KMAG 20250115 Open Thread / False Flags, Pedos & Satanists

I first want to say, PLEASE at least skim this article. Gunderson documents the false flags the US government has used to control us for decades. I have run out of time, so please excuse my mistakes.

Continuing from last week, now on to the meaty subject of Ted L. Gunderson. He is a whistle-blower & was Agent in Charge of FBI field offices in Los Angeles, Memphis, and Dallas. He is quite interesting, especially given he was poisoned with arsenic powder sprinkled in his home and car after he retired. (1 hour)


I was going to include Colonel Tower’s videos about Operation Gladio since it gives you the WHY but I will do that next week. In a nutshell, to fund Operation Gladio (Color Revolutions and such) the CIA uses ‘off the books’ money from drug running, arms trafficking, — from guns and ammo to fighter jets and helicopters — and human trafficking — from slaves to child sex workers. Drugs and sex are also used to control politicians, the media, judges and such. If that doesn’t work??? Well there is always threats, entrapment, imprisonment and assassination.


And speaking of assassinations, that was Ted Gunderson’s fate.

FBI Chief Ted Gunderson’s Affidavit


[Left click on page and open image in new tab. You can then enlarge the print using [Ctrl] [+] — GC]

Theodore L. Gunderson was poisoned with Arsenic to death a few months after writing this affidavit…

Ted L Gunderson, former head of FBI in Los Angeles, Memphis, and Dallas, was poisoned with arsenic says Dr Ed Lucidi who saw Ted’s body before and after he passed away. Dr. Ed treated Mr Gunderson, who suffered bladder cancer and died as a result of its spread at age 82. LINK

For the science go to the paper:

Aggregated cumulative county arsenic in drinking water and associations with bladder, colorectal, and kidney cancers...

At 9 minutes in that video, Dr Lucidi talks of Gunderson’s arsenic poisoning and the signs [Black nails and body turning black after death.] Also that Ted found arsenic dust in his apartment & locked car.(18 min)

Dr Lucidi then goes into WHY Doctor MacDonald was targeted. The CIA was shipping cocaine back to the States via the body cavities of the Dead soldiers.

Dr MacDonald, as an army doctor became aware of this drug pipeline and thus was framed for the murder of his family. This ties directly into the CIA and their method of funding Operation Gladio coups. So we now, with the recent New Years False Flags, have several interesting links to Fort Bragg, including the 4th Psy Op group that Badlands Media loves. And speaking of Psy-ops, at around 29 minutes in the video, Ted says, “…the MK Ultra program has been very actively administered not only at Offutt  Air Force Base [but] at Fort Brag North Carolina, the place where Dr MacDonald’s family was slaughtered in 1970…”— GC

>>>>>>>>>>>>>>>>>>>>>>>>>>


ADDENDUM: I just found this clean transcript of the GUNDERSON PRESENTATION, MAY 12, 2005, LINK

>>>>>>>>>>>>>>>>>>>>>>>>>>

Another, transcript of one of Ted’s one hour videos with added information can be found at:

The Most Disturbing Story Never Told – Truth Mafia

It is a similar video but goes more in depth into the child trafficking. It is not surprising to see, that since I started work on this article, this video, posted by Truth Mafia, has been taken down.

I am going to take their summary and add my own bits and pieces from the video I have link above, that is still up. I am using most of the transcript from You-tube with a bit of clean up and editing by me. Since this summary does not cover all the cases I am going to insert missing information in the same order as Ted presented it. I am also going to include links and other information that cover the cases Ted Gunderson talks about. I will use the labels “Summary” and “Video” to differentiate between the two sources.

Summary

➡ This text tells the story of Ted Gunderson, a former FBI official who exposed a child abuse ring involving powerful figures in America. Despite facing threats and obstacles, Gunderson revealed a network of child trafficking that extended beyond Nebraska and involved high-ranking officials. His investigations echo in recent scandals involving Jeffrey Epstein and P. Diddy, showing a pattern of powerful elites exploiting their influence to commit heinous acts and avoid accountability. Gunderson’s courage reminds us that truth, no matter how deeply buried, will always surface.

FBI & CIA

As part of the video intro, ted says:

…. I do have credentials…. Believe me if you read the Internet you may not think so because there are some heavy duty FBI informants out there like Stu, Webb, and Barbara Hartwell, who are MK Ultra mind control victims. CIA mind control victims who are making all kinds of disparaging remarks about me.

So right off the bat, he connects the CIA to the FBI and both to the control of information. Because without that control of information the Cabal’s grip on the world slips.

…..

Rothschilds & Adam Weishaupt.

If you use Yandex.com to search those 2 names together it gets into some really bizarre areas. Expose News and Order of the Illuminati are just two examples Yandex brings up. Ted source of information is Commander Carr’s Pawns in the Game (Link to the actual book)

Report on this book:

Pawns in the Game – William Guy Carr

This book was written by a high ranking Canadian naval officer with connections in both military and intelligence agencies. He identifies a group of ‘International Bankers’ as the “secret power” behind world revolutions, and documents the history of their activities as they fund wars and upheavals from Cromwell to WWII. He covers wars and revolutions throughout Europe from 1640 to 1940, but of special interest are his insights into the Spanish Civil War (1936) and events leading to WWII, since these are not well covered in most other accounts…

William Guy Carr died in 1959 of unexplained causes four years after publishing “Pawns in the Game”. He was 64. His son published one of his other important books “Satan, Prince of this World”, after his death.


The book, Satan, Prince of this World in PDF format

PREFACE

When the author of this book, Commander W.J.G. Carr died on October 2, 1959, he left this book in manuscript form along with many scribbled notes, reference books, half formulated thoughts, etc. His last wish was that the book be finished and published in order that all men might know of the plot which exists to wipe out every trace of decency in the world and all civilizations as we know them now. Such a task is manifestly beyond ordinary means. I, his oldest son, have been asked to try and edit, revise and correct the manuscript as best possible before publication. This I have done to the best of my limited ability.

I have not added anything to the original draft or changed anything except where requested to do so in marginal notes in my father’s own handwriting. I found the work frustrating because it was far beyond the scope of my ability. At the same time, I found it extremely interesting and rewarding as I tried to sort out the thoughts and ideas of a man who died almost seven years ago.

At some points in the manuscript I found notes such as: “Check the accuracy of such and such a point” or “dig out more information on such and such a person”. On each occasion, I deleted the point queried completely, for it was always my father’s strong belief that nothing should ever be written until completely proved out in the light of existing knowledge. Since I do not have the necessary sense of values to decide what information should or should not be used in such cases, I felt safest by leaving the information out completely.

The fact that there are only thirteen chapters in this book will annoy some people and frustrate others: I think all who read it will be left in a state of restlessness. “The Unfinished Symphony” has never been completed and this book will not be completed either, except as each reader finishes it for himself in the future by personal experience as the story unfolds. Many of you will scoff at the statements made in this book; many will toss it aside as the ravings of a madman; some will be unable to finish the book because it will arouse anxieties and fears that cannot be faced. But many others, and I hope that they will be in the majority, will find in this work the answers to some of the most perplexing of the problems that have faced men since the beginning of time and provide material for pondering possible solutions to the future….

Please also read the forward by Commander Carr. (pg 6)

….

As I said last week, this is not a rabbit hole it is a a rabbit warren, a network of interconnected burrows. And what a mess it is!

From the video:

Let’s go back to 1776 May the 1st.. Adam Weishaupt  was commissioned by the Rothchild family to set up the goals to control and the final goal was the take over of the world with a One World Government.

Adam Weishaupt came up with 25 goals. Among these goals were control the Press, corrupt the youth through sex and drugs, elect our own people, our own people meaning the Illuminati, to key positions in all levels of the government. City, County, State and Federal and it goes on. The final goal was to take over the world with a One World Government.

[The] information is very well documented by William Guy Carr in his magazine excuse me, in his book Pawns in the Game.

To me this is a critical point. The ‘Cabal’ goes back CENTURIES, not decades and is deeply entangled in not just the USA but everywhere. At the end of the video Ted also mentions satanism — 4 million practicing in America today… 50,000 to 60,000 human sacrifices a year.

1970 Green Beret Murder.

More info:

‘Green Beret’ Murders & Army/Police Complicity in Cover-up

In the video Ted starts off with his first case as a private investigator. It ties drug running from South East Asia (Vietnam) to military bases; a cover-up by military intelligence at Fort Bragg; the involvement of sons and daughters of military personnel in the Satanic Cult who actually committed the murders; all to protect that CIA drug pipeline. Note that these same Cult members were the distributors of the drugs up and down the east coast.

As of 2014, I still do not know if Dr Jeffrey R McDonald has finally been released from prison.

Dr. Jeffrey MacDonald: Innocence, and the Future of Habeas Corpus (Sept. 16, 2014)

This sums up our Just-Us system:


The Tragic Case of Dr. Jeffrey MacDonald 1/15/2021

“We discovered how the defense, the jury, and the judge were prevented by prosecutors from seeing the extensive evidence of outside assailants collected at the crime scene as revealed in CID laboratory notes. This critical material – my entire defense, if you will – remained hidden. As later proven in documents acquired through the Freedom of Information Act, the critical CID lab notes had been carefully collected by prosecutor Murtagh, who left the Army to build his career on my case. He had kept the lab notes in his briefcase in the courtroom throughout my seven-week trial.” Dr. MacDonald wrote,

Murtagh’s fellow prosecutor, James Blackburn, repeatedly told the court, ‘Where is the evidence of outside assailants? Where is the evidence that Helena Stoeckley was ever inside 544 Castle Drive?”


It was in the brief case of his fellow prosecutor as he knew damn well! Reminds me all to well of the Jan 6ers.


McMartin Preschool case

Digging for tunnels on the McMartin Preschool grounds

Summary:


➡ Dr. Gary Stickel, a UCLA archaeologist, discovered tunnels under a school, leading to the uncovering of a covert criminal enterprise involving military intelligence. This enterprise, known as the Franklin cover-up, involved kidnapping children from foster homes and orphanages for sex trafficking. The operation, which is documented in a book, involved flying the children to Washington, D.C. for sex orgies with prominent figures. Despite evidence and demands for investigation, the FBI has refused to look into the matter.


This actually combines one or more cases. From the Video:

The next case I worked of a major consequence was the McMartin preschool case in Manhattan Beach, California. The children there claimed there were tunnels under the school. That they were taken into the tunnels and through the tunnels up into the trap door of a bathroom in a Triplex next door, placed in automobiles and prostituted in the community. These are two, three, and four year-old children before they entered kindergarten. In addition the children claimed that they were flown into the mountains where they were involved with adults in robes. Black robes, Chanting, Candles. They talked about the brown babies who were sacrificed. Who were cut up, actually sacrificed. In checking into this and researching this of course this was obviously a satanic ceremony. The McMartin family who owned the preschool they were tried of Ray Buckey and his grandmother. The grandmother was acquitted. Hung jury on Ray Buckey, the second trial another hunt jury.

I had an opportunity in 1990 to gain control of the school. Now the school had been given to Danny Davis the defense attorney and he had sold it even though he made $15 million on the case by the way. He had sold it to a contractor who was going to take it down. When I learned this, I contacted the contractor. I said I want to be given an opportunity to go on that school and look for the tunnels. The authorities had looked for them in 1987. They said they could find no tunnels. Along with some of the parents ,we hired Dr Gary Stickel, UCLA archaeologist. He hired his crew and brought them in. And in 34 days Dr Stickel said there had been tunnels under that school. They were covered up and they were covered in.

An informant of mine told me that there was an abandoned satanic site in Crestline California up in the mountains I went up into the mountains and obtain copies, photocopies [of] photographs of the site…


Makes you wonder what evidence those California fires are burning… Think the Standard Hotel. Think the 1986 Presidio Child Development Center scandal in San Francisco….


THE FRANKLIN COVER-UP CASE

Selected excerpts from: The Franklin Cover-Up, Child Abuse, Satanism, and Murder in Nebraska by Senator John W. DeCamp

Please at least skim the above article. It is not long. Ted worked a lot with John DeCamp.

From the video:

12:50

From there I became involved in another case. A very frightening case because I established with the help of people like John DeCamp former state senator of Nebraska that we have in this country today, a covert Military Criminal Enterprise Government. An Enterprise primarily by US military intelligence that is operating Full Throttle and everybody refuses to investigate it. In the Nebraska case, it’s called the Franklin Cover-up, this is the book here, that Johnny DeCamp wrote by the way. It’s all documented in there and in that particular instance they were taking children out of foster homes & orphanages [like] Boy’s Town, driving them from Omaha Nebraska to Sioux City Iowa 184 miles away. Placing them in private jets and flying them to Washington DC for sex orgies with prominent people including Congressman, senators and certain people in the White House it’s well documented.

And we wonder why our congress critters vote the way they do?

John DeCamp, CONVENIENTLY died at age 76, July 27, 2017, after battling Parkinson’s disease and other illnesses. He spent his final days at the State Veterans Home in Norfolk Nebraska. LINK

When a person is first diagnosed with PD, they are often told “You will die with Parkinson’s disease, not of Parkinson’s disease”. This means that PD is not a fatal disease per se and end of life often occurs at an old age from another medical illness entirely. End-Stage Parkinson’s Disease & Death | APDA

For more information on the Franklin Cover-up there is:


An Interview with Nick Bryant: Part I – The Franklin Scandal

Nick Bryant: “The Franklin scandal” is about an interstate pedophile network that flew kids from coast to coast. What we are seeing with Jeffrey Epstein, we saw in the Franklin scandal, although I think the Franklin pandering network was much, much bigger than Jeffrey Epstein’s network. There were two primary pimps. There was a pimp in Nebraska, Larry King. He was getting children that had fallen through the cracks, from foster-care homes, from Boy’s Town Orphanage and from some other institutions. There was another pimp living in Washington, DC, who was involved in this, Craig Spence, who had his home wired for audio-visual blackmail. Anybody who took part in any of those parties at Craig Spence’s home was definitely blackmailed.…

Before I went on the wild goose chase with Rusty I made a video of myself and disseminated it to some people and I said exactly what I was going to be looking for, and that I was going to be with Rusty Nelson. So, if anything had happened to me, that video would have been indispensable in a court of law. I backed myself up that way. Pictures had gotten Gary Caradori killed, so I knew that going for pictures was very, very dangerous. This was absolutely “smoking gun” material….Well, no one has ever sued me. “The Franklin Scandal” is layered with corroboration and vetted by an attorney. I told Trine Day, my publisher, “You guys have got to really vet this. What we are saying about a lot of people is pretty horrific. I am confident I am telling the truth here, but you’ve got to vet it.” So, it was vetted by an attorney and no one has ever accused me of libel over the years it has been out. No one has ever accused me of fabricating anything. It’s a very solid piece of investigative journalism.

But the Wikipedia page about the Franklin child abuse allegations has some very autocratic operators who will not let any truth about The Franklin Scandal enter that page. I’ve had wars with them and there’s other people who have tried to make changes to that page. So people look at the Wikipedia page and I am summarily dismissed as a lunatic.

For what it is worth, someone at Badlands Media commented that Wiki is run by the CIA.

Back to the video:

I replaced a fellow named Gary Caradori who was the investigator for a Nebraska Senate committee. Gary met the official photographer of the group who had split from the group, defected. [he] agreed to take the pictures that this official photographer gave him. They met in Chicago. And he agreed to take the pictures back to the committee. He flew out of Chicago in his private plane. A short distance out of Chicago the plane exploded midair. His briefcase has never been found. He and his 11-year-old boy died. The rear seat of the airplane has never been found. I had made every attempt possible to obtain possession of or control of that plane because I wanted to examine it for bomb chemicals particularly the back seat. It’s no longer available. Nobody knows what happened to it.

Gary kadori was a civilian yet it [the plane] was taken to a military base for examination. A deputy sheriff was the first one on the scene he saw the pictures. He started picking up the pictures and FBI agent came along took the pictures away from him. Told him to keep his mouth shut. He started talking to a few people. A year later his wife was murdered. He’s no longer talking.

