailants? Where is the evidence that Helena Stoeckley was ever inside 544 Castle Drive?”


It was in the brief case of his fellow prosecutor as he knew damn well! Reminds me all to well of the Jan 6ers.


McMartin Preschool case

Digging for tunnels on the McMartin Preschool grounds

Summary:


➡ Dr. Gary Stickel, a UCLA archaeologist, discovered tunnels under a school, leading to the uncovering of a covert criminal enterprise involving military intelligence. This enterprise, known as the Franklin cover-up, involved kidnapping children from foster homes and orphanages for sex trafficking. The operation, which is documented in a book, involved flying the children to Washington, D.C. for sex orgies with prominent figures. Despite evidence and demands for investigation, the FBI has refused to look into the matter.


This actually combines one or more cases. From the Video:

The next case I worked of a major consequence was the McMartin preschool case in Manhattan Beach, California. The children there claimed there were tunnels under the school. That they were taken into the tunnels and through the tunnels up into the trap door of a bathroom in a Triplex next door, placed in automobiles and prostituted in the community. These are two, three, and four year-old children before they entered kindergarten. In addition the children claimed that they were flown into the mountains where they were involved with adults in robes. Black robes, Chanting, Candles. They talked about the brown babies who were sacrificed. Who were cut up, actually sacrificed. In checking into this and researching this of course this was obviously a satanic ceremony. The McMartin family who owned the preschool they were tried of Ray Buckey and his grandmother. The grandmother was acquitted. Hung jury on Ray Buckey, the second trial another hunt jury.

I had an opportunity in 1990 to gain control of the school. Now the school had been given to Danny Davis the defense attorney and he had sold it even though he made $15 million on the case by the way. He had sold it to a contractor who was going to take it down. When I learned this, I contacted the contractor. I said I want to be given an opportunity to go on that school and look for the tunnels. The authorities had looked for them in 1987. They said they could find no tunnels. Along with some of the parents ,we hired Dr Gary Stickel, UCLA archaeologist. He hired his crew and brought them in. And in 34 days Dr Stickel said there had been tunnels under that school. They were covered up and they were covered in.

An informant of mine told me that there was an abandoned satanic site in Crestline California up in the mountains I went up into the mountains and obtain copies, photocopies [of] photographs of the site…


Makes you wonder what evidence those California fires are burning… Think the Standard Hotel. Think the 1986 Presidio Child Development Center scandal in San Francisco….


THE FRANKLIN COVER-UP CASE

Selected excerpts from: The Franklin Cover-Up, Child Abuse, Satanism, and Murder in Nebraska by Senator John W. DeCamp

Please at least skim the above article. It is not long. Ted worked a lot with John DeCamp.

From the video:

12:50

From there I became involved in another case. A very frightening case because I established with the help of people like John DeCamp former state senator of Nebraska that we have in this country today, a covert Military Criminal Enterprise Government. An Enterprise primarily by US military intelligence that is operating Full Throttle and everybody refuses to investigate it. In the Nebraska case, it’s called the Franklin Cover-up, this is the book here, that Johnny DeCamp wrote by the way. It’s all documented in there and in that particular instance they were taking children out of foster homes & orphanages [like] Boy’s Town, driving them from Omaha Nebraska to Sioux City Iowa 184 miles away. Placing them in private jets and flying them to Washington DC for sex orgies with prominent people including Congressman, senators and certain people in the White House it’s well documented.

And we wonder why our congress critters vote the way they do?

John DeCamp, CONVENIENTLY died at age 76, July 27, 2017, after battling Parkinson’s disease and other illnesses. He spent his final days at the State Veterans Home in Norfolk Nebraska. LINK

When a person is first diagnosed with PD, they are often told “You will die with Parkinson’s disease, not of Parkinson’s disease”. This means that PD is not a fatal disease per se and end of life often occurs at an old age from another medical illness entirely. End-Stage Parkinson’s Disease & Death | APDA

For more information on the Franklin Cover-up there is:


An Interview with Nick Bryant: Part I – The Franklin Scandal

Nick Bryant: “The Franklin scandal” is about an interstate pedophile network that flew kids from coast to coast. What we are seeing with Jeffrey Epstein, we saw in the Franklin scandal, although I think the Franklin pandering network was much, much bigger than Jeffrey Epstein’s network. There were two primary pimps. There was a pimp in Nebraska, Larry King. He was getting children that had fallen through the cracks, from foster-care homes, from Boy’s Town Orphanage and from some other institutions. There was another pimp living in Washington, DC, who was involved in this, Craig Spence, who had his home wired for audio-visual blackmail. Anybody who took part in any of those parties at Craig Spence’s home was definitely blackmailed.…

Before I went on the wild goose chase with Rusty I made a video of myself and disseminated it to some people and I said exactly what I was going to be looking for, and that I was going to be with Rusty Nelson. So, if anything had happened to me, that video would have been indispensable in a court of law. I backed myself up that way. Pictures had gotten Gary Caradori killed, so I knew that going for pictures was very, very dangerous. This was absolutely “smoking gun” material….Well, no one has ever sued me. “The Franklin Scandal” is layered with corroboration and vetted by an attorney. I told Trine Day, my publisher, “You guys have got to really vet this. What we are saying about a lot of people is pretty horrific. I am confident I am telling the truth here, but you’ve got to vet it.” So, it was vetted by an attorney and no one has ever accused me of libel over the years it has been out. No one has ever accused me of fabricating anything. It’s a very solid piece of investigative journalism.

But the Wikipedia page about the Franklin child abuse allegations has some very autocratic operators who will not let any truth about The Franklin Scandal enter that page. I’ve had wars with them and there’s other people who have tried to make changes to that page. So people look at the Wikipedia page and I am summarily dismissed as a lunatic.

For what it is worth, someone at Badlands Media commented that Wiki is run by the CIA.

Back to the video:

I replaced a fellow named Gary Caradori who was the investigator for a Nebraska Senate committee. Gary met the official photographer of the group who had split from the group, defected. [he] agreed to take the pictures that this official photographer gave him. They met in Chicago. And he agreed to take the pictures back to the committee. He flew out of Chicago in his private plane. A short distance out of Chicago the plane exploded midair. His briefcase has never been found. He and his 11-year-old boy died. The rear seat of the airplane has never been found. I had made every attempt possible to obtain possession of or control of that plane because I wanted to examine it for bomb chemicals particularly the back seat. It’s no longer available. Nobody knows what happened to it.

Gary kadori was a civilian yet it [the plane] was taken to a military base for examination. A deputy sheriff was the first one on the scene he saw the pictures. He started picking up the pictures and FBI agent came along took the pictures away from him. Told him to keep his mouth shut. He started talking to a few people. A year later his wife was murdered. He’s no longer talking.

This International child kidnapping ring I later learned was out of Washington D.C. It was very active and the organization is known as the Finders. I have a report on the Finders back there. Everything I’m telling you is documented by the way. The Finders has been established and operating throughout the 1960s up to the present time. It was exposed in 1987, [so] they moved their operation to Wichita Kansas and they’re operating right today in Wichita Kansas.

So Nick Bryant had good reason to be nervous about getting concrete evidence.

THE FINDERS

The Finders: The Ted Gunderson Report (84 pages)

Video


I have taken my report to the FBI a half a dozen times demanded an investigation and I have yet to be interviewed. So we have the Finders, we have the Franklin Coverup, which documents what I’m telling you. We have the Game of Pawns. [which] is the Illuminati. This is the Illuminati, the Satanic movement, in this country today and the last thing I’m going to mention in the way of a book is Why Johnny Can’t Come Home.

Why Johnny Can’t Come Home (347 pages)


From the Summary:

➡ Johnny, a boy from Iowa, was kidnapped and used as a sex slave in a covert CIA mind control project. He escaped and briefly returned to his mother in 1997 before disappearing again. The case is linked to the Nebraska case and the CIA’s MkUltra mind control program, which was investigated by Congress in 1987. This program, still active today, involves training individuals for various tasks, including assassinations, and has connections to powerful figures and institutions, including Boys Town, Nebraska, a respected children’s charity.

➡ Larry King, a prominent businessman, was accused of abusing children from Boys Town, a home for troubled youth. Despite reports of his actions, no action was taken due to his influence and connections. However, in 1988, his financial crimes led to his arrest and the exposure of his pedophilic activities. Despite the evidence and testimonies, many of the influential people involved in the abuse were not prosecuted due to their power and status.


➡ The text discusses a horrifying scenario where children were manipulated and abused by a man named Larry King. King used drugs to control the children, who were then forced into sexual acts and threatened with violence. The text also mentions a disturbing ritual involving murder and sacrifice of children, which was believed to bring power through invoking demons. The victims were often very young and were brainwashed into participating in these horrific acts.


➡ In 1990, a child abuse ring was discovered in Nebraska, but the media and law enforcement discredited the victims instead of investigating the accused. The FBI and local police didn’t take the victims’ allegations seriously, and even pressured them to change their stories. When one investigator died in a suspicious plane crash, his evidence was quickly seized by the FBI. Despite the victims being acknowledged as abused, the grand jury dismissed their allegations and instead charged one victim with perjury.


➡ In 1991, Alicia Owen was sentenced to 9-25 years in prison due to a false child abuse story by Troy Bonner. Alan Baer was fined $500 for aiding prostitution, and Peter Citron served two years for a similar crime. Larry King, however, never faced child sex charges due to Bonner’s lies, but was sentenced to 15 years for a $40 million fraud. John de Camp believes this case shows a failure of justice and hopes to expose it, despite strong opposition and claims of cover-ups in high places.

At this point things get really interesting.


Noreen Gosch Speaks About – Jeff Gannon, Johnny Gosch And The Attempted Theft Of Her Book ‘Why Johnny Can’t Come Home’


…Years later, on February 5, 1999, in a civil action in a U.S. District Court in Lincoln, Nebraska, Paul Bonacci painstakingly recounted the sordid, heart breaking details of Johnny Gosch’s abduction and forced participation in an elite government sponsored pedophile sex slave ring, that dehumanized and controlled its young, hapless victims using techniques such as drugs, murder, satanic rituals, sexual abuse, and torture, resulting in MPD (multiple-personality disorder). The children were systemically programmed and “zombified” as part of the CIA’s ongoing, under-the-radar MK-ULTRA (MK = mind control) mind control program….

Paul Bonacci knew what he was talking about regarding Johnny Gosch’s kidnapping in 1982. Why? Because he was there! Bonacci’s role within the pedophile ring was simultaneously that of a victim and a perpetrator. Actually, the then 16 year old Paul Bonacci was the person who had lured and then forced Johnny into the back of the car that screeched away on that fateful September morning. It was Bonacci who had helped drug Johnny, and then proceeded to initiate him into the group, his new “family”, by sexually assaulting him.

Bonacci himself had been abducted and pressed into service as an MK-ULTRA sex slave by Lawrence E. King, a high ranking Republican operative who managed Franklin Savings and Loan in Omaha, Nebraska as a front for an internationally organized pedophile ring. He ran this pedophile ring for the benefit of government, military, and big business elites, whose patronage included political blackmail, snuff films, kiddy pornography, prostitution, illegal arms and drug running, extortion, and money laundering. This was the same Larry King who allegedly ran the infamous midnight “call-boy” tours of the White House, along with Craig Spence. Amazingly, the White House pedophile story was headlined by the Washington Times, on June 29, 1989.….

Unbelievibly, now Noreen is threatened with another loss, as if the 1982 brutal kidnapping of her son Johnny wasn’t enough. A scoundrel is using the courts to paint Noreen into a legal and financial corner in order to to steal HER remaining book inventory and the reprint rights to HER book… 

The theft of her book is a way to bankrupt her and shut her up of course.


That article leads to this unsavory character and his wife Lilith. Note the winged eyebrows on this dude.


LTC Michael Aquino and his wife Lilith. Aquino was a practicing satanist, but whether he actually believed in it or used it for his role as mind-control and rape of women and children only he knows.

The Military and Child Molestation: Holding Our Own Accountable in This 5 Gen War


…The Presidio Child Development Center scandal was reported on beginning in 1986 in San Francisco.
As in the Franklin case, there is no question children had been sexually abused. Literally dozens of children were medically examined and showed signs of genital and anal trauma, and 5 to 6, depending on reports, contracted chlamydia, a sexually contracted disease
. The game became what could be prosecuted in a court of law.


Many of the children repeatedly identified Aquino as being present when they were transported from the base to area homes for ritualized abuse.


Aquino lived in the area and eventually his home was raided based on descriptions provided by the children of not only a satanic décor, but a soundproof room with photography and video recording equipment inside. Photographs of naked children were carried out of the Aquino home in clear trash bags, along with video tapes and other evidence. Of course, Aquino was never brought up on charges, most likely because of the level of prominence of the people depicted in those photographs and movies raping children.


The Army took over a year to close the daycare. About the only thing it did even half right was ensure Aquino would never get promoted.

End of career. Bye…


Pedophilia in the Military: Lt. Colonel Michael Aquino and His MK Ultra/Monarch Mind Control Program Revisited — Before It’s News

Back to the Video:

…the mother Noreen Gosch was dumbfounded didn’t know what happened demanded an investigation by the FBI and by the West Des Moines Police Department. The chief of police in West Des Moines said to her, even though he disappeared, we do not have any witnesses who saw him being grabbed and placed in a car or being taken control of, 👉so we’re not going to investigate it.👈 The FBI used the same premise they refused to investigate it. Now I’ve been involved in kidnappings in the FBI and I can tell you that it’s automatic within 24 hours, 👉at the end of 24 hours that we had to go in.👈 In my day this was back in the 50s, 60s and 70s we had to go in and start investigating the case after they’ve disappeared for 24 hours.

Today as we as I stand here and you sit there the children are disappearing in this country at the rate of 83 per hour that’s over 700,000 children a year now. I can go back to July 1982 the Readers Digest claimed there were 100,000 children disappearing every year. There’s another statistic that I find very interesting and that is that it is estimated 2,500 children are kidnapped and murdered in this country every year….


Now we know why the DemonRats are so interested in ‘unaccompanied children’ and why they ‘disappear’ from the system. The USA now has a much lower birth rate and parents are more careful about keeping a sharp watch on their kids compared to the 1950s & 60s. The pedos and satanists, needed a fresh source.

Back to the video:

I personally talk to one of the youngsters who was involved in this network. I’ve talked to several of them and he assures me that Jeff Ganon is in fact Johnny Gosch.

Well how did Johnny Gosch get from a West Des Moines Iowa 12 years old, all the way, with the phony press pass, into the White House as of a few weeks ago. What happened to Johnny is that he was transported from West Des Moines to Sioux City. He was placed on a farm for 3 weeks [and] sexually molested. He was taken to the mountains in Colorado placed in a cage in a house of some sort or cabin. And then later he was used as a sex slave. They didn’t kill him they didn’t sacrifice him although a number of these kids are sacrificed in satanic ceremonies. He escaped with another young man. They stole a car and in 1997 Johnny knocked on his mother’s door at 2:30 in the morning. Gosch said he wanted to talk to her. He was there with another young boy. He came in. He told [her] in the rain. He says “mother I was kidnapped.” Kidnapped, I’ve been placed in a covert military CIA controlled mind control project and used as a sex slave. He said I can’t come forward at this time. They will kill me and then he left in the rain . She says that’s the last time she talked to him.

[It’s] 1997 now. Now several years after that, a girl named Burns who was a producer for 20-20 decided to do a story on the Johnny Gosch kidnapping and the Nebraska case. And She interviewed me. In fact I spent 5 days with her. Gave her the benefit of all my research, which is available to you folks also. Then she got a lead that Johnny was hiding out on an Indian reservation in northern Minnesota she went there and flushed him out. He basically went into hiding and now he shows up at the White House. He was a mind control victim.