This International child kidnapping ring I later learned was out of Washington D.C. It was very active and the organization is known as the Finders. I have a report on the Finders back there. Everything I’m telling you is documented by the way. The Finders has been established and operating throughout the 1960s up to the present time. It was exposed in 1987, [so] they moved their operation to Wichita Kansas and they’re operating right today in Wichita Kansas.

So Nick Bryant had good reason to be nervous about getting concrete evidence.

THE FINDERS

The Finders: The Ted Gunderson Report (84 pages)

Video


I have taken my report to the FBI a half a dozen times demanded an investigation and I have yet to be interviewed. So we have the Finders, we have the Franklin Coverup, which documents what I’m telling you. We have the Game of Pawns. [which] is the Illuminati. This is the Illuminati, the Satanic movement, in this country today and the last thing I’m going to mention in the way of a book is Why Johnny Can’t Come Home.

Why Johnny Can’t Come Home (347 pages)


From the Summary:

➡ Johnny, a boy from Iowa, was kidnapped and used as a sex slave in a covert CIA mind control project. He escaped and briefly returned to his mother in 1997 before disappearing again. The case is linked to the Nebraska case and the CIA’s MkUltra mind control program, which was investigated by Congress in 1987. This program, still active today, involves training individuals for various tasks, including assassinations, and has connections to powerful figures and institutions, including Boys Town, Nebraska, a respected children’s charity.

➡ Larry King, a prominent businessman, was accused of abusing children from Boys Town, a home for troubled youth. Despite reports of his actions, no action was taken due to his influence and connections. However, in 1988, his financial crimes led to his arrest and the exposure of his pedophilic activities. Despite the evidence and testimonies, many of the influential people involved in the abuse were not prosecuted due to their power and status.


➡ The text discusses a horrifying scenario where children were manipulated and abused by a man named Larry King. King used drugs to control the children, who were then forced into sexual acts and threatened with violence. The text also mentions a disturbing ritual involving murder and sacrifice of children, which was believed to bring power through invoking demons. The victims were often very young and were brainwashed into participating in these horrific acts.


➡ In 1990, a child abuse ring was discovered in Nebraska, but the media and law enforcement discredited the victims instead of investigating the accused. The FBI and local police didn’t take the victims’ allegations seriously, and even pressured them to change their stories. When one investigator died in a suspicious plane crash, his evidence was quickly seized by the FBI. Despite the victims being acknowledged as abused, the grand jury dismissed their allegations and instead charged one victim with perjury.


➡ In 1991, Alicia Owen was sentenced to 9-25 years in prison due to a false child abuse story by Troy Bonner. Alan Baer was fined $500 for aiding prostitution, and Peter Citron served two years for a similar crime. Larry King, however, never faced child sex charges due to Bonner’s lies, but was sentenced to 15 years for a $40 million fraud. John de Camp believes this case shows a failure of justice and hopes to expose it, despite strong opposition and claims of cover-ups in high places.

At this point things get really interesting.


Noreen Gosch Speaks About – Jeff Gannon, Johnny Gosch And The Attempted Theft Of Her Book ‘Why Johnny Can’t Come Home’


…Years later, on February 5, 1999, in a civil action in a U.S. District Court in Lincoln, Nebraska, Paul Bonacci painstakingly recounted the sordid, heart breaking details of Johnny Gosch’s abduction and forced participation in an elite government sponsored pedophile sex slave ring, that dehumanized and controlled its young, hapless victims using techniques such as drugs, murder, satanic rituals, sexual abuse, and torture, resulting in MPD (multiple-personality disorder). The children were systemically programmed and “zombified” as part of the CIA’s ongoing, under-the-radar MK-ULTRA (MK = mind control) mind control program….

Paul Bonacci knew what he was talking about regarding Johnny Gosch’s kidnapping in 1982. Why? Because he was there! Bonacci’s role within the pedophile ring was simultaneously that of a victim and a perpetrator. Actually, the then 16 year old Paul Bonacci was the person who had lured and then forced Johnny into the back of the car that screeched away on that fateful September morning. It was Bonacci who had helped drug Johnny, and then proceeded to initiate him into the group, his new “family”, by sexually assaulting him.

Bonacci himself had been abducted and pressed into service as an MK-ULTRA sex slave by Lawrence E. King, a high ranking Republican operative who managed Franklin Savings and Loan in Omaha, Nebraska as a front for an internationally organized pedophile ring. He ran this pedophile ring for the benefit of government, military, and big business elites, whose patronage included political blackmail, snuff films, kiddy pornography, prostitution, illegal arms and drug running, extortion, and money laundering. This was the same Larry King who allegedly ran the infamous midnight “call-boy” tours of the White House, along with Craig Spence. Amazingly, the White House pedophile story was headlined by the Washington Times, on June 29, 1989.….

Unbelievibly, now Noreen is threatened with another loss, as if the 1982 brutal kidnapping of her son Johnny wasn’t enough. A scoundrel is using the courts to paint Noreen into a legal and financial corner in order to to steal HER remaining book inventory and the reprint rights to HER book… 

The theft of her book is a way to bankrupt her and shut her up of course.


That article leads to this unsavory character and his wife Lilith. Note the winged eyebrows on this dude.


LTC Michael Aquino and his wife Lilith. Aquino was a practicing satanist, but whether he actually believed in it or used it for his role as mind-control and rape of women and children only he knows.

The Military and Child Molestation: Holding Our Own Accountable in This 5 Gen War


…The Presidio Child Development Center scandal was reported on beginning in 1986 in San Francisco.
As in the Franklin case, there is no question children had been sexually abused. Literally dozens of children were medically examined and showed signs of genital and anal trauma, and 5 to 6, depending on reports, contracted chlamydia, a sexually contracted disease
. The game became what could be prosecuted in a court of law.


Many of the children repeatedly identified Aquino as being present when they were transported from the base to area homes for ritualized abuse.


Aquino lived in the area and eventually his home was raided based on descriptions provided by the children of not only a satanic décor, but a soundproof room with photography and video recording equipment inside. Photographs of naked children were carried out of the Aquino home in clear trash bags, along with video tapes and other evidence. Of course, Aquino was never brought up on charges, most likely because of the level of prominence of the people depicted in those photographs and movies raping children.


The Army took over a year to close the daycare. About the only thing it did even half right was ensure Aquino would never get promoted.

End of career. Bye…


Pedophilia in the Military: Lt. Colonel Michael Aquino and His MK Ultra/Monarch Mind Control Program Revisited — Before It’s News

Back to the Video:

…the mother Noreen Gosch was dumbfounded didn’t know what happened demanded an investigation by the FBI and by the West Des Moines Police Department. The chief of police in West Des Moines said to her, even though he disappeared, we do not have any witnesses who saw him being grabbed and placed in a car or being taken control of, 👉so we’re not going to investigate it.👈 The FBI used the same premise they refused to investigate it. Now I’ve been involved in kidnappings in the FBI and I can tell you that it’s automatic within 24 hours, 👉at the end of 24 hours that we had to go in.👈 In my day this was back in the 50s, 60s and 70s we had to go in and start investigating the case after they’ve disappeared for 24 hours.

Today as we as I stand here and you sit there the children are disappearing in this country at the rate of 83 per hour that’s over 700,000 children a year now. I can go back to July 1982 the Readers Digest claimed there were 100,000 children disappearing every year. There’s another statistic that I find very interesting and that is that it is estimated 2,500 children are kidnapped and murdered in this country every year….


Now we know why the DemonRats are so interested in ‘unaccompanied children’ and why they ‘disappear’ from the system. The USA now has a much lower birth rate and parents are more careful about keeping a sharp watch on their kids compared to the 1950s & 60s. The pedos and satanists, needed a fresh source.

Back to the video:

I personally talk to one of the youngsters who was involved in this network. I’ve talked to several of them and he assures me that Jeff Ganon is in fact Johnny Gosch.

Well how did Johnny Gosch get from a West Des Moines Iowa 12 years old, all the way, with the phony press pass, into the White House as of a few weeks ago. What happened to Johnny is that he was transported from West Des Moines to Sioux City. He was placed on a farm for 3 weeks [and] sexually molested. He was taken to the mountains in Colorado placed in a cage in a house of some sort or cabin. And then later he was used as a sex slave. They didn’t kill him they didn’t sacrifice him although a number of these kids are sacrificed in satanic ceremonies. He escaped with another young man. They stole a car and in 1997 Johnny knocked on his mother’s door at 2:30 in the morning. Gosch said he wanted to talk to her. He was there with another young boy. He came in. He told [her] in the rain. He says “mother I was kidnapped.” Kidnapped, I’ve been placed in a covert military CIA controlled mind control project and used as a sex slave. He said I can’t come forward at this time. They will kill me and then he left in the rain . She says that’s the last time she talked to him.

[It’s] 1997 now. Now several years after that, a girl named Burns who was a producer for 20-20 decided to do a story on the Johnny Gosch kidnapping and the Nebraska case. And She interviewed me. In fact I spent 5 days with her. Gave her the benefit of all my research, which is available to you folks also. Then she got a lead that Johnny was hiding out on an Indian reservation in northern Minnesota she went there and flushed him out. He basically went into hiding and now he shows up at the White House. He was a mind control victim.

27:00 MK ULTRA MIND CONTROL PROGRAM

If you don’t know anything about MK Ultra mind control program, it came into this country through the German scientists after World War II. They were involved with the Nazis during the war and prior to World War II in developing robots and individuals to be used on command for anything that they wish ,including assassinations and other nefarious activity. The MK Ultra program, CIA mind control program, was investigated by Congress in 1987. Congress said CIA you got to quit doing that that. You’re bad boys and they said we will quit. Don’t kid yourself. It’s is very active today. There are people like Barbara Hartwell out there who are mind control victims. She’s another one who’s been bashing me. I must be doing a pretty good job because I wouldn’t have these people criticizing me on the internet like they do. Of course it doesn’t bother me in the least.

But going back to the Nebraska case [and] MK Ultra. A lot of this training took place at Offutt  Air Force Base in Omaha Nebraska which was strategic care command headquarters. You recall after 9-11 the president flew to I think it was the South someplace in Louisiana or New Orleans and then he flew to Offutt Air Force Base in the afternoon of September 11th. They had a party there that morning at 9:30 in the morning. He missed the party. He was sorry he missed the party. Warren Buffett was there by the way.

The MK Ultra program has been very actively administered not only at Offutt  Air Force Base, [but] at Fort Brag North Carolina, the place where Dr McDonald’s family was slaughtered in 1970.

32 minutes. KENNEDY ASSASSINATION

I used to be in charge of the FBI in Dallas. So in checking into the Jack Kennedy assassination, I learned no question about it that it was a joint hit by the CIA and the Chicago mob. Sam Giancana was head of the mob in Chicago. Three days before he was to testify before Congress, [he]was shot and killed…

33 minutes PEARL HARBOR

I interviewed the naval intelligence officer who on December 4th 1941 received information that the Japanese were going to bomb Pearl Harbor. We had broken the secret code of the Japanese. He told me personally, on December the 4th, he gave it to his superiors they passed it up the line…

34 – 36 minutes WACO TEXAS

..look at Waco. The military was involved in destroying, shooting and killing women and children. Also the FBI. They use tanks, military tanks in violation of Posse Comitatus… They got away with it… in Waco there were four ATF agents who were shot and killed. some of the Branch Davidians were tried sentenced for these quote murders… in researching the four ATF agents who were shot, I learned every one of them was shot in the head. Now for those of you who have been in the military that’s a sniper shot no question about it. [in] one of [the] men the bullet trajectory was from above down through his lip and into his body probably from a helicopter. It’s interesting to note that these four men, ATF agents, at one time were all bodyguards for former President Bill Clinton..

37:09 WORLD TRADE CENTER CAR BOMBING

We have the 1993… the car bombing of the World Trade Center. I have a copy of the New York Times [from] October 28th 1993. And in the article was reporting from The Trial that took place [of] an FBI informant named Salam who was in among the terrorists. He testified that he was commissioned by the terrorists to put the bomb together to bomb the World Trade Center in February 1993.

Fortunately for him, when he met with the terrorist he wore a body mic so he could record every word that was said. Unknown to the FBI, when he met with the FBI, he also wore a body mic. That was probably what kept him from being set up and framed and sent to prison. This is actually in this newspaper article he went to his FBI superiors. [He] says I’ve been commissioned to put the bomb together we’re going to use a dummy bomb aren’t we and 👉he was told by his FBI superiors no we’re going to use a real bomb.👈

Now I don’t understand why Congress and Senate investigators and our leaders in Washington DC are not jumping up and down over that situation. 👉The FBI not only knew in advance of the car bombing, they furnished the ingredients for the bomb. [ Jan 6th Pipe Bomb anyone? – GC] 👈

Why doesn’t somebody take some action in that area. Why doesn’t somebody investigate this International child kidnapping ring being operated by the CIA. Why are these congressmen voting on bills like the Patriot Act which takes away many of our constitution rights and civil liberties in the best interest of quote protection for our country and protection from the terrorists.

Let me tell you something ladies and gentlemen, there are people in our government, a rogue outfit, whatever I’m not sure who, are actually Behind These Terrorist Acts. And the reason they’re behind the terrorist acts is so they can pass bills like the Patriot Act and the reason the congressmen and the Senators vote for these stupid bills. Stupid by our terms and our definition, is because they’ve have been set up and framed through sex and drugs.

40:11 OKLAHOMA CITY BOMBING

So then we have Oklahoma City 1995.

I personally made two trips to Oklahoma City. I investigated Oklahoma City. Because of my report, the defense attorney for Timothy McVeigh, sent two of his investigators to interview me. I spent four hours with them actually. I got a lot of information out of them. For example they told me that they were allowed to tour the remains of the M building in Oklahoma City in the presence of a US Marshall, but they were not allowed under any circumstances to take soil samples or to pick up any evidence for examination. Stephen Jones was their attorney.

I heard that they were going to tear down the building.

Now you can trace bombs through what they call the tagging chemicals. When I heard this, I called John deCamp. I said, “John we’ve got to prevent that building from coming down.” I actually called an outfit in Chicago of the Pat Kennedy group, who are specialists in examining evidence of this type. John called McVeigh’s attorney, Jones. Because John had a client who he was representing, who was involved in the case, John said I’ll handle the paper. We’ll have a hearing. We will prevent that building from coming down. The next thing we heard the building was coming down. John called Jones. “What’s going on and he had no good answer for it. That was evidence. I’ve been at many a crime scene and it is critical that the evidence be preserved. That was a huge cover up.

McVeigh wrote a letter to his sister. [Jennifer] was in Special Forces. The government said the military says “oh no he flunked out” He didn’t flunk out. He was recruited out of Special Forces according to him in a letter he wrote to his sister. [He was recruited] to be trained to be a CIA assassin and also to work for the CIA International drug operation both against the competition and for the CIA pro- drug people. McVeigh was in my opinion an MK Ultra mind control victim. He was visited in prison in Oklahoma and in Colorado by Dr Jolly West. This was secret by the way, I happen to find out because I made some phone calls to the right people. Jolly West was one of the foremost leaders along with Sidney Gottlieb and the CIA’s MK Ultra mind control operation.

Some additional information about Dr Jolly West, so you understand the implications of what Ted is talking about:

Correspondence Between Jolly West and Sidney Gottlieb, Director of the CIA’s Operation MKULTRA (1 minute video)

Jul 21, 2022

Never-before published internal documents from the Lackland Air Force base psychiatrist who was secretly contracted to the CIA’s MKULTRA program to experiment with airman using drugs and hypnosis — without their knowledge. These exclusive letters between psychiatrist Louis “Jolly” West and MKULTRA’s director, Dr. Sidney Gottlieb, outline the men’s plans for creating mind controlled assassins. Their work began in June 1953, one year before the murder of three-year-old Chere Jo Horton by Lackland airman Jimmy Shaver.

43:30

Why would somebody like Jolly West go interview McVeigh not only in Oklahoma but also in Colorado during the trial? Because he was a mind control victim himself. At one time it was reported, I think in US News & World Report, that McVeigh had a microchip in his buttocks. Our military reportedly have been using microchips to keep track of their soldiers.

The bomb in the truck allegedly was a fertilizer bomb. The government first announced that it was a 1500lb bomb and then a 2500 lb bomb and I think it ended up being 4,800 lb. That bomb that was in the truck destroyed half the building. A 4,800 lb fertilizer bomb, an ammonia nitrate fertilizer bomb dissipates and did not have the potential, the possibility, of destroying that much of the building. After the Oklahoma City bomb went off I had a call from a friend of mine, Michael Riconosciuto. For those of you who are making notes look up in the internet, Michael Riconosciuto. I’ve been working with Michael since the early 1980s, 1982.

44:55

It’s when I first met him. He was a CIA agent operative for some two decades he was also an FBI informant at one time. His father owned the Hercules Manufacturing in Silicone Valley California. Hercules manufacturing developed what is known as the electro-hydrodynamic gaseous fuel device which is a highly classified bomb. The bomb was was actually manufactured by Dyno Nobel out of Salt Lake City.

I want to stop here and mention Brave has ZERO info on “Electro-hydrodynamic gaseous fuel device” (I was trying to find the correct spelling.) However when I tried Yandex, I got a whole bunch of hits for “Hercules Manufacturing Electro-hydrodynamic gaseous fuel device” For example:


THE OKLAHOMA CITY BOMBING & THE POLITICS OF TERROR — The Liberty Beacon. Jan 2015


Oklahoma City Bombing: Was Timothy McVeigh a Patsy in a Sinister Black Flag Operation? — Covert Action Magazine 2022/04/19

Hercules-2 | (The) Project on ship engine technologies

Fuel flexible, near-zero emissions, adaptive performance marine engine

46 minutes PROMIS SOFTWARE TRAPDOOR FOR US GOV’T

Now Michael, in the meantime, is in jail now. Right? In fact I talked to him yesterday because he started to talk before the Brooks committee about a very interesting case involving the Promis Software [Inslaw, 30 Inc.]. The Promis Software was a computer operation. They developed all kinds of intelligence information on you, and I, and every citizen in America. The Department of Justice leased it for two years. At the end of two years they refused to pay Bill and Nancy Hamilton the $10 million they owed them. Then the Department of Justice through Earl Bryant, past president of United Press International, took that computer [and] sold it around the world. Sold it to the French, to the English, Israelis, Canadians. Unknown to these foreign countries, [to] the officials in these foreign countries, there was a trap in the computer. A very clever trapdoor [that] secretly allowed us, the US government, to retrieve all the information they developed.


Michael Riconosciuto was the CIA agent who developed the trapdoor in the Promis Software Computer. When Congress started to investigate it in the late 1980s, they called on Michael. We want you to testify. Michael received a threatening phone call two weeks before he was to testify, he claimed. From a fellow named Peter Videnieks of the US Department of Justice. “If you testify you’ll be sorry.” Michael testified anyway. A few weeks later [He] was arrested for drugs [and] is now serving a 30-year prison sentence because he dared to expose these nefarious activities by this Rogue Criminal Enterprise operating within the confines of the US government.

Summary of Michael Riconosciuto’s Information Presented in Terrorism Cover Up in America

What happened to Michael Riconosciuto? American Conspiracy: The Octopus Murders culprit’s whereabouts explored March 2024 [NETFLIX Docu-series???]

Michael has been released and is scared to death he will meet the same fate as journalist Danny Casolaro. The documentary is by Christian Hansen & Zachary Treitz. Riconoscuito was one of the chief sources for Casolaro. Michael had a lot of inside info on the people concerned.

Back to the rest of the video.

47:30

I gave you a little background on Michael. Going back to Oklahoma City now, I want you to understand who Michael is. He’s not some guy walking down the street with a grocery basket looking for a recycling center okay? He has credibility. Now Michael called me right after the Oklahoma City bomb went off and he said Ted, (He called from prison by the way) that’s my bomb meaning [that it is the bomb] Hercules developed. That it was not an ammonium nitrate bomb. Now when that [Hercules] bomb was tested in 1982 I happened to be with a group of intelligence agents in Palm Springs waiting for the results of that test.

It was tested in Area 51. It was under estimated because the power, it was so powerful, that two of the technicians died. They underestimated the strength of it. This, I call it a barometric bomb, this barometric bomb, according to Michael was what was in the car not a fertilizer bomb. I have an Oklahoma City report on that. So what did I do as an investigator?

49 minutes

Well I went to the Picatinny Arsenal in New Jersey. I gave him the contract number which I obtained through a Science magazine. One of my associates actually did the research on that and I gave the public Picatinny Arsenal contract number and the Picatinny came back and said there’s no such contract here, even though I had the contract. By the way that’s documented in my report. I went to Dyno Nobel who I knew manufactured it and they didn’t even bother to respond. It’s interesting to note that a  Dyno Nobel  expert witness testified at the Grand Jury when they indicted McVeigh in September of 1995

50 minutes

Some five or six months after the 19th of April 1995 Oklahoma City, in an article in Fireman’s Magazine. It was written by the editor of Fireman’s Magazine. The information was obtained from the Oklahoma City Fire Department. In that article, again that’s in my report, in that article it states that four unexploded devices were taken out of the building. When people were in the building after the bombing, DYING, they discontinued the rescue efforts for some 5 hours, while they carried out a bunch of government files. Men in blue suits of some sort. Sweatsuits. So what I’m telling you is Oklahoma City was perpetrated by certain people other than McVeigh and Nichols and now Roger Moore.

If you read the paper recently, the gun dealer who claims that he was robbed of his guns in Arkansas and that that money was used to finance Oklahoma City Bombing, Roger Moore, has been accused by Terry Nichols of being involved in it. Roger Moore denies it. Roger Moore at the time of the Oklahoma City Bombing was an FBI informant. I had an Inside investigator in Oklahoma City tell me that there were at least 11 other individuals involved in Oklahoma City okay?

52 minutes 9-11 ATTACK ON THE TWIN TOWERS

That brings us up, we’ve gone through Pearl Harbor, Waco, Ruby Ridge, Car bombing 93, Oklahoma City 95, that brings us up to 9-11.

As I said my [client] was in prison. I’m his “investigator of record” which means I’m like an attorney. I should have access to him on a regular basis. I represent this man. For a year prior to 9-11, actually year and a half. I tried to get in and see Michael. He was in prison in Northern Pennsylvania. I was in the Philadelphia area. The Bureau of Prisons would not allow me to see [him.]

I finally was able to talk to Michael in January 2003. I flew to the east coast spent three days with him.

Michael told me that he had developed information from among his contacts in advance of 911 that they were going to be involved in using missiles, airplane missiles and they were going to be involved in skyjacking. They were training Arab terrorists. Also he knew the identity of the person in the United States. An Arab who lived in Patterson New Jersey who was the leader of terrorist activity by the Arabs in this country. Now Michael had this information, because you’re saying how can Michael develop this information being in prison? Because I met with Osama Bin Laden, along with Michael, along with the state department representative, in the spring of 1986.

At that time I was contacted by former top Reagan Ronnie Reagan official who said can we help the Afghan Rebels? They were our friends then. So I called Michael, and I said what do you think? He said let’s meet. So there was a fourth fellow there. We didn’t know at the time it was Osama Bin Laden. He actually used the name Tim Osman traveling under a Turkish passport. But because of Michael I passed the ball to him. I just arranged for the meeting and went on.

Michael traveled all over the world putting this package together to furnish the Afghan Rebels with the surface to air missiles that defeated the Soviets. Really shot down their helicopters. As a result of this Michael developed sources inside the Arab world. And that’s how Michael knew in advance about 911.

55 minutes

Michael told the FBI on March the 20th 2001 about this plan to use Skyjacked airplanes and use them as missiles. He also furnished to the FBI one of his sources, one of his confidential sources inside the Arab group. The FBI interviewed him, threatened him with prosecution and deported him. That man along with his family have disappeared. We think that they’re dead. The FBI refused, absolutely refused to look into this situation. More shocking is that Michael had the names of the people who were obtaining the false names. Of the people, the Arabs, who were obtaining false passports. had their names. He had the source who could furnish him that information he told FBI Agent Keith Cutri on March 20, 2001. He told Cutri. He says “I’ll give you these names, the name of this person who’s coordinating the whole project for the Arabs, providing I be given immunity and he be given immunity.” Mr. Cutri, in spite of the fact he was armed with this information six months prior to 9/11, came back two days after 9/11, on the 13th and saw Michael in prison again. [He] accused Michael of being anti-government, anti FBI, of being a publicity seeker, and so forth, being disloyal. And so Michael, of course, didn’t have much to say after that.

Michael is still in prison, as I said. But, we had this information. The FBI did nothing with it. Cutri admit it, on September 13, 2001. Admitted that the FBI did nothing with it. So, after I visited Michael, in 2003, I felt it was important that I confirm that the FBI did meet with him.

The Bureau of Prisons would not furnish Michael with the visitors list to confirm it. So I started writing letters to the FBI through Senator George Allen to confirm that he did in fact meet with them. I wanted to document it. I also asked for the identity of the other agent who was with agent Cutri and I had a terrible time. It took me a year and a half writing letters to the FBI to get them to admit that they’ interviewed Michael on March the 20th 2001. I finally did have that information. That information is available again in one of my reports. My terrorism report that I have in the bag. So that basically brings me up to the the present time.

I think my time is up but I feel compelled, as a former FBI agent, I had all this training and I feel compelled to do everything I can to educate as many fellow Americans as I can, as to what’s going on behind the scenes. We have being operated and orchestrated primarily by US military intelligence. A Covert Criminal Enterprise involving FBI and the CIA active in this country today. [It] is being covered up right from the beginning.

By the way, they tried to frame me on a drug deal back in 1984. It didn’t work. The girl that they used to try to frame me contacted me, and said I need to meet with you. We met, [and ]she told me the whole story. I took a signed statement from her. Her name is Pam Fawsett. And, I said to Pam, I said Pam you’re working for these people the DEA and the FBI in Modesto. By the way she was making phone calls to me. I said you’re working with the people trying to set me up. Why have you — and of course in the phone call she kept trying to get me to make admissions that had knowledge of a felony and I wouldn’t. I said I don’t have any knowledge of that or was involved in a felony.

Actually I said Pam look you were working with these people for 6 months. They gave you $2,000 you had the run of the FBI office. You had your own coffee cup. Why did you come to me and tell me this now. I’d helped her, give her little advice about her 14-year-old son in the interim. You know talking back and forth there, any individual would do [it] who might be able to help. She said Ted I woke up the other morning and I realized you’re the only honest son of a bitch I’ve talked to in 6 months. Those were her exact words.

The FBI not only tried to set me up on a drug deal, I’ve also been the victim of four separate investigations. They tried to set me up on a fraud case in Denver, in Dallas, and most recently. Very frankly I’ve been under surveillance, heavy surveillance. I’ve had illegal entries into my car into my apartment. There’s been attempts to gas me within the last month and I was able to anticipate it and avoid it. But they don’t want people like me out telling the truth and that’s what I’m doing.

1:00:57

I will not stop I will continue to do so in the future so that’s basically it. I brought you from 1776 to the present time. We went through one conspiracy after another.

I had given Jim Nichols my Oklahoma City bombing report. Jim said to Bryant Gumbel, he says, did you read Ted Gunderson’s Oklahoma City report. Gumbel says, “Oh, Ted Gunderson’s a conspiracy theorist.”

I want you to know I’m not I’m not a conspiracy theorist I’m a conspiracy realist. It is there. All you have to do is get your own website, get your own internet go out there. There’s a lot of disinformation out there but you can pick out what’s really solid and what’s really truthful.

1:02:00

I have done, I have 25 years of research. [It is] on that back table back there. If you buy any of my reports or this video tape or any of my material I want you to make a promise that you will make copies and distribute it far and wide. We need to wake up America right now. Let me emphasize again I’m not anti-American. I don’t believe in violence. I believe in change through legal means. But we need to wake up an apathetic sleeping society that is active in America today. This not only ties into MK Ultra – CIA, it ties into Satanism. There are approximately 4 million practicing Satanist in America today involved in the Nebraska case.

I can go on about satanic cults for another, but I think my time is almost up. I might mention that speaking of Satanism, there are between 50,000-60,000 human sacrifices, according to three different sources, in this country every year. The satanic cults operate secretly. The Satanic Cults are along with our Covert Criminal Enterprise within the government, a serious threat to our society

I thank you very much.

The Ted Gunderson Chronicles (Part 2) Various editions:

2 hours: https://www.bitchute.com/video/aI0QNi2NQAYT/

56 minutes: https://rumble.com/v2wjzy6-ted-gunderson-chronicles-ii-part-2.html

2 hours: https://www.dailymotion.com/video/x2hfy6z

Dear KMAG 20250101 / Happy New Year 2025 from Wolf / Rewriting History

HAPPY NEW YEAR, EVERYONE!

Thanks to Gail Combs for persisting with the writing of this article for the New Year 2025 post. Gail is having incredible difficulty, trying to publish from her computer – in my opinion more than just the usual WordPress crappiness. Again, IMO, it is most likely due to “plausible reasons” of subtle interference by enemies of her posting – whoever those may be. COUGH, COUGH, COUGH.

In any case, I have not changed anything in her article below. I did add a comma to Gail’s well-wish to you all above! Other than that, I have just added these few notes at the beginning, regarding the outgoing year, and the New Year.

The year 2024 AD (Year of our Lord) could have gone many ways other than the way it did. I am of the opinion that we should be incredibly thankful for the divine blessings and providence we were granted, including the life of our wonderful president, Donald J. Trump.

And then, on top of that near-miracle, President Trump WON – we kept the House – and we gained the Senate. WOW.

Be thankful. We are blessed. Trust in God. Praise God. Trust that the TRUTH will set us free.

May 2025 AD be a year in which we not only make America great – but a year in which we make God great, too.

Always remember that YOU have the power to make God great in YOUR life!

Peace and Blessings!

W


Rewriting History

by Gail Combs

This entire article is speculative. I am taking bits and pieces from various articles I have read and seeing if there is a common theme that can be informative. After all if the Cabal is rewriting history, it becomes very difficult to know what actually happened. Especially since they seem to have a habit of offing whistle-blowers and destroying evidence.

Well, the rewriting of history by the elite was what I originally planned to write about, however the ‘rabbit hole’ took a sharp left turn. I am going to address that branch of the rabbit hole in the next article. It was when I went to find the info linking John Maynard Keynes to the Fabians, that things went south. I pulled up some old 2014 notes and followed where they led. 🤔 However I still want to follow the rewriting history concept first as a basis for the next article.

Let’s start with George Orwell’s Nineteen Eighty-four, published in 1949.

Nineteen Eighty-four — Summary

…The book’s hero, Winston Smith, is a minor party functionary living in a London that is still shattered by a nuclear war that took place not long after World War II. He belongs to the Outer Party, and his job is to rewrite history in the Ministry of Truth, bringing it in line with current political thinking…

Like John Maynard Keynes, Orwell was not formally a member of the Fabian Society. However his teacher and mentor was Aldous Huxley. Even Encyclopaedia Britannica mentions this. (I did not know John D. Rockefeller in 1900 “..bought Encyclopedia Britannica, acquiring control of a key source of information for readers worldwide.LINK and LINK)

An Introduction to Fabian Socialism via Brave New World [by Aldous Huxley] and 1984 [by George Orwell.]

[Excellent article]

…The Fabian Society was founded as the political arm of the Fellowship of the New Life, an occult, socialist think tank founded in 1883. The Fellowship was home to many influential figures, including the UK’s first Labour Party Prime Minister and Karl Marx’s daughter, Eleanor. The Fabian Society has been dominant in both British and global politics for over a century. It founded numerous influential organizations, such as the London School of Economics (1895) and the British Labour Party (1900). Fabians were instrumental in the creation of the United Nations and the entire postwar world order itself. Aldous Huxley’s brother Julian, for example, was the first director of UNESCO. He also coined the term “transhumanism” in his book ‘New Bottles for New Wine’ (1950).