27:00 MK ULTRA MIND CONTROL PROGRAM

If you don’t know anything about MK Ultra mind control program, it came into this country through the German scientists after World War II. They were involved with the Nazis during the war and prior to World War II in developing robots and individuals to be used on command for anything that they wish ,including assassinations and other nefarious activity. The MK Ultra program, CIA mind control program, was investigated by Congress in 1987. Congress said CIA you got to quit doing that that. You’re bad boys and they said we will quit. Don’t kid yourself. It’s is very active today. There are people like Barbara Hartwell out there who are mind control victims. She’s another one who’s been bashing me. I must be doing a pretty good job because I wouldn’t have these people criticizing me on the internet like they do. Of course it doesn’t bother me in the least.

But going back to the Nebraska case [and] MK Ultra. A lot of this training took place at Offutt  Air Force Base in Omaha Nebraska which was strategic care command headquarters. You recall after 9-11 the president flew to I think it was the South someplace in Louisiana or New Orleans and then he flew to Offutt Air Force Base in the afternoon of September 11th. They had a party there that morning at 9:30 in the morning. He missed the party. He was sorry he missed the party. Warren Buffett was there by the way.

The MK Ultra program has been very actively administered not only at Offutt  Air Force Base, [but] at Fort Brag North Carolina, the place where Dr McDonald’s family was slaughtered in 1970.

32 minutes. KENNEDY ASSASSINATION

I used to be in charge of the FBI in Dallas. So in checking into the Jack Kennedy assassination, I learned no question about it that it was a joint hit by the CIA and the Chicago mob. Sam Giancana was head of the mob in Chicago. Three days before he was to testify before Congress, [he]was shot and killed…

33 minutes PEARL HARBOR

I interviewed the naval intelligence officer who on December 4th 1941 received information that the Japanese were going to bomb Pearl Harbor. We had broken the secret code of the Japanese. He told me personally, on December the 4th, he gave it to his superiors they passed it up the line…

34 – 36 minutes WACO TEXAS

..look at Waco. The military was involved in destroying, shooting and killing women and children. Also the FBI. They use tanks, military tanks in violation of Posse Comitatus… They got away with it… in Waco there were four ATF agents who were shot and killed. some of the Branch Davidians were tried sentenced for these quote murders… in researching the four ATF agents who were shot, I learned every one of them was shot in the head. Now for those of you who have been in the military that’s a sniper shot no question about it. [in] one of [the] men the bullet trajectory was from above down through his lip and into his body probably from a helicopter. It’s interesting to note that these four men, ATF agents, at one time were all bodyguards for former President Bill Clinton..

37:09 WORLD TRADE CENTER CAR BOMBING

We have the 1993… the car bombing of the World Trade Center. I have a copy of the New York Times [from] October 28th 1993. And in the article was reporting from The Trial that took place [of] an FBI informant named Salam who was in among the terrorists. He testified that he was commissioned by the terrorists to put the bomb together to bomb the World Trade Center in February 1993.

Fortunately for him, when he met with the terrorist he wore a body mic so he could record every word that was said. Unknown to the FBI, when he met with the FBI, he also wore a body mic. That was probably what kept him from being set up and framed and sent to prison. This is actually in this newspaper article he went to his FBI superiors. [He] says I’ve been commissioned to put the bomb together we’re going to use a dummy bomb aren’t we and 👉he was told by his FBI superiors no we’re going to use a real bomb.👈

Now I don’t understand why Congress and Senate investigators and our leaders in Washington DC are not jumping up and down over that situation. 👉The FBI not only knew in advance of the car bombing, they furnished the ingredients for the bomb. [ Jan 6th Pipe Bomb anyone? – GC] 👈

Why doesn’t somebody take some action in that area. Why doesn’t somebody investigate this International child kidnapping ring being operated by the CIA. Why are these congressmen voting on bills like the Patriot Act which takes away many of our constitution rights and civil liberties in the best interest of quote protection for our country and protection from the terrorists.

Let me tell you something ladies and gentlemen, there are people in our government, a rogue outfit, whatever I’m not sure who, are actually Behind These Terrorist Acts. And the reason they’re behind the terrorist acts is so they can pass bills like the Patriot Act and the reason the congressmen and the Senators vote for these stupid bills. Stupid by our terms and our definition, is because they’ve have been set up and framed through sex and drugs.

40:11 OKLAHOMA CITY BOMBING

So then we have Oklahoma City 1995.

I personally made two trips to Oklahoma City. I investigated Oklahoma City. Because of my report, the defense attorney for Timothy McVeigh, sent two of his investigators to interview me. I spent four hours with them actually. I got a lot of information out of them. For example they told me that they were allowed to tour the remains of the M building in Oklahoma City in the presence of a US Marshall, but they were not allowed under any circumstances to take soil samples or to pick up any evidence for examination. Stephen Jones was their attorney.

I heard that they were going to tear down the building.

Now you can trace bombs through what they call the tagging chemicals. When I heard this, I called John deCamp. I said, “John we’ve got to prevent that building from coming down.” I actually called an outfit in Chicago of the Pat Kennedy group, who are specialists in examining evidence of this type. John called McVeigh’s attorney, Jones. Because John had a client who he was representing, who was involved in the case, John said I’ll handle the paper. We’ll have a hearing. We will prevent that building from coming down. The next thing we heard the building was coming down. John called Jones. “What’s going on and he had no good answer for it. That was evidence. I’ve been at many a crime scene and it is critical that the evidence be preserved. That was a huge cover up.

McVeigh wrote a letter to his sister. [Jennifer] was in Special Forces. The government said the military says “oh no he flunked out” He didn’t flunk out. He was recruited out of Special Forces according to him in a letter he wrote to his sister. [He was recruited] to be trained to be a CIA assassin and also to work for the CIA International drug operation both against the competition and for the CIA pro- drug people. McVeigh was in my opinion an MK Ultra mind control victim. He was visited in prison in Oklahoma and in Colorado by Dr Jolly West. This was secret by the way, I happen to find out because I made some phone calls to the right people. Jolly West was one of the foremost leaders along with Sidney Gottlieb and the CIA’s MK Ultra mind control operation.

Some additional information about Dr Jolly West, so you understand the implications of what Ted is talking about:

Correspondence Between Jolly West and Sidney Gottlieb, Director of the CIA’s Operation MKULTRA (1 minute video)

Jul 21, 2022

Never-before published internal documents from the Lackland Air Force base psychiatrist who was secretly contracted to the CIA’s MKULTRA program to experiment with airman using drugs and hypnosis — without their knowledge. These exclusive letters between psychiatrist Louis “Jolly” West and MKULTRA’s director, Dr. Sidney Gottlieb, outline the men’s plans for creating mind controlled assassins. Their work began in June 1953, one year before the murder of three-year-old Chere Jo Horton by Lackland airman Jimmy Shaver.

43:30

Why would somebody like Jolly West go interview McVeigh not only in Oklahoma but also in Colorado during the trial? Because he was a mind control victim himself. At one time it was reported, I think in US News & World Report, that McVeigh had a microchip in his buttocks. Our military reportedly have been using microchips to keep track of their soldiers.

The bomb in the truck allegedly was a fertilizer bomb. The government first announced that it was a 1500lb bomb and then a 2500 lb bomb and I think it ended up being 4,800 lb. That bomb that was in the truck destroyed half the building. A 4,800 lb fertilizer bomb, an ammonia nitrate fertilizer bomb dissipates and did not have the potential, the possibility, of destroying that much of the building. After the Oklahoma City bomb went off I had a call from a friend of mine, Michael Riconosciuto. For those of you who are making notes look up in the internet, Michael Riconosciuto. I’ve been working with Michael since the early 1980s, 1982.

44:55

It’s when I first met him. He was a CIA agent operative for some two decades he was also an FBI informant at one time. His father owned the Hercules Manufacturing in Silicone Valley California. Hercules manufacturing developed what is known as the electro-hydrodynamic gaseous fuel device which is a highly classified bomb. The bomb was was actually manufactured by Dyno Nobel out of Salt Lake City.

I want to stop here and mention Brave has ZERO info on “Electro-hydrodynamic gaseous fuel device” (I was trying to find the correct spelling.) However when I tried Yandex, I got a whole bunch of hits for “Hercules Manufacturing Electro-hydrodynamic gaseous fuel device” For example:


THE OKLAHOMA CITY BOMBING & THE POLITICS OF TERROR — The Liberty Beacon. Jan 2015


Oklahoma City Bombing: Was Timothy McVeigh a Patsy in a Sinister Black Flag Operation? — Covert Action Magazine 2022/04/19

Hercules-2 | (The) Project on ship engine technologies

Fuel flexible, near-zero emissions, adaptive performance marine engine

46 minutes PROMIS SOFTWARE TRAPDOOR FOR US GOV’T

Now Michael, in the meantime, is in jail now. Right? In fact I talked to him yesterday because he started to talk before the Brooks committee about a very interesting case involving the Promis Software [Inslaw, 30 Inc.]. The Promis Software was a computer operation. They developed all kinds of intelligence information on you, and I, and every citizen in America. The Department of Justice leased it for two years. At the end of two years they refused to pay Bill and Nancy Hamilton the $10 million they owed them. Then the Department of Justice through Earl Bryant, past president of United Press International, took that computer [and] sold it around the world. Sold it to the French, to the English, Israelis, Canadians. Unknown to these foreign countries, [to] the officials in these foreign countries, there was a trap in the computer. A very clever trapdoor [that] secretly allowed us, the US government, to retrieve all the information they developed.


Michael Riconosciuto was the CIA agent who developed the trapdoor in the Promis Software Computer. When Congress started to investigate it in the late 1980s, they called on Michael. We want you to testify. Michael received a threatening phone call two weeks before he was to testify, he claimed. From a fellow named Peter Videnieks of the US Department of Justice. “If you testify you’ll be sorry.” Michael testified anyway. A few weeks later [He] was arrested for drugs [and] is now serving a 30-year prison sentence because he dared to expose these nefarious activities by this Rogue Criminal Enterprise operating within the confines of the US government.

Summary of Michael Riconosciuto’s Information Presented in Terrorism Cover Up in America

What happened to Michael Riconosciuto? American Conspiracy: The Octopus Murders culprit’s whereabouts explored March 2024 [NETFLIX Docu-series???]

Michael has been released and is scared to death he will meet the same fate as journalist Danny Casolaro. The documentary is by Christian Hansen & Zachary Treitz. Riconoscuito was one of the chief sources for Casolaro. Michael had a lot of inside info on the people concerned.

Back to the rest of the video.

47:30

I gave you a little background on Michael. Going back to Oklahoma City now, I want you to understand who Michael is. He’s not some guy walking down the street with a grocery basket looking for a recycling center okay? He has credibility. Now Michael called me right after the Oklahoma City bomb went off and he said Ted, (He called from prison by the way) that’s my bomb meaning [that it is the bomb] Hercules developed. That it was not an ammonium nitrate bomb. Now when that [Hercules] bomb was tested in 1982 I happened to be with a group of intelligence agents in Palm Springs waiting for the results of that test.

It was tested in Area 51. It was under estimated because the power, it was so powerful, that two of the technicians died. They underestimated the strength of it. This, I call it a barometric bomb, this barometric bomb, according to Michael was what was in the car not a fertilizer bomb. I have an Oklahoma City report on that. So what did I do as an investigator?

49 minutes

Well I went to the Picatinny Arsenal in New Jersey. I gave him the contract number which I obtained through a Science magazine. One of my associates actually did the research on that and I gave the public Picatinny Arsenal contract number and the Picatinny came back and said there’s no such contract here, even though I had the contract. By the way that’s documented in my report. I went to Dyno Nobel who I knew manufactured it and they didn’t even bother to respond. It’s interesting to note that a  Dyno Nobel  expert witness testified at the Grand Jury when they indicted McVeigh in September of 1995

50 minutes

Some five or six months after the 19th of April 1995 Oklahoma City, in an article in Fireman’s Magazine. It was written by the editor of Fireman’s Magazine. The information was obtained from the Oklahoma City Fire Department. In that article, again that’s in my report, in that article it states that four unexploded devices were taken out of the building. When people were in the building after the bombing, DYING, they discontinued the rescue efforts for some 5 hours, while they carried out a bunch of government files. Men in blue suits of some sort. Sweatsuits. So what I’m telling you is Oklahoma City was perpetrated by certain people other than McVeigh and Nichols and now Roger Moore.

If you read the paper recently, the gun dealer who claims that he was robbed of his guns in Arkansas and that that money was used to finance Oklahoma City Bombing, Roger Moore, has been accused by Terry Nichols of being involved in it. Roger Moore denies it. Roger Moore at the time of the Oklahoma City Bombing was an FBI informant. I had an Inside investigator in Oklahoma City tell me that there were at least 11 other individuals involved in Oklahoma City okay?

52 minutes 9-11 ATTACK ON THE TWIN TOWERS

That brings us up, we’ve gone through Pearl Harbor, Waco, Ruby Ridge, Car bombing 93, Oklahoma City 95, that brings us up to 9-11.

As I said my [client] was in prison. I’m his “investigator of record” which means I’m like an attorney. I should have access to him on a regular basis. I represent this man. For a year prior to 9-11, actually year and a half. I tried to get in and see Michael. He was in prison in Northern Pennsylvania. I was in the Philadelphia area. The Bureau of Prisons would not allow me to see [him.]

I finally was able to talk to Michael in January 2003. I flew to the east coast spent three days with him.

Michael told me that he had developed information from among his contacts in advance of 911 that they were going to be involved in using missiles, airplane missiles and they were going to be involved in skyjacking. They were training Arab terrorists. Also he knew the identity of the person in the United States. An Arab who lived in Patterson New Jersey who was the leader of terrorist activity by the Arabs in this country. Now Michael had this information, because you’re saying how can Michael develop this information being in prison? Because I met with Osama Bin Laden, along with Michael, along with the state department representative, in the spring of 1986.

At that time I was contacted by former top Reagan Ronnie Reagan official who said can we help the Afghan Rebels? They were our friends then. So I called Michael, and I said what do you think? He said let’s meet. So there was a fourth fellow there. We didn’t know at the time it was Osama Bin Laden. He actually used the name Tim Osman traveling under a Turkish passport. But because of Michael I passed the ball to him. I just arranged for the meeting and went on.

Michael traveled all over the world putting this package together to furnish the Afghan Rebels with the surface to air missiles that defeated the Soviets. Really shot down their helicopters. As a result of this Michael developed sources inside the Arab world. And that’s how Michael knew in advance about 911.

55 minutes

Michael told the FBI on March the 20th 2001 about this plan to use Skyjacked airplanes and use them as missiles. He also furnished to the FBI one of his sources, one of his confidential sources inside the Arab group. The FBI interviewed him, threatened him with prosecution and deported him. That man along with his family have disappeared. We think that they’re dead. The FBI refused, absolutely refused to look into this situation. More shocking is that Michael had the names of the people who were obtaining the false names. Of the people, the Arabs, who were obtaining false passports. had their names. He had the source who could furnish him that information he told FBI Agent Keith Cutri on March 20, 2001. He told Cutri. He says “I’ll give you these names, the name of this person who’s coordinating the whole project for the Arabs, providing I be given immunity and he be given immunity.” Mr. Cutri, in spite of the fact he was armed with this information six months prior to 9/11, came back two days after 9/11, on the 13th and saw Michael in prison again. [He] accused Michael of being anti-government, anti FBI, of being a publicity seeker, and so forth, being disloyal. And so Michael, of course, didn’t have much to say after that.