The Fabians’ political aim is — or was, since their objectives have already been achieved to a large degree — the creation of a one-world Socialist government, ruled by a technocratic elite that micromanages every aspect of our lives, including our biology (via transhumanism). However, their ultimate goal is the total alchemical reconfiguration of humanity: They aim to break down the unwashed masses of the world and remold them into an entirely new breed of man — a new species of human, even. 


This is not to say that all Globalists are literally Fabians, but that the ideas laid out by Fabian Socialists appear to be the most accurate description of where Globalists aim to take their world empire.

As stated above, Aldous Huxleys brother is Sir Julian Huxley Julian Huxley, UNESCO, and Eugenics

In 1949 Aldous Huxley wrote to Orwell:



My own belief is that the ruling oligarchy will find less arduous and wasteful ways of governing and of satisfying its lust for power, and these ways will resemble those which I described in Brave New World. […] Within the next generation I believe that the world’s rulers will discover that infant conditioning and narco-hypnosis are more efficient, as instruments of government, than clubs and prisons, and that the lust for power can be just as completely satisfied by suggesting people into loving their servitude as by flogging and kicking them into obedience.”
– Aldous Huxley (emphasis added)


…infant conditioning and narco-hypnosis….” Boy talk about prophetic, or is it knowledge of the actual plan?


Aldous Huxley’s Prophetic Insights on Technology, Freedom, and Propaganda in a 1958 Interview with Mike Wallace. Aldous Huxley lived in CA at the time and in my opinion, he lied his head off in this interview.

part 1 (10 min)

Part 2 (10 min)


Part 3 (9 min)

Video about Aldous Huxley and mescaline experiments (2 min)

Humphry Osmond (1917-2004) was the British psychiatrist who coined the word “psychedelic” – “mind manifesting” – in a letter to Aldous Huxley. Osmond publicized the term at a meeting of the New York Academy of Sciences in 1957. “Psychedelic” is perhaps better term than “hallucinogen” since many classic psychedelic agents do not typically induce hallucinations.

Osmond introduced Aldous Huxley to mescaline in May 1953. Huxley sent Osmond a rhyme containing his own suggested coinage: “To make this trivial world sublime, take half a gram of phanerothyme.” [Thymos (Gr): soul]. Osmond demurred: “To fathom Hell or soar angelic, just take a pinch of psychedelic.” LINK

HMMMmmmm
CIA Mind Control and MK Ultra in Canada


Aldous Huxley, George Orwell & The Fabian Society (1 minute)

>>>>>>>>>>>>>>>>>>>>>>>>>


When talking of rewriting history, we are talking about a group of very wealthy people capable of long range planning with a single goal in mind. By long range I mean over one hundred years and probably a lot more. These people think in terms of family dynasties like the Rothschild and Rockefeller dynasties.

“Some of the biggest men in the United States, in the field of commerce and manufacture, are afraid of somebody, ARE AFRAID OF SOMETHING. They know that there is a power somewhere so organized, so subtle, so watchful, so interlocked, so complete, so pervasive that they had better not speak above their breath when they speak in condemnation of it.

― Woodrow Wilson

The Modern History Project has written about The Fabians, the Round Table, and Cecil Rhodes and the Rhodes Scholarships‎

G. Edward Griffin has written about the subject naming names.


The Chasm The Future Is Calling (Part One) © 2003 – 2015

…Where do we find this evidence? The first place to look is in history. The past is the key to the present, and we can never fully understand where we are today unless we know what path we traveled to get here. It was Will Durant who said: “Those who know nothing about history are doomed forever to repeat it.”

THE HIDDEN AGENDA

…the year 1954 and, suddenly, we find ourselves in the plush offices of the Ford Foundation in New York City. There are two men seated at a large, Mahogany desk, and they are talking. They cannot see or hear us, but we can see them very well. One of these men is Rowan Gaither, who was the 3 President of the Ford Foundation at that time. The other is Mr. Norman Dodd, the chief investigator for what was called the Reece Committee, which was a Congressional committee to investigate tax-exempt foundations. The Ford Foundation was one of those, so he is there as part of his Congressional responsibilities. In 1982, I met Mr. Dodd in his home state of Virginia where, at the time, I had a television crew gathering interviews for a documentary film. I previously had read his testimony and realized how important it was; so, when our crew had open time, I called him on the telephone and asked if he would be willing to make a statement before our cameras, and he said, “Of course.” I’m glad we obtained the interview when we did, because Dodd was advanced in years, and it wasn’t long afterward that he passed away.

We were very fortunate to capture his story in his own words. What we are about to witness from our time machine was confirmed in minute detail twenty years later and preserved on video. The reason for Dodd’s investigation was that the American public had become alarmed by reports that large tax-exempt foundations were promoting the ideologies of Communism and Fascism and advocating the elimination of the United States as a sovereign nation. As far back as the 1930s, William Randolph Hearst had written a series of blistering editorials in his national chain of newspapers in which he cited Carnegie Foundation publications that spouted Communist slogans identical to what was coming from the Communist Party itself. When the Carnegie Endowment published an article written by Joseph Stalin attacking Capitalism and praising Communism, Hearst called it “propaganda, pure and simple.”….


This is very crucial because of what Mr Griffin says later.

A STRATEGY TO CONTROL THE TEACHING OF HISTORY

The question that arises in Mr. Dodd’s mind is: How would it be possible for anyone to think they could alter life in the United States so it could be comfortably merged with the Soviet Union and, by implication, with other nations of the world? What an absurd thought that would be – especially in 1954…

The answer was provided by the Carnegie Endowment Fund for International Peace, the same group that had been the center of controversy in the 1930s. When Dodd visited that organization and began asking about their activities, the President said, “Mr. Dodd, you have a lot of questions. It would be very tedious and time consuming for us to answer them all, so I have a counter proposal…

This is what those minutes revealed: From the very beginning, the members of the board discussed how to alter life in the United States; how to change the attitudes of Americans to give up their traditional principles and concepts of government and be more receptive to what they call the collectivist model of society…

At the Carnegie Foundation board meetings, they discussed this question in a scholarly fashion. After months of deliberation, they came to the conclusion that, out of all of the options available for altering political and social attitudes, there was only one that was historically dependable. That option was war. In times of war, they reasoned, only then would people be willing to give up things they cherish in return for the desperate need and desire for security against a deadly enemy. And so the Carnegie Endowment Fund for International Peace declared in its minutes that it must do whatever it can to bring the United States into war. They also said there were other actions needed, and these were their exact words: “We must control education in the United States.” They realized that was a pretty big order, so they teamed up with the Rockefeller Foundation and the Guggenheim Foundation to pool their financial resources to control education in America – in particular, to control the teaching of history. They assigned those areas of responsibility that involved issues relating to domestic affairs to the Rockefeller Foundation, and those issues relating to international affairs were taken on as the responsibility of the Carnegie Endowment. Their first goal was to rewrite the history books, and they discussed at great length how to do that. They approached some of the more prominent historians of the time and presented to them the proposal that they rewrite history to favor the concept of collectivism, but they were turned down flat. Then they decided – and, again, these are their own words, “We must create our own stable of historians.” They selected twenty candidates at the university level who were seeking doctorates in American History. Then they went to the Guggenheim Foundation and said, “Would you grant fellowships to candidates selected by us, who are of the right frame of mind, those who see the value of collectivism as we do? Would you help them to obtain their doctorates so we can then propel them into positions of prominence and leadership in the academic world?” And the answer was “Yes.” So they gathered a list of young men who were seeking their doctorate degrees. They interviewed them, analyzed their attitudes, and chose the twenty they thought were best suited for their purpose. They sent them to London for a briefing. (In a moment I will explain why London is so significant.) At this meeting, they were told what would be expected if and when they win the doctorates they were seeking. They were told they would have to view history, write history, and teach history from the perspective that collectivism was a positive force in the world and was the wave of the future….

More from G. Edward Griffin:

Part 2: Secret Organizations and Hidden Agendas

Part 3: Days of Infamy

They are well worth the read.

Substantiating Griffin’s claim:


Ignoring Elites, Historians Are Missing a Major Factor in Politics and History

by Steve Fraser, Gary Gerstel (2005)

… Over the last quarter-century, historians have by and large ceased writing about the role of ruling elites in the country’s evolution. Or if they have taken up the subject, they have done so to argue against its salience for grasping the essentials of American political history. Yet there is something peculiar about this recent intellectual aversion, even if we accept as true the beliefs that democracy, social mobility, and economic dynamism have long inhibited the congealing of a ruling stratum. This aversion has coincided, after all, with one of the largest and fastest-growing disparities in the division of income and wealth in American history….

Neglecting the powerful had not been characteristic of historical work before World War II. ”

An example of the re-writing to remove anti-communism evidence.

The Great Thanksgiving Hoax | Mises Institute

The Socialist-Capitalist [FASCISM -CG] Alliance: the Fabian Society, the Frankfurt School, and Big Business: Part I

…do most people know the link of cultural Marxism, in particular its strategy of the “long march through the institutions,” to another socialist society famed for its “gradualism” and its connection to the British Labour Party? This society is called the Fabian Society and heavily influenced, indeed was a precursor to, the creation of the Frankfurt School.

…In 1905, American Fabians established the Rand School of Social Science in New York City and incorporated the Intercollegiate Socialist Society to promote “an intelligent interest in socialism among college men and women.” A founding member was American Fabian John Dewey, considered the father of progressive education, and an atheist, socialist, and evolutionist. In 1921 the Fabian Rand School changed its name to “The League for Industrial Democracy” and established a network of 125 chapters with the aim of de-Christianising America. Dewey became president of it in 1941. Dewey also co-founded the New School for Social Research (NSSR) in 1919, which is a Fabian-socialist institution that is the American equivalent to LSE. This school, funded by the Rockefeller Foundation ($208,100 between 1940 and 1944) and the Carnegie Corporation ($95,000 in 1940) among others, set up the Graduate Faculty on Political and Social Science in 1933, called the “University in Exile,” and aimed to “accommodate the large number of socialist intellectuals” who fled or were expelled from Hitler’s Germany…


First Andrew Carnegie Medals Awarded to Seven Visionaries of Modern Philanthropy

A nice nest of vipers -GC

Bill Moyers, Ted Turner, Bill Gates Sr, David Rockefeller, Richard D Parsons Judy Woodruff, Anthony Fauci, Tom Brokaw, George Soros, Mamphela Ramphele, Barbara Walters, David McCullough, Irene Diamond, Keonore Annenberg, Brooke Astor at the Carnegie Medal of Philanthropy 2001

>>>>>>>>>>>>>>>>>>>>>>>>>


Going further back in time we come to the PrussiaGate series by Will Zoll, a team of two writers. The series is on a paid subscription substack but Patrick Gunnels reads them on Epic Threads. Zoll lays out an interesting hypothesis and backs it up with historical information. https://rumble.com/search/video?q=pgunnels%20Prussiagate (Skip the first 10 minutes which is intro.)

Part 1: https://rumble.com/v12s30v-new-prussiagate-the-reichswef-part-1.html

Part 2: https://rumble.com/v135wxl-new-prussiagate-the-reichswef-part-2.html

Part 3: (Includes the War for our minds too) https://rumble.com/v13nxac-the-war-for-our-minds-part-2-prussiagate-reichswef-part-iii.html

Part 4: https://rumble.com/vvxut3-new-prussiagate-not-since-1917-part-iv.html

Part 5: https://rumble.com/v16h7xl-promptly-at-745-prussiagate-the-reichswef-part-v.html

Part 6: https://rumble.com/v18bxk7-prussiagate-the-reichswef-part-vi.html

Marburg: The Four Horseman, the Marburg Files, Snow White and Revolution – A Prussian Dream: Start @ 28:50 This is very interesting given the Good vs EVIL battle we are currently in.

A short free article by Will Zoll on the same topic.

Fairy-tale Anon: Marburg and the Grimm Tales of Child Abuse

>>>>>>>>>>>>>>>>>>>>>>>>>


Finally going back centuries in history, we have a series by another Badlands associate. Given the time frame this is very speculative. However he brings up some interesting ideas and some nuggets of fact. He is also wrong about other things.

The Werewolf Game: On Languages and Cover-ups

Words are Precious Archeological Artifacts by American Hypnotist

…I’ve become more and more convinced over the years that mainstream history is a hypnotic spell. I frankly wonder if ANY of what we were told in school was true.

The same dark cabal that runs the Deep State today has likely been messing with our history for centuries—what we want to know is how and for what purpose.

99% of our job as Digital Soldiers is simply to know what’s going on!….

The Werewolf Game:

The Hidden Dimensions of Information Warfare by American Hypnotist

many people generally don’t understand that an informed minority ALMOST ALWAYS defeats an uninformed majority in any information-based conflict/war….

American Hypnotist then gets into the psychology of the Cabal.

The Mindset of Evil

What is the “platonic form” of evil?

In my opinion, evil can be best described as unbounded parasitism.

Allow me to explain …

Seen from a “Darwinist” perspective, life itself is nothing more than a non-stop struggle for “domination”. I call this the eternal power struggle worldview. This is, indeed, the central belief of Marxism; it’s also the worldview that all psychopaths share on some level.

Power struggles are indeed a part of life, but the key difference between the perspective of psychopaths and non-psychopaths is that your average human being doesn’t define the entirety of existence by such power struggles (unless they’ve been trained to look at things in such away by a psychopathic education system/media complex/culture/family environment… but I digress). Either way, many people DO see things that way, and they’re living their lives accordingly.

The most intelligent of such people are quite capable of hiding their manipulative ploys behind a well-crafted façade. Sometimes, such people form “alliances” with each other.

Do you see where I’m going with this?

This mentality is one of the key factors driving the Deep State. It acts as a powerful unifier for all the slavers and dark occultists of the world in their quest to parasitize mankind as much as possible….

…brilliant psychologist, Andrew Lobaczewski, author ofPolitical Ponerology: the Science of Evil, had many up close encounters with psychopathic personality types as well, for he was an escapee from communist Poland. According to him, psychopaths feel oppressed by the common morality of the people, simply because they see no reason for it—they often quite literally see themselves as a “more evolved” version of humanity, because they’re “unburdened” by the “silly” moral considerations of normal folk.

Psychopathic personality types often deeply wish to take revenge out on the populace whose morality prevents them from pursuing the satisfaction of their appetites without impediment.[Think Pedophilia and cannabilism – GC]

one of the driving features of the psychopathic personality type is the INABILITY to achieve satisfaction


After defining psychopath/parasites he goes on to the Werewolf Game. Note it is a RUSSIAN who comes up with the concept for this game. A game that teaches how to analyze people.

…When it comes to an information war, oftentimes it’s the most innocent seeming “comms” that tell us the most—fairy tales and mythology almost certainly contain more clues than people tend to think. The very archetype of the Werewolf may indeed come from an ancient death cult that appears to have its origins in the Western Russia/Ukraine region. This cult was sometimes known as the “Koryos”, and they’d go on killing sprees under every full moon, usually wearing wolf-pelts on their heads.

Are you starting to see why I believe there’s something very profound going on here with the Werewolf Game? ..

That he brings up fairy tales is interesting because Will Zoll also points out the importance of the old fairy tales. See the Gunnels VIDEO above Prussiagate Files: Marburg, Snow White, Brothers Grimm starting at 40 minutes.

Another interesting article within the series:

The Werewolf Game – Hell On Earth

Something Weird is Going on at the Black Sea

…Did you know that the Black Sea has almost no oxygen in it? Not only that, but it glows red, and contains high levels of sulphur. Alas, the smell of sulphur is popularly associated with the presence of demons…

AND

Now, my first piece of evidence supporting the idea that hell is real comes from the research of Dr. Jerry Marzinski, a brave man who spent many decades as a therapist working with schizophrenic patients in maximum security prisons. After many years of working with these patients, he concluded that the voices schizophrenics hear in their minds are NOT hallucinations, but rather demonic entities who “infest” human beings.