Michael is still in prison, as I said. But, we had this information. The FBI did nothing with it. Cutri admit it, on September 13, 2001. Admitted that the FBI did nothing with it. So, after I visited Michael, in 2003, I felt it was important that I confirm that the FBI did meet with him.

The Bureau of Prisons would not furnish Michael with the visitors list to confirm it. So I started writing letters to the FBI through Senator George Allen to confirm that he did in fact meet with them. I wanted to document it. I also asked for the identity of the other agent who was with agent Cutri and I had a terrible time. It took me a year and a half writing letters to the FBI to get them to admit that they’ interviewed Michael on March the 20th 2001. I finally did have that information. That information is available again in one of my reports. My terrorism report that I have in the bag. So that basically brings me up to the the present time.

I think my time is up but I feel compelled, as a former FBI agent, I had all this training and I feel compelled to do everything I can to educate as many fellow Americans as I can, as to what’s going on behind the scenes. We have being operated and orchestrated primarily by US military intelligence. A Covert Criminal Enterprise involving FBI and the CIA active in this country today. [It] is being covered up right from the beginning.

By the way, they tried to frame me on a drug deal back in 1984. It didn’t work. The girl that they used to try to frame me contacted me, and said I need to meet with you. We met, [and ]she told me the whole story. I took a signed statement from her. Her name is Pam Fawsett. And, I said to Pam, I said Pam you’re working for these people the DEA and the FBI in Modesto. By the way she was making phone calls to me. I said you’re working with the people trying to set me up. Why have you — and of course in the phone call she kept trying to get me to make admissions that had knowledge of a felony and I wouldn’t. I said I don’t have any knowledge of that or was involved in a felony.

Actually I said Pam look you were working with these people for 6 months. They gave you $2,000 you had the run of the FBI office. You had your own coffee cup. Why did you come to me and tell me this now. I’d helped her, give her little advice about her 14-year-old son in the interim. You know talking back and forth there, any individual would do [it] who might be able to help. She said Ted I woke up the other morning and I realized you’re the only honest son of a bitch I’ve talked to in 6 months. Those were her exact words.

The FBI not only tried to set me up on a drug deal, I’ve also been the victim of four separate investigations. They tried to set me up on a fraud case in Denver, in Dallas, and most recently. Very frankly I’ve been under surveillance, heavy surveillance. I’ve had illegal entries into my car into my apartment. There’s been attempts to gas me within the last month and I was able to anticipate it and avoid it. But they don’t want people like me out telling the truth and that’s what I’m doing.

1:00:57

I will not stop I will continue to do so in the future so that’s basically it. I brought you from 1776 to the present time. We went through one conspiracy after another.

I had given Jim Nichols my Oklahoma City bombing report. Jim said to Bryant Gumbel, he says, did you read Ted Gunderson’s Oklahoma City report. Gumbel says, “Oh, Ted Gunderson’s a conspiracy theorist.”

I want you to know I’m not I’m not a conspiracy theorist I’m a conspiracy realist. It is there. All you have to do is get your own website, get your own internet go out there. There’s a lot of disinformation out there but you can pick out what’s really solid and what’s really truthful.

1:02:00

I have done, I have 25 years of research. [It is] on that back table back there. If you buy any of my reports or this video tape or any of my material I want you to make a promise that you will make copies and distribute it far and wide. We need to wake up America right now. Let me emphasize again I’m not anti-American. I don’t believe in violence. I believe in change through legal means. But we need to wake up an apathetic sleeping society that is active in America today. This not only ties into MK Ultra – CIA, it ties into Satanism. There are approximately 4 million practicing Satanist in America today involved in the Nebraska case.

I can go on about satanic cults for another, but I think my time is almost up. I might mention that speaking of Satanism, there are between 50,000-60,000 human sacrifices, according to three different sources, in this country every year. The satanic cults operate secretly. The Satanic Cults are along with our Covert Criminal Enterprise within the government, a serious threat to our society

I thank you very much.

The Ted Gunderson Chronicles (Part 2) Various editions:

2 hours: https://www.bitchute.com/video/aI0QNi2NQAYT/

56 minutes: https://rumble.com/v2wjzy6-ted-gunderson-chronicles-ii-part-2.html

2 hours: https://www.dailymotion.com/video/x2hfy6z

Dear KMAG: 20230807 Joe Biden Didn’t Win ❀ Open Topic

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!

We will always remember Wheatie,

Pray for Trump,

Yet have fun,

and HOLD ON when things get crazy!


We will follow the RULES of civility that Wheatie left for us:

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

And while we engage in vigorous free speech, we will remember Wheatie’s advice on civility, non-violence, and site unity:

“We’re on the same side here so let’s not engage in friendly fire.”

“Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”

If this site gets shut down, please remember various ways to get back in touch with the rest of the gang:

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Word of The Week:

deranged

adjective

  • Disordered; especially, disordered in mind; crazy; insane.
  • Disturbed or upset, especially mentally.
  • Insane.

Used in a sentence

Rep. Jamie Raskin, D-Md., slammed former President Donald Trump’s legal defense in his criminal case over the 2020 election as “deranged.”

Used in a Truth Social post

“Do you think that A.G. Garland, and Deranged Jack Smith, understand that we are in the middle of a major political campaign for President of the United States? Have they looked at recent poll numbers?” Trump wrote.

Used in a theory

I’ve been wondering why Trump keeps referring to “deranged” Jack Smith, when the history of John (his real name) Smith shows no indication of ever being deranged in any way, or even having ever been a mental patient, unstable, etc.

And yet – well – when this allegedly sane person Jack Smith read off the weird crap charges against Trump, with utter seriousness, he sounded to me like a nutcase.

HOLD THAT THOUGHT.

I believe that Smith is an “MK ULTRA” subject, and that Trump is hinting at this. It is my contention that MK ULTRA leads to a variety of forms of brain damage, as side effects of the process of mental manipulations.

Among the people who I suspect have been conditioned by MK ULTRA (see many earlier posts), for a variety of purposes:

  • Whitey Bulger
  • Robert Mueller
  • Loretta Lynch
  • Merrick Garland
  • Christine Blasey “Two-Door” Ford

Whitey Bulger was likely used to test MK ULTRA’s capacity to carry out murder.

Robert Mueller’s sad dementia and wrecked brain seem very post-MK to me. Recall Mueller’s close relationship with Bulger during Bulger’s work as an “informant” who was murdering other criminals (likely under MK ULTRA).

Merrick Garland likewise shows damage from tampering, IMO.

Loretta Lynch had nearly complete amnesia about critical events when she had to testify. IMO she would pass a lie detector test about any items in her “selective memory” – because of MK ULTRA.

Christine Blasey Ford is a powerful example of the derangement resulting from MK ULTRA. She is a human puppet who can be made to say anything. Clearly this is “deranged”.

I believe that MK ULTRA was used to take over DOJ. “They” literally brainwashed critical people in DOJ and FBI.

Bottom Line:

Jack Smith is “deranged” = brainwashed = MK ULTRA

https://www.newsweek.com/donald-trump-deranged-jack-smith-election-interference-1814772


More “country” music! (as in THIS country)

And some epic Two Steps From Hell for Wheatie….


I am getting used to the local work. I’m getting stronger.

THINK globally.

ACT locally.

TWO can play that game.

Hope you’re STILL having a great summer!


ENJOY THE SHOW

W

Wolf’s Statement on the End of Affirmative Action


I have tried to write this several times.

I have decided to be short, blunt, and to the point.

Here it is, very simply.

I was part of the cover-up of the early failure of Affirmative Action.

And when I say EARLY, I mean it failed during the alleged TESTING – meaning the very first year they put AA students on campus, which was supposed to be a test, but was really an unstoppable, unchangeable, unarguable implementation, that was going to happen, no matter what.

Let me be crystal clear.

Affirmative Action failed RIGHT OUT OF THE GATE.

I was there, and was an integral part of the disaster and the cover-up. And, quite frankly, I’m lucky I’m still alive. But I learned to keep my mouth shut for a very long time, and how to stay ahead of the people who needed me “gone” in some legal, plausible, and useful fashion.

Here is a bullet list of what happened. It’s long, but it gets the point across quickly, how the failure of Affirmative Action became known, and was then covered up.

  • I was working on an advanced science degree at a very fancy university
  • The university was informed that we would be getting Affirmative Action students
  • There were only a few of these students
  • This was supposed to be some kind of test, but it really was more of a “done deal”
  • I was warned by a friendly superior to steer clear of these students, and I did, but I didn’t realize why
  • One AA student in my professor’s class was caught cheating
  • I got the scoop from the teacher involved – the cheating was stupid and desperate – it was almost a cry for help
  • The student was clearly out of their depth
  • The failure was likely to mean the student would fail the course
  • AT THIS POINT, AFFIRMATIVE ACTION WAS IN TROUBLE – if this was really a “test”
  • It was obvious to me that Affirmative Action would require a “fix” to actually work
  • I was an idiot and thought I could help Affirmative Action work
  • I suggested the idea of a remedial program, which had worked for unprepared math students at my previous university
  • That was it – I just mentioned this to the professor
  • TIME GOES BY – we hear nothing
  • The next thing I know, this same student was placed into our research laboratory, as an undergraduate researcher, by orders from the university
  • This was absolutely insane, dangerous, and utterly backwards to all common sense – only the BEST students are normally allowed into undergrad research in any university
  • The professor could not stop this – it came from too high up the chain
  • As one might predict, there was a DISASTER involving this student.
  • The disaster resulted in a lawsuit
  • The next five parts are very important – it’s about LAWFARE
    • (1) The lawsuit conveniently prevented the university from reporting anything about the student to the government, due to “conflict of interest”
    • (2) The lawsuit therefore prevented the university from reporting anything bad for Affirmative Action
    • (3) The lawsuit prevented the university from taking any public position regarding Affirmative Action
    • (4) The lawsuit created leverage on everybody involved, to hide what happened
    • (5) The lawsuit resulted in NDAs on everybody involved, to silence them on what happened
  • Bottom line, the “forced disaster” protected the truth about Affirmative Action from ever being known

However, that’s just the superficial, top-level view.

I was close enough on this sucker, and paying enough attention, that I realized things were EVEN WORSE THAN THAT.

This disaster didn’t just happen because putting a deficient student in a dangerous place is a dangerous idea.

SOMEBODY MADE SURE THERE WAS A PROBLEM.

Yes. This was a scam – an engineered accident. And the technology used to pull it off was astounding. So much so, that it was unbelievable, and I had to hide it. I simply could not testify to something that people could not believe.

For a long time I thought that the money of the lawsuit was the driving force behind SOMEBODY deciding to use cutting-edge technology, but the economics just were not there. Nope – it was the millions, and then billions, and eventually TRILLIONS of dollars at stake.

Once I realized that this was really a deep-state thing for billions and trillions of dollars, and not just a lawsuit for measly low millions, it all started making sense.

Now, I don’t want to get any deeper into how they pulled this off, than what I’ve already revealed, because I like keeping a few nukes handy, in case somebody wants to make this into a big deal. They want to go there, I can REALLY make this a big deal.

If you want to know more details than that, just read this earlier post I wrote about the topic.


Déjà Woo

This post is rather long, and it ultimately leads to VALIDATE what Q said about MK. And beyond. WAY beyond. I’m choosing to spill enough now that no matter what happens, or what happens to me, they will no longer be able to keep using MK for murders and getting away clean. People will SPOT …


Now, let me be clear – I’m not saying that all Affirmative Action students can’t handle the rigor of the universities they are pumped into, over more qualified students. But we are lying to ourselves to think that there is no downside to lowering standards of admission. I encountered that downside in the very first Affirmative Action student to come through our department’s classes.

An interesting debate on the topic is this one, which involves Michelle Obama. She was, if I’m dating things properly, admitted in the second year of Affirmative Action.

In my opinion, both sides arguing in the linked article are “right and wrong” about things. There were definitely VERY FEW Affirmative Action students in the first year, and not that many in the second year, if I remember things correctly. Bear in mind – not all black students were Affirmative Action cases. Eventually, though, the effect on the student population was very noticeable. The timing, IMO, isn’t all that important.

Nevertheless, I would not be surprised if Michelle Obama really felt isolated on campus, despite likely being among perhaps a few hundred other AA-admitted students.

But much of what the rabbi is saying is quite right. Students who are not qualified to enter these schools were being prioritized over students who were qualified, due to race, and it was eventually a very big deal, that caused a LOT of problems.


So what’s the point, in the end? We know the Deep State does what it wants. They make their money in the name of some good thing that they inevitably lie about and FAKE.

The Deep State can and will roll over anybody that they need to roll over. We’ve seen what they did to Trump.

But yet, all that is not what matters.

Thanks to all this stuff, I found God. I mean, not like I did when I was a kid. I mean deeply, and in a big way, and as an adult.

It’s DIFFERENT when you walk through the Valley of the Shadow of Death, and you LEARN the hard way that GOD is your only real ally. And it’s not just magic, or the belief in magic, but the reality of how one deals with the universe, and how the universe deals back. God is a very “complex” thing, with both “real” and “imaginary” components. I am grateful for ending up with the understanding that I eventually got.

I lost a lot of things IN THIS WORLD, but in many ways that was purifying. I was stripped of much corruption and my worldly idols, and was left with GOD and the best teacher of all, the LORD JESUS CHRIST, the carpenter who dared to speak truth in a world of lies.

Affirmative Action was a noble cause, for those who believed in its truth, just as the response to 9/11 was a noble cause, for those who believed in its truth.

The problem is, neither one was completely true. Affirmative Action was never meant to be a logical reality. It was Hollywood. It was a story. It was Potemkin. It was fake. It was a societal version of “fake it until you make it”. They had no intention of doing it right.

I still believe in the “ends” of Affirmative Action – that Martin Luther King, Jr.’s dream can and will be achieved. But that end will NOT be achieved through these means – through deception and lies. It can only be achieved through truths. Sometimes those truths will be painful. Sometimes they will be joyous. But in the end, they will be part of the story – the TRUE story – that makes America great.

God bless you, and thank you for listening.

W


Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President:

AND our beautiful REALFLOTUS.


This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both).

And yes, it’s Monday…again.

But we WILL get through it!!!

With a little help from our “friends in high places”!

Oh, yeah – we’re headed back to the WHITE HOUSE!

HANG ON for the ride of your life!


Dedication

Image: https://i.pinimg.com/originals/d5/e5/ad/d5e5ad861f1fc08b93a6d511ed5ff19f.jpg

WHEATIE – OUR WARRIOR ANGEL

by Duchess01


Please forgive us, Wheatie, we did not know
That you had left us with armor in tow
We had no idea with what you dealt
We did not know the pain you felt
And now we can only imagine
With you what really did happen
Cause rarely did you complain 
And/or share your personal pain
Of one thing we are most certain
You are flying high behind the curtain
Watching over us above the crowds
Our Warrior Angel above the clouds
Thank You, Wheatie, for caring for us
While you were here among the fuss
We miss you dear you have no idea
Since time began in the pangaea
With you there was no time
In your wisdom you would chime
To clarify and magnify
The what where how and why
We did not question when you left
We were not slightly bereft
But over time we wondered why
You did not at least stop by
Now we know where you have gone
With the break of this new dawn
We could be angry but are not
Tho with an arrow we’ve been shot
Rest peacefully Warrior Angel dear
Send us a sign that you are near
A butterfly a flower a kiss of rain
From your love do not refrain
God sends Angels to watch over us
And now we have an Angel Plus
A Warrior Angel of Magnificence
From today and forward hence

LINK: https://www.theqtree.com/2019/05/23/the-poetry-tree/comment-page-2/#comment-917655

Our heroine in high definition!