According to his experience, these entities do this because they feed on negative emotions. Literally, they are hungry, and cannot produce their own energy—ergo, they need ours to “survive”.

Marzinski discovered, among other things, that the voices inevitably get VERY mad when you correctly identify their parasitic nature.Much like how a garden-variety narcissist or psychopath will react when you wise up to the games they play.

Alas, there is no profit in curing schizophrenia for the drug companies, and this is why you aren’t going to see any mainstream publications talk about Marzinski’s work.

Among other things, Marzinsky discovered that reciting Psalms 23 agitates the voices and makes them run away—he taught his patients to recite it until he was “found out” and told by the authorities that the only allowable method of “treatment” was to continue giving his patients drugs.

THAT certainly puts another twist on why the Cabal is adamant about pushing Russia out of that area and why Putin insists the Cabal is satanic.

From Part II

The Werewolf Game – Agents from Russia

Whether it sounds plausible or not, the fact of the matter is that werewolf, vampire and zombie symbolism holds many keys to understanding the mindset of the Deep State death cult.  

This cult is indeed a predator class that goes to great lengths to visit untold violence and torture upon innocent people. Pardon my candor, but if you want to be more than mere food for anything that eats you, then the onus is on you to become aware of predators in your midst….

There once was a time when “fairy tales” were used as a teaching tool to warn people about psychopathic personality types and the cults that such types create. Nowadays, many stories are told to accomplish the very opposite effect.

The “misunderstood psychopath” has become a trope in mainstream entertainment…..

…going all the way back to 3,000-2,000 BC, there existed a cult that had its home base right where Ukraine stands today, and which used the “wolf” as its main “theme”. This cult was known by many names, including but not limited to the Koryos and the Are-ans  (due to worshipping a deity named “Ares”, which looks an awful lot like the words “Aryan” and “Aries”, if I do say so myself)….

From ancient times up until the year 1,000 AD, the Koryos would ride into Asia and Europe, marauding their more peaceful, agrarian neighbors—like many psychopathic types, they didn’t produce anything themselves, instead preferring to do drugs for half the year, in between raids. They’d go into a “berserk” trance under the full moon, and wore wolf pelts on their heads as they pillaged everything and everyone around them.

It would be a mistake to think that this cult disappeared centuries ago.

Among other places, the symbolism of this cult can be seen in the coat of arms for the Fabian Society, a prominent British socialist organization that officially formed in 1900, and that had a hand in the formation of the League of Nations (1919). Their membership included Walter Lippman, whose 1927 book Public Opinion goes into detail regarding the elites plans to use “democracy” as a smokescreen to mentally control the masses whilst convincing the masses that they are free…

Fabian Society’s coat of arms:

Rather blatant, isn’t it?

As we discussed in the previous article, psychopaths are “two faced”—That is to say, they wear a mask to blend in with normal society—indeed, most of us would become very skilled actors if we practiced the art of manipulation all day, every day, like psychopaths do. The symbolism here is important, because when we’re dealing with the dark occult practicing elites, we are indeed dealing with people who keep their “inner monster” hidden, and who also engage in ritualistic, cult violence

… The ancient kingdom of Khazaria was also said to hail from this area, and there’s a tremendous amount of evidence that Khazaria and the werewolf cult are deeply connected. Khazaria was said to have pioneered horseback warfare, traveling in nomadic tribes, marauding nearby villages…

[The Author points to another tidbit I was not aware of. GC]

 Vladimir Putin—another “Russian agent”, if you will—who recently told the world that,

“For centuries, [the cult] got used to stuffing their stomachs with human flesh and their pockets with money. But they must realize that this ‘ball of vampires’ is coming to an end.”

When Putin calls them “vampires”, I’m certain he’s talking about one and the same cult that I’ve been talking about, which is likely the same cult that is variously called the Illuminati, the NWO, Satanists, Luciferians, the Babylonian Brotherhood, etc. by popular culture….


This author maybe doing a bit of a stretch in some areas. I certainly have problems with some of his ideas, but there is this:


Sviatoslav’s Council of War,” by Boris Chorikov, 1836. Around the year 965, after centuries of traveling merchants being ambushed and murdered by cut-throats in the modern-day nation of Ukraine, an alliance was formed between Christians and Muslims. Led by the [Kievan-Rus] Grand Prince of Kiev, Sviatoslav I, the proto-Russians fought alongside the Byzantines and the Turks (all former enemies) to destroy the Khazarian Empire, which had rejected all three Abrahamic religions, instead practicing the profane art of blood magic from ancient Babylon, worshiping the satanic deity, Ba’al. Defeating this existential threat required an alliance of old sworn enemies. (They had all previously failed on their own.)


Image and quote swiped from Ghost of Based Patrick Henry : https://badlands.substack.com/p/horseshoe-theory-part-1

And we have this from RUSSIA.

1050 years ago Svyatoslav squads defeated the state of the Khazars July 3 2015

1050 years ago, in the summer of 965, the great Russian prince Svyatoslav Igorevich defeated the Khazar army and took the capital of the Khazar Kaganate, Itil. The lightning strike of the Russian troops with the support of the Allied Pechenegs led to the collapse of the parasitic Khazar state. Russ committed a sacred revenge, destroying the Khazar “snake”…

Khazar threat

The fight against the parasitic state of the Khazars was the most important strategic task of Russia. The trade and usurious elite of Khazaria, who subjugated the Khazar tribal military nobility, held in their hands all the exits from Eastern Europe to the East. The Khazar state received huge profits by controlling transit routes.

The Khazar Khaganate represented a serious military threat to Russia. Archaeologists have discovered a whole system of stone fortresses on the right bank of the Don, North Donets and Oskol. One white-stone stronghold was located at a distance of 10-20 kilometers from the other. The outposts were located on the right, western and northwestern banks of the rivers. An important role in the construction of these fortresses was played by Byzantine engineers. So, Sarkel (Belaya Vezha) on the bank of the Don was built by Byzantine engineers led by Petron Kamatir. Yes, and strengthened Itil Byzantines-Romans. The Khazar state played an important role in the military-political strategy of Constantinople, holding back Russia….

The Khazars made campaigns and raids in the Slavic-Russian lands. Arab geographer Al-Idrisi reported that Khazar vassals regularly made raids on the Slavs, in order to steal people for sale into slavery. These were not just spontaneous raids, from time to time, but a deliberate predatory strategy on the part of the parasite state. In the Khazar state, the power was seized by the Jews representing the caste of rakhdonites (radanity). This caste of international traders controlled trade between East and West, including the Silk Road and other communications. Their influence extended all the way to China and India. One of their main “goods” were people. The slave clan worshiped the “golden calf” and measured everything in gold.…

Certainly makes you wonder what history Putin has access to. To bad Tucker Carlson cut him off.

Next week I will get into the rabbithole I discovered when looking for the John Maynard Keynes Fabian connection.

TRUMP ASSASSINATION ATTEMPT


NOTE ADDED BY WOLF:

Please save all crucial information about the attempted assassination of President Trump HERE. There may be other articles later – we will make sure to link those HERE. Please also add reference links back to this post.

Thank you!

W


I am going to put this up fast. It will be a hodgepodge of data in no particular order… lots OF DATA!

My goal at this point is just to capture the information and not to actually write an article.

We will start with my raw notes THAT ARE ALL FROM SOMEONE ELSE. I am sorry if I ‘Stole’ your work without including your name. I AM NOT GOING TO DO QUOTES. It takes to long!

prognosticatasaurusrex(@prognosticatasaurusrex)

 July 18, 2024 14:43

#1307104

Afternoon Treepers. I have “held my mud” since Saturday to try and sort through all the lies and distortions on the assassination attempt. I think this stinks worse than day old tuna in the Sahara.

Lets state some OBVIOUS.

This is NOT incompetence. This was PLANNED. Meticulously PLANNED.

  1. Hint, it was NOT Crooks who did the planning
  2. Crooks was a set up radicalized PATSY
  3. SS, and some local PSP had to be in on it
  4. the cover up is WELL underway
  5. This will NOT go away or be explained away like 1963. The TRUTH is coming, and it will put the FINAL nails in the DS Cabal.

Guys. Lets be REAL here. NO ONE gets within 500 yards of a former and leading candidate for President in an outdoor setting with an ELEVATED position. NO ONE. There is a REASON that this had not happened since 1963. ALL elevated line of sight positions became the FIRST priority of the SS sight team.

Trump was a sitting duck. The SS and PSP had NO confusion on where to cover, that is complete horse shit. Remember my axiom. When the MSM or DS have to change a narrative more than ONCE, the original narrative, and ALL subsequent narrative to support it are a LIE.

As soon as the SS Director said the reason the roof at AGR was not covered was because of the pitch, I knew it was ALL a lie, and the circle jerk had began.

Too many “”omissions” for this to be mere incompetence.

1)Short perimeter instead of 500 yards it was 200, leaving the nice elevated and deserted AGR building just outside the SS “:perimeter.
2) Convenient “confusion” on what group was responsible for covering AGR )PSP or SS)
3) Supposed lack of comms between local, state, and SS LE running this site. NO WAY they were not ALL monitoring each others comms.
4) a suspect walks around with a range finder for HOURS before the event and NO ONE confronts him. SS and LE tactical units are trained to EXACTLY spot suspects like that. Loner, lurking around, scouting with a range finder…RIGHT.
5) SS supposedly stationed IN AGR building instead of ON the ROOF of AGR. Anyone that has ever been even moderately trained knows about sight lines, interlocking fire, triangulation, and the high ground. The FIRST thing is to scout and eliminate the OBVIOUS vulnerabilities. They did not, they left this OPEN, WIDE open, more on that in a bit.
6)the lack of air support even a drone. NO WAY someone of Trump’s stature politically is NOT given close air support, even infrared. To pretend that Trump was not a former President, not the presumptive Republican nominee, not the odds on favorite to once again be President, and did not have political threats and enemies looking to take him out, especially after Iran issued a threat that DAY is laughable. It is not just Trump, there were expected to be 20-5- THOUSAND people in attendance. Who are they trying to kid here.
7) a kid of 20, with no know military training was able to evade SS, with a range finder, a riffle, and perhaps a ladder, to find THE perfect spot. So close it was almost unbelievable. Like shooting fish in a barrel. Come on.
8) The PERFECT location was left WIDE open. No perimeter or roof presence, the building was likely deserted because it was a Saturday. The building was just far away enough to avoid regular LE detection. Easy road access, EASY roof access with concealment.. The perfect height and distance for line of sight. Hell the SS snipers positioned behind Trump could have just as easily been positioned at AGR for sight coverage. Why was it omitted? .
9) poor comms when the shooter was spotted (by the CROWD) no less than 30 minutes before he took the shots. 30 seconds would have been PLEANTY of time to remove the President AND neutralize the shooter. Which is EXACTLY what should have happened.
10) Trumps regular team was diverted, or over worked so that the pony tail brigade was brought in…furthering the “tragic circumstance” narrative

They did not need to WAIT to remove Trump, OR take out the shooter. See, not ONLY Trump was in DANGER. That is where their narrative FAILS. There were @ 20000 CIVILIANS there as well as Trump. The shooter could have EASILY randomly opened fire into the crowd after his initial volley at Trump. That ALONE was reason enough to terminate the target.

Think about it. person on WHITE roof, with a weapon, outside perimeter, aiming toward protectee AND crowd. 3 seconds to know that he was NOT part of the detail. One outside perimeter, two, NOT in SS or LE attire, three, no comms to suspect. Execute, bang…threat neutralized. Medals for valor conferred later, as well as TV appearances, and hero accolades for acting quickly and SAVING lives. Think I’m off base, try posing on a roof with a weapon outside any open air venue after Las Vegas. You will get properly ventilated expeditiously.

Now, back to the shooter. How did a kid from 1 hr away get the perfect location scouted? How did he KNOW there was not someone stationed on that roof waiting to take out a threat. How did he KNOW there was no close air support or elevated surveillance? How did he carry a ladder and a riffle around undetected?

Answer, he was TOLD where to go, where to set up, that he would be un accosted, and that he would have a free shot, be a “hero” and that he would get away. Bank on it. Hell, I bet the reason the ladder theory of 5 ft does not fit the building is because he did not NEED a ladder. Looks to me like that building has what we call a mechanical “penthouse” I bet the reason he was not seen at first is because he was either let in the building, or told where an unlocked door was and how to get to the roof position from INSIDE. Then he was seen by the CROWD as he crawled into position. Curious how that could happen.

Remember folks. It did not have to be a detailed comm message. Simply “possible shooter on the roof” would have sufficed.

Trump would have (should have) been immediately covered and rushed away. The shooter would have been targeted by the SS snipers and eliminated. Hell they were watching him purportedly for THREE minutes. “awaiting authorization to fire” BULL SCHIFF. Any ONE of the listed items could have been an oversight. The vast amount of “oversights” can only lead to ONE conclusion. .Trump was set up by insiders to be assassinated right before the convention when he had not yet named a VP. They were going to fill the vacuum with their DS choice, who would take the sympathy and be their Manchurian candidate puppet.

Almighty God had other ideas. That slight head turn, milliseconds before the bullet would have struck (it was already on its way) was NOT luck, it was not planned, it was God’s will and his hand. PERIOD.

Now, they are in full coverup mode, but this time, it is not still cameras, BW photos, or even grainy 35mm film that captured it ALL I GUARANTEE someone has some smoking gun video. They should not give it to the FBI so it will be lost or destroyed. They should give it to Trump or James O keefe. So the WORLD will see.

Lastly, LOTS of people KNEW this was supposed to happen. Why was THIS rally out of ALL the others so extensively covered by ALL the major networks…LIVE. Why was the AP photographer able to perfectly capture the bullet in flight in frame (because he was WAITING for the head shot…that is also why he used fast shutter speed, to capture the head explosion in gory detail) Why were politicians like Obama so quick to come out with statements? Answer because they were PRE written, and they only had to change a word from “attempted” to “assassination”

The Cabal left an opening, put in a patsy, and showed him the way to do it to a tee. Trump was supposed to die that day, and leave us all in morning with nowhere to turn. Their plan FAILED and now they are FUBAR. They KNOW IT.

The old adage holds. “If you are going to go after a king, you’d best not MISS”

They MISSED. I expect a LOT of mea culpa’s, fleeing the country, and yes even suicides soon. This was STUPID. They thought this was their way out, and it was 1963 all over again where they could take out the countries leader, line up a patsy and a BS story, and insert their puppet in our blind emotion.

EPIC FAIL

litenmaus(@litenmaus)

Online

Wolverine

 Reply to  prognosticatasaurusrex

 July 18, 2024 15:57

#1307156

No apologies rex, there’s a whole lot to this assassination attempt and it takes time and length to put the pieces together….I hope you don’t mind if I add the following as a consideration to be taken in regard to to your comment 6)the lack of air support even a drone.

I picked this up while I was crawling through social media this morning:

Anonymous insider testimony on the Trump shooter incident. This will eventually be submitted to the Congressional tip line. In the meanwhile, it’s your too! The people deserve to know.
My person has access to the PA State Police, Butler County Sheriffs, and Butler Police Department. Now let’s begin.
 
1. The water tower is still very much in play. 

2. The Pennsylvania State Police are usually allocated to events such as the Trump rally.

3. Secret Service told the State Police not to show up.

4. All SERT tech (Strategic Emergency Response Team) would have been leveraged by the State Police that were disinvited.

5. Tech for State SERT services also includes drones, bombs, and snipers.  So State Pol ice was not allocated and local police were only allocated to traffic control.

6. If SERT is the normal unit to provide permitted security and technology, how did the Secret Service intend to augment without them?

7. Only four state police were permitted onsite. They were stationed near to local police who had been restricted to crowd/vehicular traffic.

8. State SERT would normally be the team on the roof. (But the Secret Service told them not to show up.)

9. Sheriffs department is suggesting someone fell off the roof and broke both ankles. This has not yet been confirmed. [Would this be the local police officer that fell after he peeked over the edge and the cop that the Shooter pointed his weapon at?]

10. The Butler County Sheriff is largely corrupt. Many are questioning his messaging on Main Stream Media outlets. [such as this press announcement he gave on July 13, 2024: In a recent development, the Butler Police Department has announced the arrest of the suspect involved in the shooting incident targeting former President Trump. The alleged shooter has been identified as Mark Violets, who is reported to be a member of the Antifa group. Prior to the shooting, Violets posted a video on YouTube in which he ominously declared that “justice is coming.”

It appears to me that the Secret Service was deeply involved in perpetrating an assassination upon a political candidate…and it also appears at this time that the FBI, the DOJ, and the DHS are deeply involved in covering it up.

Cheato doesn’t deserve to be allowed to resign and walk away. She is a traitor who facilitated a murder against three civilians that her “team” put in harms way. I think she deserves to hang, but maybe that’s just me.

.

“Eyewitnesses from the ground who saw the shooter on the roof at the Butler Trump rally describe seeing snipers in the second story building of the AGR Building in Butler Township, Pennsylvania.

Speaking yesterday exclusively to the Gateway Pundit, the eyewitnesses said there is a lot more to the story that is not being reported by the mainstream media.

Though they could not get a clear look at them, they describe seeing one sniper in particular with a sleeve tattoo. The building staff had been chasing off Trump supporters earlier that day, people who wanted to walk up on the property to the security fence to get a better shot of America’s President. Later, when the group tried again the security was nowhere to be found so they went onto the field.

While there, they witnessed a man crawling on the roof and for what ABC admits is at least twenty minutes, and witnesses say was at least thirty minutes, trying to warn security as to what was going on, but there were no police and no security on this entire side of the Trump rally.

But they did notice some kind of security team inside the building on the second floor.
The windows for the second story were open so that the team of snipers inside had a clear view of the Trump Rally field.”

There are pictures from a drone showing windows in the article.

https://coldfury.com/WRSA/WRSA-WP/page/1

para59r(@para59r)

Offline

Coyote

 July 16, 2024 03:50

#1305441

Where we left off last night late at the end of our Monday thread was with some tweets from a CBS reporter Olivia Rinaldi and a live blog from CBS.
The way this news is presented is rather disjointed with mish mash of information crammed together. It certainly does not read like a cohesive piece but it is telling a very strange story of what occurred in Butler PA. By all means read it yourself but your going to have to keep plowing through it to get to the salient parts as it is disjointed IMO or maybe I don’t understand modern writing.
For the above reason I’m going to provide the basic out line.
In the building that Crooks fired from were 3 local police department snipers inside the same building Crooks fired from. They had visual contact with Crooks two to three times as Crooks sat outside the building fiddling with a range finder. At one point Crooks left but returned minutes later carrying a bag. Shortly after the police sniper team went outside after being alerted someone had gone up on the roof. When they went out and looked up onto the roof is when the cop looking got faced off by Crooks with Crook’s rifle turning on him. The cop dropped to the ground and before they could get back up on the roof, Crooks was already firing at the President, approximately 8 shots.
Now we switch over to the Snipers we’ve all been seeing with vids and pictures. That sniper team never got off a shot apparently. The ones that shot Crooks were on the roof of the other building next to theirs. They were covering the other side of the venue but readjusted when Crooks started shooting and engaged after the other team failed to engage and it is them that killed Crooks with one shot.

https://threadreaderapp.com/thread/1813021945958449180.html?utm_campaign=topunroll At the end of this thread reader it will link into the story below.

https://www.cbsnews.com/live-updates/trump-shooting-statement-joe-biden-updates/
There’s a video with this story that should be watched.

Other source showing the other SS Sniper team engaging Crooks

While much attention has been on one of the Secret Service Sniper teams posted closest to the shooter, line of sight analysis indicates a second team, here, was more likely responsible for the return fire that killed President Trump’s would-be assassin.

All unconfirmed. pic.twitter.com/UBaFDBZZES

FUNKER530 (@FunkerActual) 

July 14, 2024

In the above video you see Trump is still talking before the shooting. You also see the SS sniper team is already deployed from their primary sector of fire to their secondary sector of fire which means two things. Both sniper teams on both roofs knew about the threat before Crooks fired. For what ever reason the closest SS sniper team did not take a shot so the other team took it for them.

Here’s some conversation from the tweet in case you can’t read it. Some disambiguation on if it was this team or one much farther away then these two teams. These two are 120m and about 180m away and they are talking about another team about 400 plus meters away. Which is still close for well trained snipers given their gear.

Nikolai

@MisterGref

·

Jul 14

If there were line of sight issues with that specific roof top and building, the fact that it wasn’t secured or constantly monitored is a major lapse in security and seems negligent.

Countergrind

@Countergrind

·

Jul 14

Next question, how does one have knowledge of the threat, location of target, eyes on target, and yet security detail doesn’t move in to protect their man. Now, does that sound routine?

Denver Software Dev Guy

@WhoshotyaCo

·

Jul 14

The video of the other team looked like they were taking cover from shots. Never looked like they were shooting. These guys look far more likely. Good post.

Mrgunsngear

@Mrgunsngear

·

Jul 14

Agreed

John of Liberty

@JohnLibertador

·

18h

Erik Prince said the sniper who took out the shooter was 488 yds away. Likely from an angle that had visibility on the shooter who had cover behind the ridge of a roof from these guys.

Seems more plausible. You don’t risk bad shots when your teammate has a lock on a perfect one.

isardinas

@isardinas2

·

14h

I know some people are saying its the same shooters but The guys in one shot seem to be wearing boonies hats and the guys in the other shot seem to be wearing baseball caps. Or maybe I’m missing something

J C Adams

@Grampsknos

·

5h

If you haven’t already, check this out https://abs-0.twimg.com/emoji/v2/svg/261d.svghttps://abs-0.twimg.com/emoji/v2/svg/261d.svghttps://abs-0.twimg.com/emoji/v2/svg/1f440.svg Attempt on Pres Trump and response.

@SeniorChiefEXW

@jlawheartselon

@Sagebrush_Rebel

Old Goater

@OldGoater68

·

16h

Antihero podcast had info that sniper from 400+ meters away shot him, aiming between bleacher seats…it’s a must listen.

EvergentTek Comhttps://abs-0.twimg.com/emoji/v2/svg/1f451.svghttps://abs-0.twimg.com/emoji/v2/svg/2694.svghttps://abs-0.twimg.com/emoji/v2/svg/2623.svg

@EvergenttekCom

·

Jul 14

And that makes sense depending on what side of the roof slant the shooter was on. People keep pointing out sniper team one wasn’t firing but they were probably trying to get comms confirmation shooter wasn’t another sniper team.

So they were totally disorganized.

WolfM00n

….this point.

Crooks wasn’t stupid, to go up on the building where cops were operating from. That is extremely devious and smart. Note that he was not only boldly claiming the best vantage point – he was forcing the countersnipers to FIRE BACK ON THEIR OWN.

Think about that. He used a contradiction to suppress USSS fire. It was not incompetence. It was a brilliant strategy, programmed into him with MK technology.

We are up against some brutal adversaries, who know the USSS playbook, and have overcome it by a combination of agency weakening and strong MK tech.

PAVACA


Here’s what happened in PA.
MK-seduced “wanna-be assassin”, possibly “overshadowed” with “professional assassin(s), use BlackRock-owned facility as backdrop/stationing area to try and kill President Trump. Stationing area on roof of building hidden by “sudden” appearance of tall, thick trees (in contrast to the rest of the greenery around the building.) Possible “professional assassins” are stationed on water tower of facility.
“President Biden’s” handlers create “Jill Biden speech at local Italian-American League dinner” TO BE GIVEN ON THE SAME DAY as the assassination attempt on President Trump.
DHS and DEI-led USSS “possibly collaborate” to “divert” USSS protection for President Trump over to “Jill Biden speech at Italian-American League dinner.”
“Substitute” USSS team for President Trump includes some real USSS + untrained / unqualified / DEI hires from other departments.
Local LEO ** possibly ** told to “stand down” if “persons with ill intent” are noticed at President Trump’s rally.
USSS snipers at President Trumps’ rally literally wait until “wanna-be assassin” and/or “professional assassin” make their first shots BEFORE engaging. “Wanna-be assassin” becomes room temperature.
USSS “substitute team” at President Trump’s rally remove him from the scene. Removal clumsily and unsafely done — President Trump was exposed to more potential gunfire during the removal. At least two female “substitute USSS” ringers, too short and/or overweight, either panic or act unprofessionally.
Any questions?

 Google Maps street view of that location. It is from November 2023, the date is shown. This even shows the “new” looking mulch under the trees:

https://i.imgflip.com/8x876x.jpg

another theory
SeekerOfTruth
July 15, 2024 9:49 am

Rule #1 – Follow the money. Possible theory below.
BlackRock reveals link to failed Trump assassin The shooter appeared in a commercial for the investment behemoth   
Thomas Matthew Crooks, the suspect in Saturday’s attempted assassination of former US President Donald Trump, featured in a 2022 ad for BlackRock, the investment giant has revealed. 
There you have it! Let’s do the math. Black Rock bought the best assets in Ukraine for 10 cents on a dollar. Practically a theft. It enrolled the neo-Nazi regime. Unleashed NATO and ISIS. All to protect its investments. There comes Trump saying he will stop the war in 24 hours, forcing Ukraine to settle the conflict. Black Rock will lose billions if that were to happen. They dust off their shooter who appeared on their commercial and was not paid on the books – but off the books. Wait… there is more.
Black Rock calls its CIA assets to direct the Secret Service to ‘loosen up’ the security around Trump. This is why there were security mishaps, designed to allow the shooter to fire his shots. So, to stop the shooter from talking and revealing his Black Rock connection, he was shot dead. All scripted by Black Rock, but there was poor execution.
Black Rock is the one behind Ukraine war, there are others too. Last, do not count on an investigation or punishing the masterminds. They are the government within the government! Major conspiration similar to the one that killed JFK. his brother, MLK, Malcom X and John Lennon. 
Trillions of dollars are at risk. Blackrock has long wanted to steal the Rich mineral and Agriculture assets of Ukraine. and there you have the motive and setup. Large corporations control the government and other military and intelligence entities needed to make easy money for themselves (CEO and executives).
PS. The secret service is now a diversity DEI hiring group. Enough said about their performance. Bunch of bumbling keystone cops.

PAVACA(@pavaca)

Online

Coyote

 July 16, 2024 13:37

#1305704

DEI head of the Secret Service — IMO, complicit in the assassination attempt on President Trump, perhaps?

Prison, NOW. Biden’s Secret Service director admitted the decision to leave the roof unguarded was deliberate. And her rationale is insane. Absolutely insane. You cannot come to any other conclusion than this: Biden’s Secret Service and DHS deliberately created every single condition that led to Trump nearly being assassinated. They did it on purpose. They’re admitting they did it on purpose. And they’re fine with the results, which is why no one has been fired. How long until we discover the shooter was in communication with fed informants or assets prior to the event? Pretty wild how he just happened to pick the one event with the one spot that Biden’s Secret Service deliberately kept unguarded. https://t.co/jCZdlYqQDn

Sean Davis (@seanmdav) 

July 16, 2024

Secret Service director says the decision to leave the roof unguarded was deliberate, because it was unsafe to have snipers on a sloped roof. “That building in particular has a sloped roof at its highest point. And so, you know, there’s a safety factor that would be considered there that we wouldn’t want to put somebody up on a sloped roof,” Cheatle said. The director of the U.S. Secret Service deliberately allowed the former and future president of the United States to be shot in the face because she didn’t want a Secret Service agent to be on a roof with a minimal slope.https://dailymail.co.uk/news/article-13639613/amp/Secret-Service-director-wasnt-roof-gunman.html

https://media.scored.co/post/NnncyLqK8E4A.png
https://media.scored.co/post/NnncyLqK8E4A.png

The other issue is whether the roof has enough of a slope to be dangerous to anyone who was on it. Someone posted this pic, which is basically a flat roof.

https://media.scored.co/post/wvfZc5RuJDhy.png

Everyone needs to see this photo to appreciate the tactical negligence that occurred during the assassination attempt on DJT. This photo was taken just minutes before the first shots were fired. DJT is oriented towards the shooter at this point.

Look in the upper left of this photo. That is the building. Look how fucking close it was. Direct line of sight to DJT.

You can see my wife & I to the right of the SS agent in the front row.

There is no excuse to not have someone on that roof. None.

It amounts to the most stunning incompetence & negligence in a tactical situation that I have ever been a part of. Ever.

It’s simply incomprehensible to me how this happens.

The only thing that is more incomprehensible to me is how the Director of the Secret Service still has a job. — https://x.com/SeanParnellUSA/status/1813240829919539633

https://pbs.twimg.com/media/GSns7HDWYAAUtSX?format=jpg&name=small

Here’s rightscoop’s story on same. Says she’s not quitting… says some other things as well. Odd things. This also substantiates the CBS reporting.

https://therightscoop.com/breaking-secret-service-chief-reveals-bizarre-reason-why-agent-wasnt-on-the-roof-of-shooters-building-at-trump-rally

Wall Street Apes @WallStreetApes

WOAH Listen To This: Secret Service Director Kim Cheatle “She has close ties to the Cheneys, the Bidens and is responsible for the J6 deleted texts scandal”

She “evacuated vice president Dick Cheney on 9/11”

You can not tell me this wasn’t an inside job 🚨

“She would know. The 28 year veteran was on the team that evacuated vice president Dick Cheney on 911, and she served on then then vice president Biden’s protective detail. He named her director in mid 2022.

New election. Amid a swirl of controversy agency deleting nearly all of its text messages from January 6th.

The agency says that was due to a data migration. System migrations happen. But I think for a lot of Americans, it just doesn’t pass the smell test given the timing and the volume of messages deleted.

Well, it’s unfortunate that that would be the assumption that people would make. Our integrity is everything, and there was nothing nefarious attached to that.“

Keystone cops.

Some of this we have already heard. According to this report, the SS says it was not responsible for the rooftop where the shooter was because it was outside their perimeter. I call complete 🐂💩on that. There should be no outside perimeter for the SS. They should be overseeing everything.

The Butler police also say they were not responsible for that rooftop but that another local law enforcement agency was. The reporter does not know which agency that was. She says there were four cops. One of them got hoisted to the roof, looked the shooter in the eye, had a gun pointed at him, and dropped 8 feet to the ground. Because he was hanging on to the side of the building, he was not able to pull a weapon to engage the shooter and could not notify anyone.

So when the officers heard reports of a person on the roof from the rally attendees, instead of standing with the attendees and letting them show them where the guy was, they decided to peek over the side of the roof with no ladder, no ability to engage the shooter, and apparently no plan. It’s unbelievable.

Collin Rugg

@CollinRugg

NEW: Dan Bongino says an “unimpeachable source” tells him that someone was supposed to be on the roof where Thomas Crooks shot from but “didn’t show up.”

Bongino also claimed that the Biden admin is telling the USSS director to keep her mouth shut if she wants to keep her job.

According to my source, that roof was supposed to be a police post… [there] was so supposed to be someone there.”

They’re now making up excuses saying the pitch of the roof. My source says to me that no one knows why the post didn’t show up.”

I was also told that the USSS director has been given instructions from the administration and the DHS secretary: ‘If you wanna keep your job, you’ll keep your mouth shut about this.’”

Video: @ColumbiaBugle

Why they didn’t put people on the roof of the building where Crooks shot from.

That building in particular has a sloped roof at its highest point. And so, you know, there’s a safety factor that would be considered there that we wouldn’t want to put somebody up on a sloped roof,’ she told ABC News in an interview Tuesday.

And so, you know, the decision was made to secure the building, from inside.’

Meanwhile I’m wondering how long we can keep it a secret from her that the other two locations where snipers were deployed had a march higher and sharper roof.

Or the fact that the same building complex had other roofs, one of which was flat and higher than the one chosen by Crooks and would have been a great vantage point in all directions to include the roof below them where Crooks set up.