The Rules

TL;DR –

Wheatie’s Rules:

  1. No food fights.
  2. No running with scissors.
  3. If you bring snacks, bring enough for everyone.

Boilerplate, more or less, but worth reading again and again, if only for the minor changes, and to stay out of moderation.


MINOR CHANGE NUMBER 1

Never talk about committing violence in a reply to Wolf or in response to anything Wolf has said, or you may get put into moderation so that your comments can be screened. This is ONLY because DHS is now playing door-knock Gestapo with people who have spoken at school board meetings, made public comments, etc. DHS regime jackboots are knocking on doors of school board mama bears and stupidly insinuating potential violence from things people say or don’t say on social media. A guy in Ohio pointed his FINGER at the school board, and they went after him, armed with pictures of the pointing, and screen captures of online comments. Yeah.

SO – give the Nazis ZERO ammo. Keep any mention of violence, even joking, away from Wolf, so that he doesn’t have to “explain” humor to humorless jackboots who pretend not to know things.

As for discussion of “violent humor” among yourselves (e.g., “#TeamHeadsOnPikes”), just use whatever discretion you think is appropriate for yourselves. I will only put you in moderation if your comments create problems for ME or THIS SITE, but not if they only impact you.

YOU are responsible for your own comments, if they come knocking. YOUR choice. Just remember this…..

OTHER THAN THAT…….


The bottom line is Free Speech. Theories and ideas you don’t agree with must be WELCOME here, and you must be part of that welcoming. But you do NOT need to be part of any agreement.

Bottom line – respect other people’s FIRST AMENDMENT RIGHTS.

Our only additional requirement is that you do so NICELY. Or at least try to make some effort in that direction.

SO….. [ENGAGE BOILERPLATE…..]

We must endeavor to persevere to love our frenemies – even here.

Those who cannot deal with this easy requirement will be forced to jump the hoops of moderation, so that specific comments impugning other posters and violating the minimal rules can be sorted out and tossed in the trash.

In Wheatie’s words, “We’re on the same side here so let’s not engage in friendly fire.”

That includes the life skill of just ignoring certain other posters.

We do have a site – The U Tree – where civility is not a requirement. Interestingly, people don’t really go there much. Nevertheless, if you find yourself in an “argument” that can’t really stay civil, please feel free to “take it to the U Tree”. The U Tree is also a good place to report any technical difficulties, if you’re unable to report them here. Please post your comment there on one of Wolf’s posts, or in reply to one of Wolf’s comments, to make sure he sees it (though it may take a few hours).

We also have a backup site, called The Q Tree as well, which is really The Q Tree 579486807. You might call it “Second Tree”. The URL for that site is https://theqtree579486807.wordpress.com/. If this site (theqtree.com) ever goes down, please reassemble at the Second Tree.

If the Second Tree goes down, please go to The U Tree, or to our Gab Group, which is located at https://gab.com/groups/4178.

We also have some “old rules” and important guidelines, outlined here, in a very early post, on our first New Year’s Day, in 2019. The main point is not to make violent threats against people, which then have to be taken seriously by law enforcement, and which can be used as a PRETEXT by enemies of this site.

In the words of Wheatie, “Let’s not give the odious Internet Censors a reason to shut down this precious haven that Wolf has created for us.”


A Moment of Prayer

Our policy on extreme religious freedom on this site is discussed HERE. Please feel free to pray and praise God anytime and anywhere.

Thus, please pray for our real President, the one who actually won the election.

You may also pray for our nation, our world, and even our enemies.

A bit of a paraphrase, I’ll admit, but it makes a few key points!


Musical Interlude

In honor of dear Wheatie, we now present some music to soothe, inspire, invigorate, or relax.

Here is Wheatie’s selection from just over 2 years ago!

“For your listening enjoyment, I offer this uplifting composition from Andreas Kübler of Really Slow Motion, titled ‘Save Me’:”

Wheatietoo

LINK: https://www.theqtree.com/2021/01/25/20210125-joe-biden-didnt-win-daily-open-thread/


Call To Battle

Our beloved country is under Occupation by hostile forces.

Daily outrage and epic phuckery abound.

We can give in to despair…or we can be defiant and fight back in any way that we can.

Joe Biden didn’t win.

And we will keep saying Joe Biden didn’t win until we get His Fraudulency out of our White House.


Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

This is the weirdest set of “data joins” in my history of researching things, but it is all starting to make sense – so I’m going to invite you into the story.

The story starts recently, when this tweet appeared in my timeline:

Weirdly, I cannot find this tweet in context in Elena’s tweets or replies on Twitter. If you check out her Twitter, she is a solid retweeter of a lot of great stuff – but I have no clue where she found this.

Anyway, after I saw it, it led to THIS post:


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


If you have not read that, please at least read a bit of it, including the “TL;DR” part, so that you can make sense of the rest of THIS post.

I did some posting about this yesterday on Twitter. Surprisingly there was no traction. This thread still has barely over 100 views on the first tweet.

I moved from the normal posting strategy, to “replying to the bigs”. Same problem – no traction.

It’s even worse today. All day I have been trying to get people to pay attention to this, and my Tweets go nowhere. However, a few examples will show you the core message, almost better than a TL;DR would.

I dumped an entire thread on a long response to ChiefNerd…..

I started replying about this stuff everywhere!

I found ONE other person tweeting about the paper – and he had almost zero engagement. And I only found the guy because I searched on the special sequence, PRRARSV.

Eventually, I even tried “mystery” to get engagement, and to get past any censorship.

No dice.

Anyway, later, THIS happened with Aubergine, from my earlier speculation about a Codemonkey Tweet.

LONG THREAD.


SO – anyway – I started a thread on Twitter…..


[We will see where this goes today. I will add more thoughts as we go on. Publishing now, for the midnight unofficial deadline….]



Wolfie’s Wheatie’s Word of the Day Year Week:


translocation

noun

  • a change of location.
  • a transfer of a chromosomal segment to a new position, especially on a nonhomologous chromosome. Also called chromosomal translocation.
  • a chromosomal segment that is translocated.

Sub-types:

  • chromosomal translocation: see above.
  • reciprocal translocation: balanced, 2-way exchanges of material between chromosomes.
  • non-reciprocal translocation: unbalanced, one-way movement between chromosomes.
  • Robertsonian translocation: a special type of chromosome rearrangement merging long arms of a chromosome and eliminating the short arms.
  • nuclear translocation: movement of genetic material into or out of the cell nucleus.

Used in an Abstract:

Although the S [spike] protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.

Shown in an Image:

Figure 4. Colocalization between S mRNA and S protein inside infected cells. The images (see Figure 3) were analyzed by using the surface rendering and colocalization features of IMARIS. S protein and S mRNA distribution and colocalization in the cytoplasm (top panel), on the nuclear surface (middle panel) and inside the nucleus (bottom panel). The specific region of colocalization is indicated by a white spot. Scale bar 0.5 μm.

ENJOY THE SHOW

Have another great week!

W

The Ongoing January Sixth MKULTRA Experiment on Patriots

I just realized something horrible, which makes it even more imperative that we either get our American prisoners out of DC Gitmo, or ask our military to bomb a certain building conducting inhumane experiments on American prisoners of war.

The House, now under Patriotic American control, needs to stop pussyfooting around. The fastest way to make the evil communist DOJ give up its hold on our patriotic Americans, is to make their friends in CIA sweat for what it is doing to our fellow Americans. The CIA hates exposure, so it’s time to expose.

I am absolutely convinced of the following.

Part of the reason patriots are being slow-walked in DC Gitmo, is so that they can be experimented on by the CIA.


First, some background on CIA human experimentation.

You may or may not be familiar with a documentary which the CIA absolutely HATES, called “The Minds of Men“, by an outfit called Truthstream Media, otherwise known as a couple of filmmakers named Aaron and Melissa Dykes.

This documentary explains, very calmly and rationally, an important PART of the broad and comprehensive research program called MKULTRA. In particular, it discusses the secret history of CIA human experimentation on American mental patients, fronted through a bunch of ingenious American university scientists, who never got Nobel prizes, because their important but shocking work was basically kept on the down low by the CIA and the elite who funded it. This was all very typical of how scientists are ABUSED by politicians, corporations, spies, and “higher powers” (i.e., rich elites, secret organizations, etc.).

The Minds of Men makes all the connections, all the way back to the elite, and it will blow your minds.

Unless things have changed recently, you cannot get this DVD on Amazon, because Amazon is Bezos, and Bezos clicks his heels to CIA orders.

You have to get the documentary mailed directly from Truthstream. In any case, it’s very eye-opening. The CIA has deep ties to American university research, and the whole “CIA recruiting on campus” fake controversy is basically a kind of cover, assisted by dupey communist agitators, who likely have no clue that the CIA which helps run communism in America, is already deep in the universities, and has been from the beginning.

Anyway, today, our friend Aubergine posted a new video by Truthstream, which is this:

If you watch this, you will get a sense of Truthstream’s style, which is very patient and visually reinforcing, so that their message really embeds. It’s worth skimming the above, if you’ve never seen The Minds of Men. That documentary is very much in the same style.

This video is great, of course, and if you watch it, you will realize that it’s extraordinarily “meta” and ironic in regards to this very post. However, that’s tangential to my point.

Aubergine pointed out the new video’s discussion of the Stanford Prison Experiment, in which pretend prison guards abused pretend prisoners. You should already be getting some vibes here.

Gail Combs responded, first quoting Aubergine:

“…it was a real social experiment in which some college students were assigned to play guards while others were to be prisoners. It is most notable for the fact that although it was supposed to last two weeks, it had to be terminated after only six days because the “mistreatment of prisoners escalated so alarmingly.””…”

and then making this connection to January Sixth:

Think of the Jan 6th Political prisoner where the guards KNOW there will be NO REPERCUSSIONS FOR THEIR BEHAVIOR… -Gail Combs

That is when I realized suddenly what is going on.

https://tv.gab.com/channel/trump_won_2020_twice/embed/a-secretly-recorded-video-is-leaked-628e6947996a4c915e8a1998/preview

All of the January Sixth prisoners have reported maltreatment at the hands of guards, appalling living conditions, isolation, and other forms of abuse.

However, SOME of the prisoners have also reported on the PROPAGANDA to which they are being subjected. And I’m not just talking about being forced to watch only CNN, or having been given leftist “defenders” who try to talk them into parroting DOJ propaganda to get out.

In particular, after much initial isolation from the world, they are then given very “read-only” tablets, which are loaded with typical “donkey com” propaganda – pro-left, pro-Islam, anti-Christian, etc., etc.

They don’t get to choose what information they get. They only get REGIME INFORMATION. And when it’s interactive, like these tablets, it has to be like Facebook on steroids.

This was immediately clear to me as CIA experimentation. Let me explain why.


The CIA didn’t just experiment surgically on mental patients, using university scientists. They did a LOT of experimentation on prisoners – both Americans and foreigners. How do I know this?

By reading this book:

This book is what is known as a “limited hangout” by CIA. It’s actually very easy to tell what they’re hiding and what they’re not, by reading it, if you go in with the idea that the CIA actually HELPED this book get written.

The basic idea of the MKULTRA hearings back in the 1970s, was to make people think that the project was an old, discredited, FAILURE. Lots of shiny objects in the way of nasty and seemingly pointless experiments, drugs, sex, and mistreatment of CIA personnel BY other CIA personnel were provided.

This is how the CIA closes out a successful project, and makes the success “disappear”.

Kinzer’s book is just more of the same, updated for what has already leaked out or been figured out, since the MKULTRA hearings. New scandalous clickbait information in the same directions, plus a few harmless new angles, help to make it look like:

  • MKULTRA was an abject failure
  • benzodiazepines and modern super-opioids never existed
  • drugged hypnosis and “brainwashing” never worked
  • everything CIA worked on was stupid, bizarre, and “paranormal”
  • Sidney Gottlieb didn’t know what he was doing, and just messed around
  • there was no real plan to MKULTRA
  • there was no successor to MKULTRA
  • the experimentation was mostly on captured foreign spies
  • the experimentation on American prisoners was just stupid LSD trips

Very typical limited hangout. Deny, deny, deny all the successes.

The reality is that Sidney Gottlieb was an excellent top-level researcher, much in the same vein as Oppenheimer, and when tasked with a formidable technical challenge, approached it from all the best logical angles.

The successes of MKULTRA were substantial

  • brainwashing techniques on par with the Soviets and Chinese
  • expertise in drugged hypnotic debriefing and programming
  • ability to suppress conscious memories
  • ability to implant false memories
  • ability to program mental patients to commit crimes
  • strong understanding of human brain electromagnetics
  • strong understanding of psychology, memory, altered states

If you prowl around on this site, searching in the search widget on MKULTRA and similar, you will find much information about those successes, including my personal experiences with the technology, shortly AFTER it was declared “case closed” in the late 1970s. The drugs most likely used are NEVER mentioned in the Kinzer book. Kinzer is New York Times. Yeah he had great contacts – and they either used the hell out of him, or he’s part of their game. I don’t really care which, or need to know.

So how does this fit in with January Sixth?


The Kinzer book does not mention the shocking brain surgical experimentation on American civilians discussed in The Minds of Men, but it does talk about drug experiments on:

  • captured foreign spies during the early cold war
  • Whitey Bulger and other American criminal prisoners

This is why I’m very confident that we’re seeing experimentation on Trump supporters in DC Gitmo. What kind of experimentation do I suspect?

  • typical social stuff – study of resistance to isolation, maltreatment, reward/punishment
  • searching for “John McCains” who are amenable to “reform” / brainwashing
  • drugged hypnotic interviews while sleeping (see my own experience here)
  • social media psychological experimentation (Facebook stuff) using the “tablets”

I suspect that the “American Soviets” who run DOJ and CIA are very busy studying these captured patriots, trying to figure out how to turn them into good socialists.

DC Gitmo = Hanoi Hilton

I suspect that if DC gulag prisoners are given this knowledge, they will be able to think back and realize exactly how they were experimented on by their communist keepers.

Congress, or course, can demand information, but expect that if they are given anything, it will just be limited hangouts.

Nevertheless, it should be interesting to hear from the J6 prisoners themselves, what was done to them, once they realize that they were being experimented on by communists.

W

PS – the CIA is always dumping massive amounts of CHAFF on MKULTRA, to cover up the reality. Don’t believe everything you hear about it – especially the stuff that seems “too attractively controversial”. Shiny objects, IMO. I will discuss that, shortly.

No New Bioweapon Under The Sun

OK – we’re going to have some fun here – but stick with me, and you could learn A LOT.

Cue the music! Borrowed from Wheatie!

Previous posts helped put both the SPIKE PROTEIN DISEASE and the SPIKE PROTEIN VACCINE into deep perspective.

We were seeing that the SOLUTION was a significant part of the PROBLEM, and that CDC was engaged in LYING, BLAME-SHIFTING, and HIDDEN AGENDAS.

And now the SCIENCE is coming out, and we were RIGHT.

We’re WINNING.

Another post discussed how – for whatever reasons are quietly embedded upon the length of the full spike protein and fragments thereof, chimeric or not – we are also now cursed with what appears to be, to some [currently socially tolerable] extent, an abortion virus and abortion vaccines.

Trust me – THAT is a trumpet that BRINGS DOWN WALLS.

We may even have a scientifically sound explanation for the craziest reports of vaccine side effects in the close but unvaccinated – namely, hormonal activities that are operating at the low microgram level.

Oxytocin – abortion dose = 10-30 IU = 16-50 mcg


Let me explain how that works. Think “DUST”.

I can tell you all about the potency of carfentanil. ONE BREATH of inhaled dust containing a tiny amount of it knocked me out like a roundhouse to the left jaw. If that ENTIRE DUST had been carfentanil, I would have been DEAD. But there was a fraction – a tiny fraction – of that tiny grain you see right there, that got into my lungs, riding on OTHER DUST, and I was OUT LIKE A LIGHT.

NOW you understand the POWER of the spike protein.

Yes, there is SO MUCH that they HIDE FROM US to maintain POWER OVER US.

However, now I want to put ALL of this virology technology into DEEP PERSPECTIVE.

“Black goo” biological agent in the movie Prometheus, part of the “Alien” franchise.

What I am going to tell you is almost certain to shock you – both about the disease and about the vaccine. It shocked me. That’s why I figured I had to explain this to people.

And what’s even WEIRDER – this is not totally about the disease or the vaccines, but also about their CONTEXT, which forces you to SEE them both differently and more CLEARLY.

A while back, I was just browsing the “edutainment” about viruses on the internet, when I was led down an interesting rabbit hole of viruses in entomology. You know – INSECTS. I read something on Wikipedia which bothered me, so I set it aside. It all seemed FAR too familiar. It surely impacted all this crap we’re going through now – I just wasn’t sure how. Later I came back and read it again.

Now, I understand. It’s actually rather beautiful. But – well – it’s interesting.

The greatest point being – THERE IS NOTHING NEW UNDER THE SUN.

The great irony of the idea “nothing new under the sun” is the self-referential part – the idea that EVEN this little bit of wisdom is with certainty not even attributable to its first alleged “author”, who HIMSELF surely understood the great irony of his saying it, and that others might attribute it to him, someday.

Nothing new under the sun. This bit of Solomonian passed-on wisdom about the curation rather than creation of wisdom is far truer than I realized. Let’s EXPAND just a bit.

The idea that this universe is as old as it appears to be, and that in all that time, Einstein was the first person (using the term rather broadly) to discover the logic of how speed actually works, strikes me as a violation of Solomon’s logic about “first discovery” being rare as hen’s teeth.

Likewise, Solomon’s logic goes further and tells me that “hen’s teeth” undoubtedly happened a lot more often than, when in its earthly rarity, it happened “here and almost now”, but seemingly only roughly once.

Rarity being somewhat relative, with distance providing a deceptive but effective cover for number and frequency, all of them together being a control of wisdom over knowledge.

Yet even these seeming corollaries of the idea of “nothing new under the sun” are just repeats of the idea with some frill on the edges enlightened for our benefit.

“…it is curiosity that gives meaning and savour to life.”

LIFE. Seems to be part of the design. No?

Have I BOTHERED you yet?

Maybe even a bit of trepidation – or even FEAR?

Good. THAT has happened before. “Nothing new under the sun.”

You can never go wrong with Solomon.



The Last Time Gene Therapy Was Reinvented

I keep trying to tell people – DNA is very smart. We are slowly learning how to talk to it. Sometimes we actually listen. Sometimes we even plagiarize.

DNA bargains and wheedles its way into the future, changing in whatever ways it has to, to keep itself alive. It gains as much vision of the future and the past that it can, using proteins, to persist as well as it can.

Think of it this way. DNA fights and feuds with DNA, but who wins in the end?

DNA.

NOTHING that these foolish young humans are trying to do with their coronaviruses, their “vaccines”, and their “gene therapy” is new to DNA. DNA came up with ALL of this stuff – AGAIN – at least 100 million years ago. THAT was its destiny. Ironically repeating like its own form.

I am absolutely serious. The technology of EVERY one of our wonderful new coronavirus vaccines (or “injections” or “gene therapies”, if you prefer) was RE-invented by DNA approximately 70-100 million years ago on this planet, and is still around.

ONE example of a prior reinvention of gene therapy resides in a tiny biological war-game where THREE organisms cut a deal that keeps them all alive. I will point out all of the “original versions” to you, and you will see where human science basically plagiarized.

One of the three organisms is an insect – a kind of wasp – that gravitated into using a living host for reliable reproduction. The second is a voracious plant-predatory host insect – a caterpillar – that needs a dependent predator to keep its numbers in steady balance, because it won’t do it itself. The third is a virus that found a way to survive by helping insure that the host-guest “life transfer” process always succeeded, so that it, too, would survive.

DNA uses ALL OF THEM to optimally persist.

The key to understanding all of this, is a kind of virus called a “polydnavirus”. I personally like to pronounce that “Poe-LID-na-virus”, even though that is wrong. They’re actually supposed to be called “Polly-D-N-A-virus”. My advice is pick whatever you like – you’re probably never going to have to say the word publicly – and on the internet, your canine pronunciation is always perfect.

Or just call them PDVs.

Wikipedia’s entry for them is an excellent place to start.

LINK: https://en.wikipedia.org/wiki/Polydnavirus

ARCHIVE: https://archive.fo/YHP7V

The bottom line is very simple. The wasp lays its eggs INSIDE a caterpillar by injection. However, instead of injecting a mere venom along with the egg – a kind of chemical weapon – the wasp injects a venom containing a VIRUS – a biological weapon. The virus provides biological effects like immune suppression that HELP the wasp egg survive, hatch, and grow. This is much more efficient than merely injecting, say, immunosuppressive proteins in the venom. The immune suppression by the virus prevents immune response by caterpillar cells known as hemocytes.

All of that is shown in the following graphic.

Here is one of the first really fascinating aspects of these polydnaviruses. When they are in the wasp, they are actually PART of the wasp genome. That’s right. They’re IN THE WASP’S CHROMOSOMES. The virus is now PART of the wasp’s genetics. One could even view it as the wasp sending PART OF ITS OWN GENES into the host, to make sure that the egg survives.

When the virus is still inside the wasp, it only comes out of the genes and reproduces in one place, in FEMALE wasps, near where the eggs are formed. It doesn’t harm the wasp, because DNA is NOT stupid. Viral DNA learned – the hard way – don’t shoot the pilot. Just stay in your seat until it’s time to debark. Wasp DNA learned – the hard way – let the jihadists sleep until we get to the airport we want them to shoot up. All of it mediated through the most annoying code in the world, with zero comments and nearly inscrutable, almost accidental language.

You remember those “well, it works” phone calls, coders. “I don’t know. Try this.”

Now – the next point is even cooler – because it’s the exact same strategy as the coronavirus vaccines that use viral vectors (e.g., Johnson+Johnson, Oxford/AstraZeneca, Sputnik V).

The infection does not lead to replication of new viruses, rather it affects the caterpillar’s immune system, as the virion carries virulence genes instead of viral replication genes.[4] They can be considered a type of viral vectors.[5]

Wikipedia, https://en.wikipedia.org/wiki/Polydnavirus#Biology

The virus particles that are sent into the caterpillar are NOT reproductive – they are merely infective. They don’t code for creation of new virus, which might reproduce exponentially and kill the host or use up too many resources. Instead, the infective non-reproductive virus particles – just like the coronavirus vaccines – give a nice, predictable amount of expression of new proteins, useful for the wasp eggs and larvae to prosper. The virus basically CONSERVES caterpillar so that it has a ticket and a ride OUT of the dead caterpillar when it’s all over.

That’s the EXACT same strategy as our mRNA and DNA vaccines. Don’t crank out too much spike protein, by cranking out any new virus, and thereby kill the host. The main point is SAVING the host. The point may also be STERILIZING the host, to some extent, because THAT protein effect is beneficial to the injecting parasites known as the Democrat Party, globalist banks, and China. And probably more than one type of pencilneck. But they do want us to live – at least for some time, it would appear.

But seriously – the wasp polydnavirus immunosuppression strategy IS the human adenovirus vaccination strategy.

The only difference is what the proteins that are created DO. In the caterpillar, they suppress the immune system response to the egg or larva. In humans, the one protein stimulates antibodies to itself, and possibly does other things which are intended or not.

So you may be wondering how the virus gets from parent wasp to child wasp if the virus that is sent into the caterpillar host is not reproductive. AHA. It is because the virus is tucked into the GENOME of the baby wasp, safe and sound, for a ride into the future. The virus genome is essentially protected by the wasp.

LINK: https://www.microbiologyresearch.org/content/journal/jgv/10.1099/0022-1317-77-11-2873

Thus, you can see how genetic incorporation of the VIRUS benefits BOTH the wasp and the virus – and even – in a weird way – the caterpillar. The wasp gets to control the genetics and expression of the virus, so that they don’t cause the wasp too much trouble, but instead yield maximum benefit. The virus can then be more effective at its now exclusively delegated task of immune suppression in the caterpillar, by relinquishing reproduction to the wasp. Division of labor creates a great mutual dependency, but it also creates a strong contract.

One could say that genetic incorporation is a STRONGER CONTRACT between the virus and the wasp.

Just like genetic incorporation of COVID-19 spike protein could be a STRONGER CONTRACT of reduced human fertility.

But how does the caterpillar benefit?

The caterpillar is not going to live on as THAT particular caterpillar, but THAT particular baby caterpillar-culling wasp will live on in an assured 1:1 trade-off, and the REST of the caterpillars which benefit by the current culling will also live on as a stable population. The C-W-V balance is maintained BETTER by seeking a more stable chaotic resonance, without the wild swings of boom and bust, if wasp reproduction and population can be more closely tied to the caterpillar population, and they all live into the future without wild swings in numbers.

Another way to view it from the caterpillar perspective, is that viral efficiency minimizes the number of sacrificial caterpillars needed to keep the necessary number of wasps alive.

Now – we’ve seen viral vector vaccines analogous to the non-reproductive but infective polydnavirus virus particles – those would be the Johnson-+Johnson, AstraZeneca, and Sputnik V vaccines, which use adenoviral vectors for non-reproducing, protein-creating, virus DNA. But what about the Pfizer and Moderna vaccines?

Well, it turns out that these {{{wasps + viruses}}} invented ANOTHER way to get DNA or RNA into the caterpillar host – those are called VLP, for “virus-like particles”. There is a lot of range and variability here, just as there is in non-viral-vector vaccine technology. So in the same way that the Pfizer, Moderna and Inovio vaccines use proprietary “virus-like lipid droplet nanotechnology” to get their mRNA or DNA into human cells and thus cranking out spike protein, wasp/virus DNA can also use a strategy of “virus-like particles” that don’t even mimic non-working viruses, and STILL get their effective DNA transferred to the caterpillar, to effect the desired expression of needed wasp/virus proteins in the caterpillar.

Now – that is not to say that PDV (polydnaviruses) and VLP (virus-like particles) are the only tricks up the ovipositors of these parasitic wasps. It turns out that – in addition to these well-described DNA viruses, there are also apparently RNA viruses which ride along with wasp eggs during injection. So YES – both DNA and RNA “vaccines” are part of the wasp injections. And YES – there can be genetic incorporation in the caterpillar cells – for their short lifespan – just as there is already genetic incorporation, long-term, in the wasps.

Remember – who wins? DNA WINS. The HOUSE always wins.

But don’t forget Novavax! It may just be protein, but protein shills for DNA!

Not only are the Novavax “pseudo-viral protein-based nanoparticles” already examples of virus-like particles – they are matched by protein-based components of the wasp venom, both free-floating or otherwise. Indeed, one cannot read about the virus-like spiked particles in this wasp venom and not think that Novavax design is pretty much the same thing.

NOW – this is all a LOT to unpack. Not just that, but my “dumbing it down” probably made it just plain dumber. To correct that, I’m going to let the experts FIX THINGS UP.

The field of polydnaviruses in insects is NOT a huge field. It’s actually rather obscure, despite the phenomenal importance we are witnessing now. Just as the media can help those in power hype and control a field like climate science, or literally HIDE certain other fields like [[[ COUGH ]]], they can obscure still other fields which radically affect you, by hiding them pretty much in plain sight.

There is a BOOK that reviews the field, however, which is EXTREMELY helpful.

You can download parts of this book, and that includes TWO parts which are more than enough for a reasonably smart normal person to see the CONTEXT EXPLAINED.

Let me get ONE of those parts out of the way because you’re not going to be interested in this, unless you’re ready to get VERY nerdy on the history of science. But I am including it because it is AMAZING STUFF. You might view this as “The history of the science of the rediscovery of all the evolutionarily discovered technology used in the “vaccines” or “shots” or “gene therapy” of the coronavirus genetic injections”. It’s a beautiful window into HOW SCIENCE WORKS.

Foreword – The Discovery of Polydnaviruses and the Influence of Dr. George Salt

You can download a PDF of this at the linked page.

Now – if you read that – you will get a LOT, including a window into the slow and painful nature of research, but it’s a bit difficult to extract the good stuff if you’re not used to reading scientific review literature.

In contrast, the PREFACE of the book is MUCH easier to read, and it puts ALL this stuff in context that normal humans who are not experts in polydnaviruses can understand.

Preface – Parasitoid Viruses – Symbionts and Pathogens

I highly encourage you to read the full preface at the linked page. But what I’m going to do here is simply pull out all kinds of juicy quotes – which is damn near the whole thing. [ My comments ] and identified WOW sequences will be in bold.

Here we go – this is all quoting:


Among parasitoid viruses, the fascinating models of polydnaviruses (PDVs) were discovered in the 1970s and the new field of polydnavirology was thus opened.

This field has been moving very fast since the beginning of the century thanks to the use of genomic approaches and rapid expansion of accessible databases on insect and viral gene sequences.

Parasitoid and viral genomic studies have confirmed that PDVs are functionally gene transfer agents used by parasitoid wasps to manipulate the physiology of their parasitized lepidopteran hosts by introducing modified versions of their own genes into host cells.

In the case of PDVs from braconid wasps, this kind of gene therapy (detrimental for the patient, which is in this case the lepidopteran host!) originated from the integration of a virus genome in a wasp genome ca. 100 million years ago. [LOL – I just noticed this “being impressed by the date” part – looks like we BOTH realized this independently. -Wolf]

This virus has been modified to incorporate wasp genes instead of its own viral genome in the nucleocapsids inside the viral particles. [Minor beef here – ownership and original genetic penmanship on the payload could be more “virus” and less “wasp” – interesting problem.]

Such use of viruses as vectors has been selected several times independently during the evolution of parasitoid wasps. [There it is. VIRAL VECTORS. Invented by DNA.]

The PDVs associated with braconid and ichneumonid wasps (Campopleginae subfamily) are unrelated as judged from the machinery producing the particles, and they represent an example of convergent evolution with different viral origins.

A third association event is suspected to have occurred in the Banchinae subfamily of ichneumonid wasps. In essence, the parasitoids have ‘captured’ viral elements that have evolved a host regulatory role that benefits the parasitoid to facilitate successful parasitism. [This is more “archaeopteryx” on the payload being of viral origin.]

Other associations with viruses or virus-like particles might have evolved with different organisms but they have not been unraveled yet, and parasitic amoebae that have associations with mammalian viruses are just one example. [“Lots of room at the bottom.”]

Many insects have evolved associations with a large number of species of bacteria such as Wolbachia and associations with viruses have been less well studied to date compared to bacterial symbionts.

A number of different viruses are found in the genital tract of the parasitoid wasps and conceivably they could be transferred to female wasps by behavioral traits, such as host feeding, initiated following ovipositor puncture of the surface of the integument.