Heck they could of tossed rocks at the guy and accomplished the mission of keeping the president safe. “plink! plink! plink! Hey you laying down there with the gun! Don’t make us come down there! . Plink! Go on get!”.

Trump rally shooting could have been MUCH worse
Police and Secret Service locked themselves inside the security fence and were not able to get to Thomas Crooks. If counter-snipers had not already taken him out, he’d have time to use all his ammo on crowd

Scattered through the short article.

Shooter.

  • Bought a ladder.
  • Carried a very tall ladder past SS, to get on the roof.
  • Picture of the ladder against the building in the article.
  • Ladder barely reaches roofline.
  • Dope drove a Hyundai Sonata an hour to the rally site.
  • Article says ladder purchased was five foot ladder. <<< ???
  • “It’s not clear whether Crooks used the ammunition or the ladder that he bought on Saturday during his attack later that day.” However, a ladder was prominently propped up against the building where Crooks would shoot from.

Purchased 50 rounds of ammo from gun store. No mention of caliber…

Failed Trump Assassin Purchased Ladder and 50 Rounds of Ammo on the Morning of the Rally, According to New Report
https://www.thegatewaypundit.com/2024/07/failed-trump-assassin-purchased-ladder-50-rounds-ammo/

Elon Musk

@elonmusk

Looks very slopey …

DogeDesigner

@cb_doge

·

Just a picture of a Secret Service agent standing on the roof of the White House.

https://pbs.twimg.com/media/GSoYypJakAA2kzt?format=png&name=small

2024

Trump assassin

another theory
SeekerOfTruth
July 15, 2024 9:49 am

Rule #1 – Follow the money. Possible theory below.
BlackRock reveals link to failed Trump assassin The shooter appeared in a commercial for the investment behemoth   
Thomas Matthew Crooks, the suspect in Saturday’s attempted assassination of former US President Donald Trump, featured in a 2022 ad for BlackRock, the investment giant has revealed. 
There you have it! Let’s do the math. Black Rock bought the best assets in Ukraine for 10 cents on a dollar. Practically a theft. It enrolled the neo-Nazi regime. Unleashed NATO and ISIS. All to protect its investments. There comes Trump saying he will stop the war in 24 hours, forcing Ukraine to settle the conflict. Black Rock will lose billions if that were to happen. They dust off their shooter who appeared on their commercial and was not paid on the books – but off the books. Wait… there is more.
Black Rock calls its CIA assets to direct the Secret Service to ‘loosen up’ the security around Trump. This is why there were security mishaps, designed to allow the shooter to fire his shots. So, to stop the shooter from talking and revealing his Black Rock connection, he was shot dead. All scripted by Black Rock, but there was poor execution.
Black Rock is the one behind Ukraine war, there are others too. Last, do not count on an investigation or punishing the masterminds. They are the government within the government! Major conspiration similar to the one that killed JFK. his brother, MLK, Malcom X and John Lennon. 
Trillions of dollars are at risk. Blackrock has long wanted to steal the Rich mineral and Agriculture assets of Ukraine. and there you have the motive and setup. Large corporations control the government and other military and intelligence entities needed to make easy money for themselves (CEO and executives).
PS. The secret service is now a diversity DEI hiring group. Enough said about their performance. Bunch of bumbling keystone cops.

Here is the BlackRock commercial!

Notice that it’s connected to TEACHERS’ PENSIONS.

Laura Loomer

@LauraLoomer

EXCLUSIVE:

🚨🚨🚨 NEW REPORT🚨🚨🚨

ALARMING NEW DETAILS AROUND THE BUILDING USED BY THE SHOOTER TO ALMOST ASSASSINATE PRESIDENT TRUMP!

WHY IS THE COMPANY THAT OWNS THE BUILDING NOT TALKING? AND WHY HAVE THEY NOT RELEASED A STATEMENT?

AGR International, the building Thomas Matthew Crooks shot from, was just sold in March to a Clayton, Dubilier and Rice (CD&R)

@CDRBuilds

subsidiary called INDICOR.

It is worth noting that Joseph L. Rice III is the Founder of Clayton, Dubilier & Rice. Rice is a member of the Council on Foreign Relations and he is also a member of the Brookings Institution, the same Brookings institute

@BrookingsInst

that has perpetuated lawfare campaigns against President Trump in an effort to keep him off the ballot for the 2024 Presidential election.

It’s important for people to understand how the DEEP STATE has a history of using proprietary companies as cutouts.

According to filings and their own press releases, Indicor was officially formed in Jan 2023 by CD&R, who just partnered Jon Selib

@Jselib

.

Prior to joining CD&R, Jon Selib was the Senior Vice President of Global policy and public affairs and Pfizer, a position he remained in until 2022.

As the Senior VP of Global policy and public affairs for

@Pfizer

, Selib was a MAX DONOR to Joe Biden’s campaign when he ran against President Trump.

The current CEO of Indicor is Doug Wright, who was previously deployed with defense contractor Raytheon Technologies. Doug Wright, CEO of Indicor, confirmed that “law enforcement was on the premises of the building before the shooting took place”, since it was deemed to be a high security risk location by the Secret Service. Wright also said the office was closed on the day of the attempted assassination of President Trump.

Roberto Quarta is the Chairman of the Private Equity group (CD&R) that owns Indicor/AGR. His photo is listed on the World Economic Forum (WEF)

@wef

website.

Oddly enough, John Stroup the Indicor Chairman and CD&R partner, recently announced his resignation from the board of directors of Crane Company on June 5th, 2024, effective July 22nd, 2024.

On March 18, 2024, the change of registered office by entity for the building the shooter shot from was changed to “Corporation Service Company”. Corporation Service Company is registered as a foreign business corporation in Delaware.

In December 2023, CD&R made Jon Selib a partner, after he joined CD&R in 2022. Selib was the former chief of Staff to Democrat Montana Senator Max Baucus

@MaxBaucus

(D), the Chairman of the Senate Finance Committee. In 2013, Barack Obama chose Senator Baucus to be the US ambassador to CHINA.

Selib spent 12 years working in the US Senate and became Chief of Staff to Senator Baucus after Baucus’ former chief of staff Jim Messina left to fill the same position for Democrat Barack Obama’s presidential campaign.

In 2020, Ambassador Baucus went on CNN and said President Trump’s rhetorical attacks on China make him “a little bit like Hitler” when President Trump was blaming China for the COVID outbreak.

Ambassador Baucus currently lives in Bozeman, Montana, where he and his wife, Melodee Hanes, formed a consulting firm called Baucus Group LLC. Ambassador Baucus provides consulting services to American and Chinese businesses and he serves on the Board of Directors of Ingram Micro, and the Board of Advisors to the Chinese Communist Party owned Alibaba Group. https://x.com/LauraLoomer/status/1813962283673903535/photo/3

Screenshot: https://i.postimg.cc/cH4W3mMh/Re-the-bldg-in-Butler-PA-where-assassin-whot-at-Trump-13-July-2024.jpg


litenmaus
(@litenmaus)

Online

Wolverine

 Reply to  PAVACA

 July 18, 2024 14:20

#1307089

And through the tangle of it all one word jumps out “Pfizer”

According to filings and their own press releases, Indicor was officially formed in Jan 2023 by CD&R who just partnered with Jon Selib.

Prior to joining CD&R, Jon Selib was the Senior Vice President of Global policy and public affairs at PFIZER, a position he remained in until 2022. As the Senior VP of Global policy and public affairs for Pfizer, Selib was a MAX DONOR to Joe Biden’s campaign when he ran against President Trump.


Wolf Moon | Threat to Demonocracy
(@wolfmoon1776)

Offline

Wolf

 Reply to  pat frederick

 July 15, 2024 10:53

Excellent. All speculation, but it’s speculation in the right direction.

CUI BONO.

Reader’s Digest version from the article.

Malice Or Massive Incompetence”: Erik Prince Gives Detailed Assessment Of Secret Service Failure
Former Navy Seal and Blackwater founder Erik Prince gave a detailed assessment of yesterday’s Secret Service debacle in the wake of a failed assassination attempt on former President Trump.

DJT was not saved by USSS brilliance. The fact that USSS allowed a rifle armed shooter within 150yds to a preplanned event is either malice or massive incompetence.

The law enforcement sniper (unclear if USSS) in newsreels was clearly overwhelmed as his face came off his rifle instead of doing his job to kill the shooter. 

Clearly USSS failed at the basics of a secure perimeter and once shots were fired their extraction was clumsy and left DJT highly exposed to follow on attacks

Merit and execution must be the only deciding factors in hiring and leadership, not the social engineering priority of the day

When looking at the circumstances in favor of Thomas Matthew Crooks, the identified alleged suspect in the attempted assassination of Donald Trump in Butler, PA, it’s hard to see how the guy failed.  

The rooftop used by Crooks was a mere 140 yards away from the event with a clear line of sight to the right of Trump

The Secret Service is supposed to secure all obvious “sniper perches” well before the arrival of a protectee –

The idea of Crooks being able to get that close with an elevated position on the stage is unthinkable

Finally, there’s the dismal lack of response time.

https://www.zerohedge.com/political/massive-secret-service-failure-led-nearly-successful-assassination-donald-trump

Stuck on this…

WHY did the sniper hesitate to take out the threat?

  • Today we are to believe protocols NOT followed. (Under the bus)
  • Permission to fire NOT required. (Bullshit. Show me the Rules of Engagement.)

pgroup2(@pgroup2)

Offline

Coyote

 Reply to  kalbokalbs

 July 15, 2024 09:38

#1304620

Why?

Pretty simple, actually.

That building was supposed to be secured by local police. The snipers in the pic were local cops. They knew that. At first, they thought it was one of their guys, doing the same job they were doing.

One of the sniper cops lifted his head from a ready-to-shoot position to get a different look at the rooftop person, probably because he heard people yelling and pointing at the killer’s perch. They didn’t realize he was a threat until the killer took his shots.

They immediately fired on the killer, although the actual neutralizing shot could have come from USSS sniper team at a different location.

Two trillion dollar deficit, massive budget increase for IRS, yet USSS has bread-and-water rations for its budget.

Plus a D E I bitch for a leader. A cherry on top of a shit sundae.

Not to mention, but… President Trump should have been secured at the 1st HINT of an issue.

kalbokalbs

Candidate Trump rally Reno, NV November 2016.

Someone near the stage yelled “gun”.

SS rushed Trump off stage.

Crowd tackled the asshole. SS & LE took him away.

Slow guy in the crowd, ~100′ from excitement. No one ran.

Trump return in, I’m guessing <ten minutes.

i read this, this morning. true? not sure. but it makes sense in a way–kill a guy who’s got a telescope? seems out there, but maybe that IS their policy. I dunno.

Susan Crabtree

@susancrabtree
Here’s my reporting on why the Secret Service did not shoot until AFTER the shooter engaged and some context about the House Republicans’ investigation already underway (months before Trump’s assassination attempt) into whether the agency’s DEI policies are affecting its readiness. The blowback against the Secret Service started within the hour of the assassination attempt and continued even after Trump and other credited the agency with saving Trump’s life by quickly killing a shooter crawling across a nearby rooftop. 
But a source within the Secret Service community tells RealClearPolitics that the agency rules of engagement in this situation are to wait until the president is fired upon to return fire. “You want to take a shot then find out the guy was holding a telescope?” the source suggested. “The Secret Service is by nature reactive…and you better be right when you do react or you’re f—–d.” The Secret Service protocol requires that a counter sniper aware of a potential shooter to radio directly to intelligence division team to respond and investigate. In this case, the investigation may have been cut short by the shooter firing his weapon, so the counter sniper then fired as quickly as possible in return. The source praised the counter sniper who acquired the target and responded within three seconds, calling their performance “incredible.” “The counter snipers are highly trained and extremely accurate,” he said. Others with law enforcement and military backgrounds want to know whether the Secret Service utilized drones, i.e. small unmanned aircraft systems, to provide detailed situational awareness.
If the agency did not use drones, why not, these experts ask. The use of drones has been a controversial issue within the agency since at least 2016. Implementing drones would have provided detailed line-of-site analysis and aerial surveillance that would have easily identified the rooftop as a potential threat area. “The USSS has access to all the best imagery and elevation data,” the military expert told RCP. “I’m not saying they didn’t [use drones], but it’s an open question.” 
The once vaunted Secret Service lost some of its former respect after a string of fence-jumping incidents and other security lapses came to light during the Obama administration. At the beginning of the Trump administration, a senior special agent in the Secret Service came under fire for suggesting in a Facebook post that she wouldn’t “take a bullet” for Trump. Kerry O’Grady, the former agent in question, was placed on administrative leave but was allowed to retire with full benefits, which outraged many in the Secret Service community. 
The agency, more recently, has come under scrutiny for its diversity, equity and inclusion policies, after a female agency attached to Vice President Kamala Harris’s protective detail and identified as Michelle Herczeg, had an apparent mental breakdown and physically attacked her senior officers at Joint Base Andrews before a trip. An agency spokesman called the issue a “medical incident,” but other members of the Secret Service launched a petition over the agency’s diversity, equity and inclusion hiring and vetting policies during the Biden administration, as first reported by RCP. 
In addition, after the attempted assassination of Trump Saturday night, conservatives blasted Rep. Bennie Thompson, the ranking Democrat on the House Homeland Security Committee, for earlier this year introducing a bill co-sponsored by several other Democrats that would have denied Service Service protection to Trump if he were convicted of a felony. The measure never gained traction in the GOP-controlled House. After the attempted assassination, which killed one innocent spectator and injured at least two others, Thompson tweeted that he is “glad that the former president is safe” and is “gratefully for law enforcement’s fast response.”

Wolf Moon | Threat to Demonocracy(@wolfmoon1776)

Offline

Wolf

 Reply to  pat frederick

 July 15, 2024 12:01

Pat – this is key – this is how the bad side controls evil outcomes through good intentions.

FIRST – remember what Sundance calls them – the INTELLIGENCE BRANCH.

Now look at this quote from what you posted…..

The Secret Service protocol requires that a counter sniper aware of a potential shooter to radio directly to intelligence division team to respond and investigate.

This is how they took over DOJ, too – using the “NSD” – the National Security Division. It’s the same thing. The shadow government uses the “intelligence group” within agencies to control them.

The Intelligence Branch can control outcomes in the Secret Service.

Now keep looking at why Trump survived.

In this case, the investigation may have been cut short by the shooter firing his weapon, so the counter sniper then fired as quickly as possible in return.

This broke the USSS out of the IC control loop!!!

The source praised the counter sniper who acquired the target and responded within three seconds, calling their performance “incredible.” “The counter snipers are highly trained and extremely accurate,” he said.

That 3 seconds CONFIRMS the audio of the shots, and my assessment of the first six bullets.

Crooks fired three shots in the video I watched, at 8.0, 9.0 and 9.9 seconds, with the countersniper getting three shots back at 12.0-13.0 seconds.

The head shot to the assassin happened at 24 seconds.

This is how the wicked Comey IC takes over. SS is under shadow government control, and they use “good things” as cover for bad things.

The same IC has total compartmentalization and deniability on weakening USSS and then sending secret forces against their hobbled Secret Service. Quite evil.

Trump assassination

https://mobile.twitter.com/Jordan_Sather_/status/1096442650687725568?p=v

New #QAnon. I believe Q to be saying “Bigger than 25th amendment attempt to remove”, meaning there have already been major assassination attempts on @realDonaldTrump, and we have evidence for these. Let’s thread down memory lane for the backstory. pic.twitter.com/juNXMT2JK9

Last year on June 12th, Q posted this photo of what looked to be a missile, saying “this is not a game”. This photo was taken June 10th overlooking Whidbey Island in WA by a weather photographer. When this was taken, Trump was on his way to the summit with N Korea in Asia. pic.twitter.com/G8wTSnbp8d

The mainstream media tried playing this off as “just a helicopter” that the photograph was taken of. The cover story Q was mentioning today. That sure looks like a photo of a helicopter to me. (not) pic.twitter.com/nOCHIrlBCY

Back on June 12th, Q then quickly gave us this saying “think hack”, which could infer that rogue actors hacked the sub that launched the missile directed at AF1 en route to Asia. pic.twitter.com/xYi0CxpwzB

Ironically on June 8th, 2 days before the “helicopter” incident, the MSM reported that “China Hacked U.S. Navy Contractor To Obtain Sub Secrets”. Were they setting up the markers for a false flag here? If POTUS was downed, blame on China? Interesting. huffingtonpost.com/entry/china-ha…

https://t.co/8mCRFEZ4tz

China Hacked U.S. Navy Contractor To Obtain Sub Secrets: Report

News comes a day after Trump agrees to drop sanctions against Chinese telecom giant ZTE.