Host feeding may thus be an advantageous behavior for viruses which facilitates their spread within insect populations and this intimate association with viruses might have favored interactions leading in some cases to integration of viral sequences into the wasp genome, although most of the wasps described in this book are no longer host feeders.

These viruses include RNA viruses of insect parasitoids and most of them appear nonpathogenic. Could these likewise have evolved a symbiotic relationship with their host? Future research may reveal such an intimate relationship with the wasp host carrying them but, currently, we have little information about their functional role as symbionts or pathogens in the virus–wasp–insect host relationship. [This was in 2012 – the situation could be different now.]

While the study of polydnaviruses was initially inspired by the pioneering studies of George Salt and Susan Rotheram at Cambridge University, more recent studies of Venturia (formerly Nemeritis) canescens particles (the virus-like agent studied by George Salt) by Otto Schmidt and Sassan Asgari documented that these virus-like virions lack both DNA and RNA; the particles are comprised of proteins encoded by parasitoid genes. [This is basically virus-like particle nanotechnology akin to the Novavax vaccine.]

The multiplicity of different molecular forms seen in these viruses and virus-like particles is truly amazing but, compared to polydnaviruses, we have less information about the biology of virus-like particles and how they function. [There is clearly an infinitude of possibility here – clearly WHY the push for gene therapy.]

Finally, not all parasitoid species are associated with viruses and most in this category have to rely on virulence factors produced by their ovaries and venom glands instead of using the host to produce them like for PDV-encoded gene products. [Translation – most of the wasps use plain old venom.]

PDV-associated species also produce venom that was shown in some cases to synergize the effect of the virus. [Combination biological and chemical weaponry.]

New sequencing approaches are more comprehensive and will thus allow comparisons of the arsenal of proteins used in different species, which will enhance our understanding of the dynamics of evolution of parasitoid virulence strategies. [Big data will allow spying on the past to happen even faster.]

Ectoparasitic wasps have not been examined yet for the presence of viral symbionts, and appear to have exploited venoms as a source of host regulatory molecules instead. Comparative studies on paralyzing versus nonparalytic venoms are lacking, and screening ectoparasitic species for viral elements should also be a future research priority. [Translation: there’s more to learn from regular stinging / paralyzing wasps.]

In addition to enhancing our knowledge of parasitoid strategies and increasing our understanding of the importance of symbiotic relationships in species evolution, parasitoid viruses and venoms may constitute a source of new molecules to control insect pests. This might be a revolutionary outcome of research on PDVs and other parasitoid viruses, since the safety of many chemical pesticides with respect to their detrimental impacts on human health and key species in the environment such as bees and other beneficial insects, is questioned. [You think proteins are going to be safer? HA! Get ready for new problems.] We anticipate that harvesting biopesticidal molecules from parasitoid venoms will likewise prove fruitful. [Translation: All this human wasp techno coronavirus lying crap is headed to agriculture, and presumably already there. Yeah.]

Finally, we hope that this book will satisfy the reader by presenting an overview of the most recent findings on all these topics presented by an international assemblage of authors. [You can say that again!]

In addition, we aim to inspire many future researchers to choose polydnavirology or studies of other parasitoid viruses or viral-like elements and venoms as their focus field. [You’ve inspired me, even though it’s a bit late for me to enroll in one more Marxist university.]


That’s it.

I tell you – this whole thing was a revelation. Suddenly, everything these people in Big Pharma have been doing has been HUMBLED BY GOD, using BUGS. LOL! Pretty amazing.

And being humbled, all of us, the TRUTH now becomes clear.

Now – if all this seems a bit scary, but you’re thinking “Hey, this isn’t exactly like our case, in which Democrats mind-fracked their victims with an RNA virus” – well, HOLD YOUR BEERS. With God – IRONICALLY – all things are possible.

Yes, this, too – baffling the victim with an RNA virus – was borrowed from nature, although I am being just a wee bit facetious, since it was done much more intelligently and much more socially against a more intelligent and social species.


The Case of the Shanghaied Babysitter

Yeah, I’ll try to keep this one shorter, but I don’t really have to go back TOO MUCH to the original literature here.

Here is where I FOUND this case originally. An article that was COPIED onto a forum.

Parasitic wasp uses virus to control its host

LINK: https://forums.spacebattles.com/threads/parasitic-wasp-uses-virus-to-control-its-host.332664/

The links back to this forum article are ALL bad, but I was able to google for correct ones. Here is the article in Discover Magazine:

Biological Warfare: Parasitic Wasp Uses A Virus To Control Its Host

Science Sushi By Christie Wilcox Feb 11, 2015 2:36 AM

LINK: https://www.discovermagazine.com/planet-earth/biological-warfare-parasitic-wasp-uses-a-virus-to-control-its-host

THAT article goes back to THIS scientific literature:

LINK: https://royalsocietypublishing.org/doi/10.1098/rspb.2014.2773

This is actually a very long and complete scientific article. Let me give you the “TL;DR” version.

When the wasp lays an egg in the ladybug, it also injects an RNA virus. That virus makes the ladybug go “mask Karen” crazy, and stick around and GUARD the pupated larval wasp after it emerges from the ladybug and cocoons. The ladybug may then even kick the virus and go on living after the young wasp departs.

Yeah, let me HIGH FIVE that long-hauler ladybug.

Just sayin’.

Democrats.

SPIT.

SO – where are we now?


Is Phony Gene Therapy About Population Control?

We have now looked at the COVER PRESENT (coronavirus and vaccines), the EFFECTIVE PRESENT (spike protein virus and vaccines), the LIKELY DEEPER MOTIVATING PRESENT (contraceptive / abortive virus and “vaccines” that look pretty much like public “health” gene therapy), and the PURPOSED ORIGINAL HONEST PAST (infection and/or genetic modification of the injected to produce desired effects using RNA viruses and/or specialized viral vectors) – the latter insect past being a lot like what is happening now.

Are you ready for the FUTURE?

Well, there’s a lot of range on that. Maybe it’s THIS…..


Now I know a lot of y’all are, like me, saying “Yeah, that will be a cold day in hell!” But let’s consider it anyway. It helps to understand things.

WHY would Hillary say this, about Trump’s possible winning in 2016?

What crime could POSSIBLY send hundreds of historic conspirators to some horrible fate like what happened to the NAZIS? They would have had to have done something even more horrible – right?

Well, viewed in “holocaust” (small “h”) terms, an “abortion virus” followed by “abortion vaccines” might count.

It’s a pretty ingenious idea. If you honestly believe that overpopulation threatens the planet, and that stopping it “by any means necessary” is justified, then the idea of:

  • taking a modifiable cold virus but…..
  • don’t call it that, so people will be AFRAID
  • warm up the FEAR CROWD with SARS, Ebola, Zika, etc.
  • use a cold with its own moderate antiprogestogenic or oxytocin hormonal activity, or some other way of exerting a contraceptive or abortive activity
  • optionally increase that activity
  • release the virus
  • create vaccines with the same effect
  • require ongoing vaccines to titrate the effect on society

To me, this is very much like the wasp strategy, only instead of hijacking the juvenile butterfly with immunosuppressive negative gene therapy in a PRO-FERTILITY strategy for its own offspring, what the Democrats are doing is an ANTI-FERTILITY strategy using progestosuppressive negative gene therapy on basically all humans who are not in on the scam. And they also used an RNA virus to mess with our minds, though THAT was a bit artful, shall we say.

Now, I think the success or failure of their operation is going to depend on the ultimate level of contraception that is achieved here. The effect on society will depend on whether the Dems, globalists, and Chinese are trying to pull off a very steep and fast population drop that would generate a social immune reaction, or a long, slow, incremental one that would not. We probably won’t know this for several years.

But just consider this “back of the envelope” calculation.

Let’s say that Demmunists require 2 coronavirus boosters every year. Say that between compliance and effectiveness, ONE of those boosters is effectively pregnancy-blocking for any pregnancy currently in process. Run this over all of humanity, so that once every year, every woman is hit with a “menstruation and miscarriage vaccine” using the spike protein. With a pregnancy window of 75% of the year, that target is the broad side of a barn, as long as CDC continues to insist that it’s safe for pregnant women, or women who are trying to become pregnant. You would get massive observable menstruation and miscarriages after vaccination, and the plot would not last.

It’s not a SUSTAINABLE LIE.

BUT – as long as the effect is random, subtle, and single-digits, it can be hidden by a compliant scientific community, which is socially conditioned to reject the truth. Even bigger, control of social media, communications, and other avenues of discovering the truth, mean society can be kept completely blind to a subtle population control.

But seriously – reducing the fertility of humans by 5% is a BIG DEAL. It doesn’t mean it’s the end of it. It’s a GOOD BEGINNING – from their point of view.

You’ve got to look at this thing, like you’re trying to pull it off, to see that you really COULD pull it off.

And if we could pull it off, they will pull it off.

So – that’s where I’m at.

And if I’m right, they will NEVER FACE JUSTICE for what they’re doing.

So here is a rule about Democrats.

Democrats, China and other communists will always pick an unjust fait accompli over a just agreement.

Thus, as long as they do things where the price of tolerating their crimes is less than the cost of a civil war, they will just keep doing those things.

Something to think about.

W

Buffalo Jump: The Intolerable Lie

Alternate Title: The moment I realized that GOD would back me in going asymmetrical on these unworthy China-compromised “U.S.” military bastards.


I have recently come into possession of information which made a lot of things start making a lot more sense. I only needed a final confirmation that I was correct – and I just got it.

I want to thank churchmouse for alerting me to this recent news about Buffalo Boy, or as he is more Q-mockingly self-named, QAnon Shaman.


Man who wore horns, hat apologizes for storming Capitol

By JACQUES BILLEAUD
2 hours ago

PHOENIX (AP) — An Arizona man who participated in the insurrection at the U.S. Capitol while sporting face paint, no shirt and a furry hat with horns said he regrets storming the building, apologized for causing fear in others and expressed disappointment with former President Donald Trump.

In a statement released late Monday through his attorney, defendant Jacob Chansley said he has re-evaluated his life since being jailed for over a month on charges stemming from the Jan. 6 riot and realizes he shouldn’t have entered the Capitol building. Chansley, who previously said Trump inspired him to be in Washington that day, said Trump “let a lot of peaceful people down.”


That’s just the beginning. We’ll get into ALL of it in a minute. So what is the meaning of this?

TL;DR – “I’m peaceful, I’m sorry, Bad Orange Man let us down.”

Stated on the first day of the “impeachment”. Yeah, right.

Are you starting to see what they’re doing there? This guy is an actor – supposedly – Jake Angeli being his stripper stage name – and yet the Fake News trots him out like something real.

Now, I’m always up for a good joke. Back in the days of my various amazing misadventures at MKULTRA University, we all enjoyed this kind of sport, and while sometimes our mocking names for each other, and for the things each other loved, were quite cruel, after a while one gets to feel comfortable with that Babylonian style of humor. It’s very New York, quite frankly, and “I’m just bustin’ ya chops, buddy” was rarely needed.

People understand this. Humor creates acceptance. Lovable Buffalo Boy is disarmingly lovable, and – well – that is the mark of a quality psy-op. How can I not respect that?

Even after discovering an enormous amount of fascinating information about this guy, I just can’t hate him. He’s just a lovable buffoon – right? And he IS – and you MUST grant me this – the very FACE of the “insurrection” – would you not agree?

Let’s go on with the AP piece.


Chansley said he’s coming to terms with events leading to the riot and asked people to “be patient with me and other peaceful people who, like me, are having a very difficult time piecing together all that happened to us, around us, and by us. We are good people who care deeply about our country.”

Chansley’s attorney, Al Watkins, released the statement about a half-day before the second impeachment trial of Trump was scheduled to begin in the U.S. Senate.

Watkins, who unsuccessfully sought a pardon on Chansley’s behalf from Trump, said the Senate didn’t take up his offer to have his client testify on how he was incited by the former president.

The defense lawyer said his client’s apology wasn’t self-serving but rather a genuine expression of culpability. Still, he said he doesn’t think it’s right for the government to prosecute people who were incited.

“If you believe the government is correctly prosecuting the (former) president, you can’t at the same time hold criminally culpable those who were incited, because the people incited become victims,” Watkins said in an interview.

Chansley has pleaded not guilty to felony charges of civil disorder and obstructing an official proceeding, plus four other misdemeanor charges.

The U.S. Justice Department declined to comment Tuesday on Chansley’s apology.


OMG, the poor peaceful baby – the pobrecito – was incited by mean old Trump!

I’m sorry, but I can’t stop laughing.

Oh, my goodness, this is beautiful, beautiful psy-op right here. This is PAYLOAD.

This is SELLING THE SELL-OUT.

This ties in with EVERYTHING ELSE they’ve been doing. This is the TEMPTATION right there. This is Peter saying to Christ “You don’t have to do this – there’s a way out.”

And once a patriot – a TRUE PATRIOT – sees that payload – there is only one proper response.

“GET THEE BEHIND ME, SATAN.”

That is to say “I am past this decision. I will not take the safe, satanic choice. It is BEHIND me now. I will choose the future of pain and suffering. I will choose the Cross of Freedom over the satanic snuggles of phony forgiveness and luscious lies.”

Truth is clarity. It’s the brisk chill air of liberty in COVID-seared lungs, rather than the self-deceit of the warm, stupefying mask.

This payload is VICTIM STATUS. The left ALWAYS offers it. All you have to do is say BAD ORANGE MAN INCITED ME AND CAUSED INSURRECTION – I’M A PEACEFUL PERSON – I’M ALL CONFUSED NOW, and…..

I’M THE VICTIM!

Oh, my goodness. A real Indian – a REAL Sitting Bull – a real medicine man – sets this treaty on fire and hands it back in FLAMES.

Let’s go on.


Chansley was among hundreds of pro-Trump supporters who charged past outnumbered police officers and stormed the Capitol as Congress was meeting to certify Joe Biden’s electoral win.

Authorities say Chansley was one of the first people in the Capitol building, disobeyed orders by an officer to leave, refused the officer’s request to use Chansley’s bullhorn to tell rioters to leave the Senate chamber, and wrote a note to then-Vice President Mike Pence saying, “It’s only a matter of time, justice is coming.”

Prosecutors said a spear on top of a flagpole carried by Chansley was a weapon, though his attorney has characterized the spear as an ornament.


I want you to look at the INSANITY of our Department of Justice. They are fighting over whether that fucking spear was a WEAPON or an ORNAMENT. Meanwhile, one of the greatest crimes in history, involving all these characters, and committed to cover up an even BIGGER crime, goes not merely unpunished, but uninvestigated, by the very same people. Mostly because most of them are committing it, or are protected by it, and are collectively allowing it to happen.

The rest of the above, however, demonstrates the CARE and PLANNING which went into this attack on President Donald J. Trump. You can see that “QAnon Shaman” was very careful to prepare his planned pacifist EXIT from his dilemma. He caused no real mayhem, because he knew this precise exit was coming.

With apologies to every gay friend I ever had, the fact that Chansley’s big crime was refusing to lend the kind officer his bullhorn to tell people to disperse – I simply cannot go there without screaming at this orchestrated farce, in Rocky Horror Picture Show tones, “THAT’S SO GAY!“, as not just a way of saying “Yeah, I get it”, but as a kind of camp praise of every peacefully spunky gay or “should have been gay” who ever lived.

Bravo! Somebody – wake up Mel Brooks. We need him again!

“Moving on……”


Since being jailed, Chansley has had two instances in which he wasn’t eating because the detention facilities where he was being held didn’t serve organic food. He lost 20 pounds (9 kilograms) during the latest starvation episode. Chansley, who calls himself the “QAnon Shaman,” said he has been following such a diet for eight years while practicing Shamanism.

Last week, a judge ordered corrections officials to provide Chansley with organic food. He was later moved to a jail in Virginia after the District of Columbia Department of Corrections said it couldn’t honor the court’s order to feed him organic food.


And that is the end of the article.

Organic food! Really!

Are you starting to see how they just rub it in? How they mock us?

This is all meant to either demoralize us, or provoke us. The latter, preferably to violence.

They want to take our guns. They want to take our “people power”. They want to wear down our “resistance”.

Can EVEN YOU LEFTY “#Resist” types see it now? Can you? Or are you so bought into the safety of ORANGE MAN BAD, that you cannot see a system that either USES you or DESTROYS YOU?

Welcome to CHINA, leftists. You’re getting your new China Joe good and hard, even though WE almost saved you from it.

Yes, almost. Except for the “valiant” efforts of a small cabal of powerful people, who made sure Trump didn’t win, and thought we would never learn how they stopped him.

The same people who pulled off the buffalo jump.

And WHO ARE THOSE PEOPLE?

YES. Let’s go there.


Everything Wrong With The Buffalo Jump

The video Everything Wrong With The Capitol Hill Shooting is genius. In the same way that the usual Everything Wrong With… videos tell the story of Fake Entertainment clocking in with less-than believable action and scenery under close examination, EWWTCHS simply busts the Ashli Babbit shooting as a cringe-worthy, staged operation, designed to float a meme that “Trump got somebody killed”.

If you have not seen the video, I urge you to watch it, before going on.

It used to be on YouTube:

…..but now one has to look elsewhere. Here is Bitchute.

And here it is on Gab TV:

Now – I will only incorporate in a limited way, how the prominent Mr. Sullivan / JaydenX / whatever……..

Sorry – not that Sullivan…..

No, not THAT Sullivan, either…….. how about…….

YEAH! That’s more like it!

This particular Mr. Sullivan is HEAVILY connected to a lot of very high-level MIC stuff, not only through family, but just in general. He was raised in a “Religion of CIA” household (that would be Mormons), by a military father, and seems to have interesting “feelz” for groups across the spectrum.

Just read this stuff and see what you think. WINK, WINK.

LINK: https://www.sltrib.com/news/politics/2021/01/16/robert-gehrke-what-we/

ARCHIVE: https://archive.fo/1m9da

So this guy shows up with a CNN reporter….

…….and leads an eye-rolling orchestrated event – straight out of active shooter training, only badly done – where an Air Force woman with what appears to be an “intel background plus cover” gets cringingly killed or at least it “looks that way if you suspend disbelief”.

Are you with me?

I’d say we have a little “MIC” on this stuff. Although possibly without the real bullets.

NOW – this stuff could be EITHER SIDE. I’m not going to get into that, because things get COMPLICATED when things ARE complicated. Sometimes, it’s only the END effects that tell you whose side somebody was on.

YEAH.

Yeah. Sometimes you don’t REALLY know until the end. I get that.

SO – when I found all this information about Mr. Jake Angeli, I had to wonder.

This was in response to the “Everything Wrong With” video. (PRIVATE SOURCE REDACTED)…….

I haven’t watched all of this video but Ive watched others. Much of what happened that day was a military op. It’s why Pelosi was crying about her laptop being stolen. Had some bad stuff on it like her brother being a pedophile I read. I read many personal electronic devices were taken, not stolen, that day for evidence. It was behind clearing the chambers — go, go now for your safety, leave everything behind! Yep. That whole girl being shot scene was as fake as could be. As a retired RN I know that blood doesn’t defy gravity and travel UP from her back to her front. Big nope! there. She’s fine. Viking horn guy was one of ours. Very out there all the past year so everyone would know him. Made himself highly visible. He’s one of ours, too. The actor “bio” found on-line for him — fake along with the name used on it. I had a photo of him shaking hands with Rudy G but lost it getting a new phone. He’s a super soldier type but sorry to say I’ve forgotten his real name per his sister. She wanted others to be clear that he was not Pantifa and not a bad guy. Photos from his sister. Guy on the right. I think that’s Chanel Rion from OAN maybe but not sure. Just know it’s him.

Now – here are the pictures that go with this.

Now – beyond my impression that NONE of the 3 soldiers matches the guy with Chanel Rion, I wanted to check against a known picture of Jake Angeli / Jacob Chansley WITHOUT the warpaint.

Such a thing DOES exist.

Look at the last comparison long enough, and you can see it’s him. Then take that back to the picture with Chanel Rion, and it all makes sense. It’s him.

Now, this is all fine and dandy. There’s a lot of HOPIUM on this, to assume that it’s OUR op, and it’s not beyond the realm of possibility. Nevertheless, I decided to dig a little deeper.

I wanted to see where that Chanel Rion picture came from, so I did a tineye search, and found the original image:

Now THAT is pretty interesting. It’s Jake’s fanboy picture with Chanel Rion.

And WHERE did it come from? Turns out, it was a TWITTER POST by a HARDCORE LEFTIST OPERATIVE, who was COUNTERING contentions that Buffalo Boy was ANTIFA or BLM.

He posted ANOTHER picture as well.

I repeat – an [apparently – I get that] unremittingly leftist Twitter account – a virulent Trump-hater – posted MAGA-doxxing photos of Angeli with two of the people who have been most faithful to Trump. They appear to be fanboi pictures, but still, he got CLOSE and got PICTURES.

Very USEFUL pictures.

Are y’all starting to see this now? How REAL sleazy operations work?

AND YET – in this same Twitter food-fight there were photos of Angeli at both BLM and climate change rallies, with an article for the latter:

LINK: https://www.azcentral.com/picture-gallery/news/local/arizona-environment/2019/09/20/hundreds-march-arizona-solidarity-climate-strikes-around-world/2391592001/

ARCHIVE: https://archive.fo/7hgAp

Quite useful – at the very least – to make him seem a bit crazy, no?

Are y’all starting to see this?

Now I just need ONE MORE “confirming article” to round this all out.

LINK: https://www.military.com/daily-news/2021/01/12/navy-career-of-qanon-shaman-ended-after-he-refused-anthrax-vaccine.html

ARCHIVE: https://archive.fo/Ibf4D

You can dig under this one for two more links:

LINK: https://taskandpurpose.com/news/qanon-shaman-guy-navy-veteran-vaccine/

LINK: https://www.military.com/daily-news/2021/01/11/qanon-shaman-arrested-storming-us-capitol-navy-veteran.html

SO – if you read up on Angeli’s military career, then it just looks like Mr. Perfect Discreditation graduated with a degree in Anthrax Refusal, then went onto a career of infiltrating leftist organizations, until he appeared (in a sharp right turn) to be the perfect vehicle for discrediting MAGA and QAnon – not like the latter needed much, but nonetheless, he served his purpose.

And right as the impeachment opens up, he delivers the final payload……

“I’m nutty but nice, and peaceful, too, and BAD TRUMP incited me to violence and insurrection.”

I mean, I suppose I could roll up my sleeve and inject myself with pure ChiCom HOPANYL at DEATH LEVELS and say “Hey, this is just cover – something WAY BIGGER IS COMING – that he HAD to do that to “sneak by” everybody’s suspicions – he had to TAKE OUT TRUMP to prove himself to SAVE MAGA!”, but what possible payload can this guy deliver FOR MAGA in the future? What possible payload that undoes all the damage he just did?

Or can we just, finally, at long last, admit that this guy was an MIC operative who helped take out Trump?

And THAT brings me to MY BIG PAYLOAD.


Wolf Moon’s Asymmetric Counterattack on Chinese Infiltration and Control of Our Military

I am TIRED of being called a “racist” by lead-dumb brasstitutes and their civilian defense lady-boys who can’t grasp ChiCom racial, political, societal, and military strategies. These folks couldn’t spell 4GW if it walked up and kicked them in the ass. Which it apparently just did.

I am TIRED of being called a “white nationalist” by idiots who don’t understand that being white and loving this nation are only “extreme” to people who have been hypnotized into a state of reflex delusion by much SMARTER people. People who think nothing of abusing psychology for their group gain, at the expense of this nation.

I am TIRED of being legally threatened for being an “extremist” or an “insurrectionist” because I oppose those who want to change this nation into its antithesis by cruel, cheating, lying methods – AGAINST the will of the people.

BUT NOW – it’s much worse.

There is talk of “standing down” the military for what amount to political purges. They can call it what they want, but we know what it is. Sure hope China don’t get any ideas during the “stand down”. Sheesh. BUT CHINA JOE SAID DO IT!

The HORROR of this political attack on our military, is that the military is not allowed to engage in political advocacy of any kind, so they’re PARALYZED while the Chinese politico-military spider draws in close to suck them dry.

Now THEY can’t do anything, but that doesn’t mean I can’t.

As a civilian who loves our military, I cannot watch this crap and remain silent. But that’s the asymmetric beauty of this situation. I don’t HAVE to remain silent. I can call out all this Chinese race-mongering bullshit that is being leveled at our military and WITHIN OUR MILITARY through DUPES and IDIOTS all I want.

Trump understood this. He knew that all this critical race theory and related crap is a beautiful but very cold Han-Chinese catalyst to get the oxidizer of black America (sorry – caps for both or caps for neither) and the reducing agent of white America to BURN UP and EXPLODE. I find it actually very impressive that the ChiComs knew they had to up the stoichiometry of the oxidizer to get the maximum yield, too.

Meanwhile, the utter corruption of the Military Industrial Complex was just waiting to be put in service of China. I mean – you didn’t think that Mr. Comey and HSBC and Lockheed and Hillary and Mueller all added together meant anything but CHINA, did you?

No, no, no – you don’t start talking about “rooting out” “white nationalism” in our fine military, until you FINISH rooting out CHINESE RACE POISON, BRITISH IDEOLOGICAL SABOTAGE, and the CORRUPTION that invites both of them in at nation-destroying levels.

You want to play this game of FUCK WITH OUR MILITARY IN SOVIET AND MAOIST WAYS?

I can get people to join me in FUCK WITH OUR MILITARY IN AMERICAN WAYS.

Oh, I don’t have to sit there and mess with this “Patriots” and “Oath Keeping” and all this stuff that the ChiComs have already made toxic using their race-minion Democrats, and that can’t be understood by their money-minion Republicans.

We just come in and say “China has no fucking business running our military, and every time you utter their race garbage, you salute CHINA, and we call you out as a CHINA PUPPET.”

And there’s other ways, too, but for now, rooting out pro-China extremism in our military seems like a winning strategy.

The race stuff is CHICOM ideological infiltration.

The trans stuff is BRITISH ideological sabotage.

Anybody going to do anything about it? I would say that any time and EVERY time that somebody brings up “white nationalists” and “domestic extremists” in the military, that maybe we bring up the FOREIGN-incited extremism – the sneaky stuff that is already doing harm – and do something about THAT first. Because critical race theory and the like IS EXTREMIST.

Maybe we start with LIE DETECTOR TESTS.

Ain’t that right, CHINA JOE?

See you around, energy-BOY. And here. Have your “buffalo chips” back. We don’t need ’em.

W


Prior Posts


Part 1: Buffalo Jump


Part 2: Buffalo Jump: The Plot Thickens


The Bidening of America – How Cognitive Decline is Being Forced Upon Us All Through the ChiNazis' Useful Idiots, the Mask Nazis


TL;DR – skip down to “Crucial Experiment” and read how you can prove to yourself that masks cause real and measurable cognitive decline that lasts long after you unmask. NPR and other leftists who say masks don’t affect you and your children are LYING.


LOOK, it’s time to be blunt.

Senility – Cognitive Decline – Dementia – OLD GUY BRAIN – Sleepy – whatever you want to call it, it’s just plain EMBARRASSING.

Double that for a DIRTY OLD MAN.

But there is a much bigger story here, than that the Democrats are running a creepy old codger who is now STUPIDER and more CONFUSED than he is CREEPY. Who is now SLEEPIER than CREEPIER.

The bigger story here is that the Chinese Communist Party (CCP) is performing this sad spectacle of ritual humiliation of America because THAT’S HOW CHINA ROLLS.

Biden isn’t the only one that the ChiNazis are humiliating.

EVERY HUMAN BEING is fair game for the ChiNazis.

Oh, trust me – the Big Brother CCP has its little brother DNC convinced that this Biden insanity is some kind of plan to save their treasonous asses, but that is half a lie for them, and half a lie for everybody else.

The truth is, CCP engages in RITUAL HUMILIATION both because it WORKS to keep people in their places, AND because they ENJOY THE SPECTACLE. The CCP are SADISTS at heart, and they have NEVER encountered a ritual humiliation they don’t enjoy. Their only concern is NOT GETTING CAUGHT, because that reduces the EXTRA JONES and PLEASURABLE PEACE OF MIND they get from knowing the victim is too STUPID to see what is happening to them.

HAPPY SLAVES IS GOOD SLAVES, AND GOOD SLAVES STAY SLAVES.

ChiNazis have all the compassion of Hitler’s SS who RODE ON THE BACKS of black American GIs – forced to crawl on the ground for the Nazis’ amusement.

After having worked with and UNDER a bunch of CCP creeps, who snuck in and took over, I can tell you exactly what is going on with the Democrat party.

Democrats are now the ARM of the CCP in America – a mouthpiece for whatever socialist insanity the ChiComs want to inflict. Every possible hypocrisy will be forced upon us – “rules for thee and not for me” – to get us to knuckle under and accept our “place”.

https://www.foxnews.com/politics/biden-calls-for-mandate-requiring-all-americans-to-wear-masks

Biden was a little late to get on the mask train in a big way, which just shows that he’s slow, even compared to various “little tyrant” governors who got there first. Maybe Biden was saving it for his “big opener” after he was assigned Kamala Harris as his running mate.


https://www.npr.org/sections/coronavirus-live-updates/2020/08/13/902257311/joe-biden-for-the-next-3-months-all-americans-should-wear-a-mask-when-outside

I HOPE YOU READ THAT LAST LINE.

“I would insist that everybody out in public be wearing that mask.”

Note the subtle combination of CONFUSION and Nazi enforcement reflex in the next one.

“Anyone to reopen would have to make sure that they walked into a business that had masks,” he said.

THAT is some cognitive decline RIGHT THERE. Biden can’t figure out if he’s talking about the store or the customer because he is CONFUSED just by continuous speech.

And if you think Biden is just saying “masks in stores”, think again.

“We absolutely need a clear message from the very top of our federal government that everyone needs to wear a mask in public, period,” he said.

Here is the money quote, that tells you why “Beijing Biden” is so comfortable with the CCP.

“It’s not about your rights; it’s about your responsibilities,” Biden said. He tried to present the issue as a matter of patriotism to protect fellow Americans.

NOW – this is interesting. Watch what Trump says in response.

In a news conference later Thursday, Trump took issue with Biden’s nationwide call for mask-wearing, ignoring that the Democrat urged governors to issue mandates.

“[Biden] does not identify what authority the president has to issue such a mandate,” Trump said, “or why we would be stepping on governors throughout our country.”

Trump added: “If the president has the unilateral power to order every single citizen to cover their face in nearly all instances, what other powers does he have?”

There’s a lot to unpack here.

First of all, Biden’s cognitive decline – just screaming in the second quote. Biden gets confused between the BEGINNING and END of the sentence. That is BAD, and it’s OBVIOUS.

Secondly, note how the media tries to protect Biden here, in essence saying that Trump didn’t say about governors what he said about governors. It’s subtle, but the LyingPress just gets away with it every time.

Lastly, note how Trump has gotten the Democrats and the press onto THIN ICE with masks. They sure seem “all in” for masks, don’t they?

Trump never went there – did he? Trump mentioned VOLUNTARY masks from the beginning. He has steadfastly refused to be baited into NON-VOLUNTARY masks, although he has let governors issue what have turned out to be hated and despised mask edicts.

Funny, isn’t it?

In my opinion, Trump gave the Democrats ALL the rope they needed to tie themselves up – and not just that – it was THEIR ROPE – left over from hoarding masks, just like the CCP did. Trump knew the Dems would try to get rid of their masks for CASH, and that they would do it in a bullying and flagrantly despicable style which would be their undoing.

You want to wear masks for the rest of your life? I can tell you exactly who to vote for.

Nope. Trump has BLESSED THE MARRIAGE of Democrats and Masks.

People are going to remember, as they CAST THEIR VOTES TO GET RID OF MASKS.

https://twitter.com/RedPilledVoter/status/1296617259696234497

NOW – I could tell you that Masks are going to be bad for Democrats simply for people hating them, and wanting to get rid of them. But that’s not all.

Masks are going to have their own #LancetGateEffect moment, and Democrats are always going to be remembered as the CCP STOOGES who fell for China’s game of “how can we actually make the stupid Americans stupider?”.

Let’s look more closely.


Rebellion Against Masks on Twitter

I was not originally opposed to masks. I have people I follow on Twitter like yohiobaseball who are vehemently opposed to masks, e.g., Mike DeWine’s mask mandate, and I did not initially go along with their opposition, which was not articulated LOGICALLY, but purely from a FREEDOM standpoint.

The problem was, I was laser-pointered to only look at the GOOD masks MIGHT do in preventing infection by COVID-19. There is some evidence that “masks work” in that respect.

Then, I realized that FLU is actually a much worse problem than COVID-19, and THUS it would be illogical to EVER get rid of masks. That simply doesn’t make sense. The problem is that we are not being logical right now. We didn’t have masks in the past – at a time when we were MORE LOGICAL.

Something is NOT RIGHT with using a “new sub-flu” to make us all wear masks now. What are we missing?

What we are missing is the focus on why we never wore masks before. We are missing the NEGATIVE side of masks.

Why? Because the NEGATIVE side of masks is COMMON SENSE. Masks simply CANNOT help respiration, oxygenation, and COGNITION. They have to hurt – the only question is HOW MUCH.

And THAT is what I “rediscovered” by simply taking my oximeter – left over from COVID self-therapy – and using it to test the effects of my masks.

BASIC. FRIGGING. SCIENCE.

What follows FIRST is a bunch of Twitter “realizations” that masks are problematic, which led to my experiments.


https://twitter.com/freedragonfly17/status/1296562363911376896

(“Hypocapnia” is an error here – I meant hypercapnia – too much carbon dioxide.)

HERE is where I really got it. This is when I started EXPERIMENTING with masks and my oximeter.

Are you ready to do a little science? GREAT!!!


The Crucial Experiment is the One That YOU Do

One of my best realizations with masks is that THEY can stop ME from convincing YOU with MY DATA that masks cause inevitable cognitive decline, because THEY control our communications.

There are more of us than them; they just control the mechanisms that allow us to communicate with each other – nothing more.  Remember that!

Sundance, in “Good Grief, Goodyear is Run By Idiots…

It’s all part of “reactive disinformation”, something I realized in October of 2017, during the Las Vegas attacks. At that time, “trolls” (in reality, Chertoff-Hayden cubicle rats) were creating NEW photographic meme disinformation in a continuous fashion, REACTING to each discovery we made, to THWART US on discovering what was really going on.

I began to realize that we needed ways to bypass reactive disinformation. Bypassing reactive information is, in fact, part of what Q does.

Modern internet warfare on Twitter is basically a giant distraction from HONEST debate by bombardment with DISINFORMATION using DISHONEST techniques. I have now spent enough time FREE of “Fake Normal” that I remember what HONEST DEBATE includes – and Democrats are INCAPABLE of honest debate.

Real, regular, good science is literally impossible with people who don’t subject their own “side” to scrutiny, but waste EVERYBODY’S time by subjecting what does not need scrutiny to scrutiny.

The answer is to BYPASS DISHONEST PEOPLE. Shut them out of the scrutiny loop.

Yeah, I can stick my numbers out here and we will argue about them because that is how FAKE SCIENCE works now. Fauci calling remdesivir the new standard when it had absolutely cringeable numbers – THAT is Fake Science right there. How do you fight against that crap? You can’t, unless you can FIRE FAUCI and put Dr. Zelenko in his place. You want to see WAR with Bill Gates? Try THAT.

However, they cannot stop YOU from proving TO YOURSELF that masks cause cognitive decline.

Better still, THAT is science itself. Duplicating results – reality checking – reproducibility.

It’s very “Q”. It BYPASSES the reactive disinformation.

Here is how I described the experiment that YOU CAN DO, on Twitter.


Twitter is absolutely suppressing the hell out of all my stuff, and this tweet is getting it BIG TIME.

That is exactly why I’m BRINGING IT HERE. Let’s dig in.

And ALL of this is just on hypoxia issues. There is more. MUCH more.

https://twitter.com/GinaGWeiss/status/1297039124461957120

Again, the key to doing this experiment is to create an overly elaborate method of recording data that includes very particular ways of spacing, punctuation, grammar, allowed terms, allowed notations, etc. Maybe a list of things to check yourself on, and an order to do it in. Practice it a few times without the mask to validate that you can do it, but right before you put on your mask. Keep these rules IN MEMORY – essentially IN RAM – and particularly your SHORT-TERM MEMORY. Thus, I suggest NOT writing any of these rules down. Force your brain to WORK.

It’s a lot like taking an SAT test, isn’t it? EXACTLY MY POINT. You are forced by both test rules and TIME to keep stuff in memory. We are creating fresh memories, and then watching masks DEGRADE THEM.

You will see FOR YOURSELF that masks degrade your short-term memory, and keep it degraded for a surprisingly long time.


Conclusions

Let me give you some of the “conclusions”.

The most important thing I found is that masks make people FORGETFUL. Not just me – I am now able to spot “mask head” in other people. It’s FREAKY. It’s like being in a science fiction movie and spotting the puppetmaster on people’s BACKS. Or is it a FACEHUGGER?


“Sorry – I asked you that already, didn’t I?”

“Yes! That’s the mask, actually! Masks make you forget stuff.”


One of the very first times I wore a mask in a store, I found myself getting more and more forgetful, going down my list of items. Near the end, I felt like reality was becoming a bit “dreamy”, so I figured I needed to GET OUT AND GET SOME AIR. I then FORGOT the last item – the one that my wife had specifically asked me to get.

Interestingly, that time I not only caught myself SPEEDING on the way home – in a place that I pride myself on NOT speeding – I later FORGOT LOADING THE GROCERIES INTO THE CAR. I had no memories of it. It was FREAKY. I had MISSING TIME. I felt real worry that I had left the groceries in the cart at the store. I had one of those “OMG” moments. I had to search my mind to realize that I had both forgotten to load the groceries into the car, but also I had also just put them away at home.

It was ILLOGICAL, but those were my memories. Of course, MKULTRA works similarly, but let’s not go there now. Maybe another time.

MISSING TIME FROM MASKS. And the effect is beautifully consistent with logic. It takes time – it’s cumulative – it has a latency, and it wears off. It took over half an hour for the effect to build up to where it was making me forget things significantly, and it took about half an hour for the effect to fully wear off.

It’s the mask. It is simply the mask.

Now – not all masks are the same. For me, the bandana is the worst. My numbers go down quickly to 96 or 97, and don’t get back up easily. Rapid breathing doesn’t raise my O2 as quickly as with either a “regular real mask” or my “cheater fashion mask”.

Obviously, I rarely use my bandana any more, except for experiments.

My regular store masks – the normal ones everybody wears – are better, but I still get hypoxia, followed by strong, measurable cognitive deficits with them. However, when I am wearing a mask in a place where I absolutely want to avoid any drama, and my time will be short, I stick to these masks that “blend in” with the crowd.

My “fashion mask” barely covers my chin. Hard breaths get strong oxygen immediately, relieving the hypoxia. That is what I wear when I don’t need to impress any Mask Karens or Mask Nazis.

Another thing is this. Yes, the oximeter scale is “scrunched up” to where meaningful stuff for normies wearing masks is roughly four numbers – 96, 97, 98, 99 – and if you interpret the oximeter waffling between these numbers as 96.5, 97.5, and 98.5, then you basically have 7 numbers you’re likely to see. It’s surprising how much you can prove with just those 7 numbers, but there is a reason for that, too – the COGNITIVE SCALE is also scrunched up near the top.

That is a POWERFUL realization, and NOT KNOWING IT is how the NPR lie works.

NPR has a pro-mask television ad with a soy boy, trying to convince you that “masks make sense” and “masks are smart”. It has a very cunning “proof” that hypoxia is not a problem – the soy boy says they’re not a problem, while showing a doctor in a gown and goggles and a mask showing you an oximeter on “99”, and then the doctor shrugs.

That is PURE PROPAGANDA. It’s not science. What YOU are doing is science, and what you are going to confirm is COMMON SENSE.

SO – that is why I am using the VERY FINE-GRAINED TEST of journaling with lots of little rules that you make up before, about how you are going to record and format your observations. With a small window of numbers that go from nodding off to alert, and a mind that – IRONICALLY – is going soft right when you should be making critical observations about your mind going soft, then it is the SET OF DETAILED PICAYUNE RULES for recording your observations that serves as the fine-grained test of cognitive ability – in addition to how you subjectively feel.

Self- analyzing your performance – being as hard on yourself as you are mentally able to do – will reveal your cognitive decline from masking.

So what’s next?

Well, some of us should not be wearing masks AT ALL. And yet, in my nearest “deep blue zone”, the TDS mayor actually EXCEEDS the regional mask mandate, by not allowing people to NOT wear a mask. You MUST wear a “face covering” into government buildings.

My recommendation in such cases is to wear a plastic face shield, as loosely as possible.

But that is not all. We need to work very hard to UNMASK, and to get around this unhealthy BS which has been foisted on us and our children in the name of health.

So let’s turn to MASK REBELLION.


How To Rebel Against Masks

People tend to be either “all in” on masks, or “all in” on mask rebellion.

What I advocate is SMART REBELLION. And part of smart rebellion against masks is for us to do back to the commies what they did to us – but OPENLY, PROUDLY, and LOGICALLY.

We need to SUBVERT masks, and encourage others who wish to join us, to join us.

  • substitute “social distancing” whenever allowed to do so (typically outside stores)
  • take “cheater breaths” around the mask whenever you feel like breathing harder
  • pull the mask away when you talk, so that you can be understood
  • wear the thinnest and least hypoxia-inducing mask you can find
  • point out “mask head” to forgetful people in a nice, concerned way
  • use a face shield instead and tell people why
  • use opportunities to tell people about mask hypoxia
  • show people your oximeter and explain how it shows mask hypoxia
  • use the oximeter in public and show people the truth
  • make your BREATHING FREELY in public very obvious and SMILE BIGLY

I will be getting a face shield shortly, and I will likewise do an oximeter experiment with it. Yeah, it will look stupid as hell, but hopefully somebody will ask.

Real science is coming back, one person at a time.

W

PS – thanks to Dep Pat for this wonderful CLOWN WORLD video!

The Revelations of Sundance of MAGA – Evidence Discussion 02 – Is Clinesmith the End of the Road?

The question of FBI attorney Kevin Clinesmith, the indictment of whom was POSSIBLY announced by AG William Barr in response to Sundance’s announcement of an imminent release about DOJ, is very interesting.

Clinesmith is the guy who altered an email about Carter Page, hiding that Page was a CIA source, and thus allowed the BAD Carter Page FISA to continue to be used against Trump.

Is Clinesmith cooperating? How MUCH is he cooperating? People are speculating like crazy. A lot of people are taking Barr’s “gib” as a sign that BIG FISH ARE GONNA BE IN THE FRYIN’ PAN! Clinesmith has to be cooperating! He’s SINGING!!!

Really? “Trey Gowdy really?” Are we sure this isn’t more “Tick Tock Club”?

Remember James Wolfe? He THREATENED to give up a bunch of people in the Senate. Sure seems very convenient that DOJ attorney Jussie K. Liu made that all go away with a wrist-slap for lying to the FBI.

Yeah, but now it’s DURHAM. And Durham is a “straight shooter”!

OK, so you say Sundance says Durham’s not real, yada yada yada, but throw that all aside – Clinesmith is TALKING. RIGHT?

Set aside the possibility – which I think is very real – that MKULTRA techniques may have been used on Clinesmith, to insure he would “come through” on “Carter Page not a source”. Totally subconscious. He won’t remember a thing. Those techniques can also interfere with investigation. “Missing time.” Gaps in memory. There is some possibility that these techniques can be REVERSED, but SET THAT ASIDE, TOO.

We simply need to know two things:

  • is Clinesmith giving up useful evidence which will get more coupsters?
  • is OTHER evidence accumulating that will get more coupsters?

Q seems to be saying YES!

Room for 5 more indictments.


4621

Link to New Q Drop

Q!!Hs1Jq13jV617 Aug 2020 – 6:59:35 PM

[Placeholder – Indictments Tracking > Non_Civ]
[Set 1]
1. Kevin Clinesmith [KC][11.3]
2.
3.
4.
5.
6.
[Placeholder – Indictments Tracking > Civ]

https://www.justice.gov/archives/jm/criminal-resource-manual-923-18-usc-371-conspiracy-defraud-us


Will this information have come from Clinesmith?

Not necessarily, IMO. I think it’s possible, but there may be MORE witnesses and MORE evidence.

We do NOT know how these indictments relate.

So what do you all think?

I’m up in the air right now. I want to hear MORE from Sundance.

Tomorrow – whoops, I mean TODAY is Tuesday. Sundance promised to DROP today. Let’s see what happens.


On Sunday, in one of his talk show coverage posts, Sundance had a video of Nunes talking about Clinesmith. Take a listen:

NOW – this is very interesting – Gateway pundit restates something that makes a lot of sense – that Comey “knew” Carter Page was CIA.

https://twitter.com/John_KissMyBot/status/1294990260674473986

If you read the article, you will see that this reasoning is based on the fact that Carter Page is KNOWN to have sent a letter to Comey, telling him that he had worked for the CIA. Page copied a WITNESS on it, so this is a KNOWN FACT.

In my opinion, TGP is overstating the case by ASSUMING that Comey believed that letter. Well, whether or not Comey believed he letter, we know that FBI top brass was RE-ASKING the lowers about Carter Page’s CIA status when Clinesmith DOCTORED THE EMAIL to hide it. So in my opinion, Comey was getting COVER from Clinesmith when he asked for VALIDATION on Carter Page having no relationship to the CIA.

Clinesmith GAVE Comey that cover by doctoring the email.

So GREAT – there has to be some smoking gun where Comey or McCabe or SOMEBODY told Clinesmith what to do – to doctor the email – RIIIIIIIGHT?

WRONG! There may be, but we don’t know yet.

OK, then. Is it the opposite? Clinesmith did it all by himself – right? End of the line? One guy caused all this damage by doctoring an email?

ALSO WRONG! It may be, but we don’t know yet.

I want to know more about what DOJ is holding here.

And I want to see what SUNDANCE is holding, too.

TODAY.

Tuesday.

Sundance, https://theconservativetreehouse.com/2020/08/14/its-500pm/

W

“Not what you expected, is it?”