Thankfully, an assassination never happened. A few hours before posting about the missile and sub on June 12th, Q gave us this photograph, which Anons determined was an original photo from Q taken over Alaska. If you zoom in, you can see it looks like the missile was intercepted. pic.twitter.com/uoN1G0u3tH

Q posted today, “Coincidence re: AF1 re: CA route NK?” A flight path from California to the Korea’s would take you over a small portion of Alaska’s Aleutian Islands, which has 57 volcanoes. More evidence that our photograph above was the missile interception. pic.twitter.com/JA2B6mYiXR

Then, in another Q post from this morning, they linked a tweet from @SevenFlamingos, who noticed that the US Army tweeted about the THAAD anti-ballistic missile defense system the same day Q brought back the June 12th “helicopter/missile” incident. What a coincidence. pic.twitter.com/TmHCXOVkwM

In a quick search on THAAD, I found this Stars & Stripes article about a successful test over the North Pacific last year. “The target missile… was detected, tracked and intercepted by a THAAD battery at Pacific Spaceport Complex Alaska in Kodiak..” stripes.com/news/pacific/a…

Kodiak, that’s right there next to the Aleutian Islands. If there was, in fact, a missile heading for AF1, the THAAD system based in Kodiak is likely what was activated to take it down >> Q’s photograph over Alaska of what looked to be an intercepted missile. pic.twitter.com/r6wPplJqpP

So let’s hypothetically say… A president for freedom, truth, and prosperity that a horribly corrupted Deep State wants to take out is on his way to North Korea. The jet that the president is in is heading from CA to Asia over the North Pacific.

They send a missile his way, hacked from a sub near Whidbey Island, WA. Missile gets taken out by THAAD missile defense systems over Alaskan islands in the North Pacific. We learn of this all through hints told via a backchannel communication line popularly known as #Qanon

Moral of the story, don’t f*ck with the military. The president is very well insulated, and him and his family are putting their lives on the line for us. These corrupted Deep State folks will go to no ends to avoid defeat, but their defeat is inevitable. Hypothetically. /end

Kalbo says: <i>”…. I hope they have proof of that bottom line…and and every detail back to its inception…..”</i>

….

OH, I think they do!

1. PDJT campaign to have Nasty Nan the Pigloser as Speaker of the House.

<a href=”https://theconservativetreehouse.com/2018/08/10/president-trump-urges-democrats-to-support-nancy-pelosi/”>President Trump Urges Democrats to Support Nancy Pelosi</a>

2. PDJT shuts down government.

3. Nasty Nan and 100 of her friends and family take a bus to the airport to catch a Government Plane to EU andthen Afghanistan. This included:

Adam Schiff, D-CA

Mark Takano, D-CA

Susan Davis, D-CA

Stephen Lynch, D-MA

Eliot Engel, D-NY

Elaine Luria, D-VA

4. While in route, PDJT orders the plane GROUNDED!

<a href=”https://theconservativetreehouse.com/2019/01/17/president-trump-cancels-speaker-pelosi-overseas-trip/”>President Trump Cancels Speaker Pelosi Overseas Trip…</a>

<blockquote> Hilarious Trump waited to release the letter while Nancy was en route to the airport and law makers were on a Air Force bus about to depart for the airport.

— The TRUMP PAGE (@MichaelDelauzon) January 17, 2019</blockquote>

5. MEANWHILE the FIB catches a Jihadist in Atlanta GA buying anti-tank weapons, small arms and such for a planned attack on the White House and other parts of DC. (We are not told anything further, but the possibility exist the Jihadist was one of a group.) This attack could have taken out BOTH PDJT AND VP PENCE, leaving Nasty Nan as president…. Who was ‘convienently’ out of DC at the time of the attack.

From INFOWARS…

<i>”…The suspect allegedly <b>planned on using IEDs and an anti-tank rocket to inflict “mass casualties,”</b> reports WSBTV.com.

“His alleged intent was to attack the White House and other targets of opportunity in the Washington, D.C. area,” the U.S. attorney for the Northern District of Georgia Byung Pak told reporters….

<blockquote>ABC News…

[…]Taheb allegedly told the informant that “jihad was the best deed in Islam and the peak of Islam,” adding that “it was not complicated at all to do jihad today,” according to the complaint.

In a meeting with the informant and an undercover FBI agent on Dec. 2, Taheb allegedly stated that “they could do more damage” in the U.S. because abroad they would be “one of many.” He also allegedly said that he wanted to be a “martyr” and cause as much damage as possible, the complaint states.

[…]<b>“He said the group would fight to the end and make it a big bang,”</b> according to the document.

[…]…He also discussed the need for <b>a “base” where they could regroup</b> and “give a speech to motivate people” and show clips of “oppressed Muslims,” the document states.

https://abcnews.go.com/beta-story-container/US/fbi-arrests-georgia-man-allegedly-plotting-attack-white/story?id=60429215 </blockquote>

6. That this was the plan was hinted at by Nasty Nan’s claims at the time that she was CO-EQUAL to President Trump (preparing for her ascent to the White house maybe?)

https://wqth.files.wordpress.com/2019/01/fall_of_the_house_of_commies.png

<b>And a really wierd tweet indicating she was about to become president.</b> (Sorry I did not save it but it was commented on OT at the time)

………….

This was not the first attempt:

https://mobile.twitter.com/Jordan_Sather_/status/1096442650687725568?p=v

<i>New #QAnon. I believe Q to be saying “Bigger than 25th amendment attempt to remove”, meaning there have already been major assassination attempts on @realDonaldTrump, and we have evidence for these. Let’s thread down memory lane for the backstory. pic.twitter.com/juNXMT2JK9

Last year on June 12th, Q posted this photo of what looked to be a missile, saying “this is not a game”. This photo was taken June 10th overlooking Whidbey Island in WA by a weather photographer. When this was taken, Trump was on his way to the summit with N Korea in Asia. pic.twitter.com/G8wTSnbp8d

The mainstream media tried playing this off as “just a helicopter” that the photograph was taken of. The cover story Q was mentioning today. That sure looks like a photo of a helicopter to me. (not) pic.twitter.com/nOCHIrlBCY </i>

Nor was it the last…

Alison

As a reminder, Doug Leone of Sequoia Capital publicly voiced his support for Trump 6 weeks ago.

Silicon Valley has shifted. https://t.co/MjFT50HPgW

Elon Musk (@elonmusk) July 16, 2024

I know venture capital in CA from 2 decades in that field. I cannot overstate that this quote coming from a Sequoia Capital partner is HUGE.


litenmaus
(@litenmaus)

Offline

Wolverine

 Reply to  Alison

 July 16, 2024 19:57

#1305923

Additional information for your considerations:

June 16, 2023

Sequoia Capital is the biggest US Venture Capitalist firm in China & they’ve been caught investing US Pension fund $$ into Chinese Military Tech Industries

Sequoia is largest US tech investor in China, including TikTok. Sequoia has been paying GOP members, *millions* to not investigate & to protect Adam Schiff

The biggest US investor in Chinese businesses is also one of the biggest GOP donors in the House & Senate.
The man in charge of Sequoia is Doug Leone, an agent for the Chinese Communist Party.

We now know why House Intelligence Committee Representative Mike Turner protected Adam Schiff from censure.

Speaker of the House, Kevin McCarthy’s top donor, has become Doug Leone (and wife) from Sequoia. 

Jeopardizing America’s security while funding China’s rise damages US economic growth and poses grave threat to the nation.

I can only assume that PDJT is adhering to the old adage: “Keep your friends close and your enemies closer.”

This was posted shortly after Trump was shot and is worthy of consideration:

The building that the shooter was on is owned by AGR aka American Glass Research. They specialize in the manufacturing of various glass products.
AGR was bought in March 2020 by Indicor.

Indicor’s website indicates that Indicor is a freestanding, diversified industrial solutions company formed in 2022 by CD&R. It owns and operates a portfolio of industrial businesses that provide specialized, highly-engineered, mission-critical products and solutions for manufacturers. Indicorruns their companies under the ESG Green New Deal ideology.

Indicor’s Certified Equity Professional is Doug Wright, who used to work for Raytheon, Honeywell and Ingersoll Rand.

Honeywell & Raytheon both refused to donate to any persons who voted against certifying Joe Biden’s 81 Million votes on January 6. Both Honeywell & Raytheon are government contractors.

Alex Soro’s infamous “assassination” tweet from January 21, 2024 features a photo of glass with a bullet hole in it and the fact that Trump’s would be assassin fired from the roof of a glass factory seems to be quite a coinky dink.

@VigilantFox

Jul 17

Replying to @KanekoaTheGreat

One or two mistakes is one thing. But when you have 10-plus anomalies on the same day, it certainly begins to look intentional. Here’s a summary, as provided by @McCulloughFund: 1. No local law enforcement was on the rooftop used by the shooter. 2. When law enforcement was notified by citizens of the shooter, there was no prompt action at the rooftop to neutralize the shooter. 3. Local law enforcement failed to initiate active shooter protocol to protect Trump and the crowd. 4. There was no apparent communication from local law enforcement to the USSS to get Trump to a secure location. 5. Police snipers on the roof used binoculars to track the shooter’s position and did not warn the USSS below to get Trump off the stage. 6. Police snipers under scope vision allowed the shooter to get set and shoot six rounds at Trump. 7. A police sniper got off the scope and looked with the naked eye to be sure the shooter had taken his shots and never looked down at Trump. 8. Finally, a police sniper shot Crooks. 9. No local police went up on the roof immediately after Crooks was shot to take away his gun and check on his status. 10. All the while, there was no active shooter protocol, and no warning was given to Trump or the audience.

https://nitter.poast.org/KanekoaTheGreat/status/1813635459861606611#m

𝐁𝐑𝐄𝐀𝐊𝐈𝐍𝐆: Austin Private Wealth with CONNECTIONS to the Bush family shorted 12M shares of $DJT via a put option on July 12, just ONE DAY before the assassination attempt. Did the Bush’s know something was going to happen to Donald Trump? This massive trade represents 6% of total shares and over 16% of the float, given Trump’s 60% ownership. Their $1B AUM makes this a significant bet. Austin Private Wealth is connected to the Bush family through James A. Baker III, a Senior Policy Director with longstanding ties to the Bushes, having served as Secretary of State under George H.W. Bush and in various roles under Ronald Reagan and George W. Bush. George W. Bush has strongly shared his support AGAINST Trump despite everything happening in our country. While these connections don’t imply direct involvement, they highlight significant professional relationships.. Sources: @JoshWalkos, @Gene_SD

https://nitter.poast.org/legislationpage/status/1813728208547709270


marymorse
(@morsearchitecture)

Offline

 Reply to  TheseTruths

 July 18, 2024 07:26

Traffic detail, you say?

Allegheny County PD covers the airport & provides motorcycle escort for VIP’s to & from VIP events. ACPD sent 10 motorcycle patrols to the rally.

Two supervisors dispatched were “unauthorized”, & later “transferred” according to local report:

https://www.wpxi.com/news/investigates/11-investigates-exclusive-pittsburgh-motorcycle-officers-transferred-after-working-trump-rally/4V43BKBXYBAN3PPHJTLK4FR4ZM

Superintendent of ACPD is appointed by the Allegheny County Executive. The current AC Executive met Jill Biden at the airport on 7/13 @ 4 PM according to reports.

The current ACPD Superintendent was appointed by Rich Fitzgerald in his final term as AC Executive.

https://www.cbsnews.com/pittsburgh/news/vice-president-joe-biden-speaks-rich-fitzgerald-reelection-party

In 2021, Allegheny County “Reimagined” Public Safety.
https://www.1hood.org/publicsafety

Shooter lived in Bethel Park, part of the jurisdiction of ACPD.

Where’s that suspicious cat? 😺

11

 Reply

marymorse(@morsearchitecture)

Offline

 Reply to  marymorse

 July 18, 2024 07:34

#1306845

Here’s the Reimagine Public Safety Report for Allegheny County:

https://www.1hood.org/s/CommunityPolicingReport.pdf

Possibly a stretch but could it be? See Pg.7, photo taken at Allegheny County Jail, extreme left of photo, back row, loner in hoodie face obscured by purple gloved fist….

Stephen Gardner video

Bongino POINTS OUT something everyone missed | New Trump Shooting Facts (36 min)

13:25 Columnist Max Boot [weekly column @ The Washington Post and a senior fellow at the Council on Foreign Relations] the man who propagated the Trump-Russia collusion story is MARRIED TO A FOREIGN SPY! [From internet: His Wife Sue Mi Terry Sue Mi Terry, a former CIA analyst and wife of Washington Post columnist Max Boot, has been indicted on charges of failing to register as a foreign agent and conspiring to violate the Foreign Agents Registration Act (FARA). Terry worked as an agent for the government of South Korea, receiving luxury gifts and covert payments in exchange for promoting South Korea’s policy positions and disclosing sensitive non-public government information.]

16:20 Senator Josh Hawley (R-Mo.), meeting with whistle-blowers behind closed doors. Potus Trump was purposely given inexperienced, and in adequate coverage on the day of the butler PA rally.

[Here is what was said. -GC]

https://www.hawley.senate.gov/hawley-reveals-new-whistleblower-allegations-exposing-loose-security-ahead-of-trump-assassination-attempt

Hawley Reveals New Whistleblower Allegations Exposing ‘Loose’ Security Ahead of Trump Assassination Attempt

Friday, July 19, 2024

Today, U.S. Senator Josh Hawley (R-Mo.), wrote a letter to Department of Homeland Security (DHS) Secretary Alejandro Mayorkas, demanding answers behind the U.S. Secret Service’s botched security rollout at President Donald Trump’s July 13 rally. The letter comes after multiple whistleblowers contacted Senator Hawley’s office with disturbing new information behind the assassination attempt on the former president.

21:30, Gardner mentions the shorting of Trump stock and ALSO RUMBLE. [Think Game Stop and the attempted destruction of that company]

21:58 is the actual Bongino Clip

“There is a serious dispute right now going on with the SS. The SS knows that there were some lapses on the side of locals.

[Robert Barnes in an earlier Viva Frei video — https://rumble.com/v56wunx-trump-assssination-attempt-rnc-in-milwaukee-baldwin-charges-dismissed-and-m.html — said PA Leo are VERY Corrupt. He is fighting a case there wher a women is going to prison for video taping HER OWN TRIAL! ]

There were — TIMEOUT –IT IS THE SECRET SERVICES FAULT It’s their job to secure the Presidents life, I get that, period.

They do have local partners however. There were some significant lapses. Here’s What I’m hearing. There is an Actual Text Record, so it’s not disputable. there’s text. Phone text, you know what I mean right? That this threat may have been recognized at about 05:01 PM an hour before Donald Trump got on stage. And there are some people telling me that there was a failure in the beginning to properly get that information out. I’m just telling you what I am hearing.

And let me give you the other side. The Locals and some of the Butler County officials are disputing that saying, Hey, we told the secret service about the threat and they didn’t do anything. That is going to come out in the wash, once we get these records FOIA’d and out in the public. [GOOD LUCK WITH THAT DAN. I am sure they are already shredded and wiped, “Like with a cloth”. -GC] You’re going to see via the text record who was notified when and what was done about it. I’m hearing from Secret Service sources that it was roughly a 1/2 an hour. In other words, 5:31 before they got a picture of this potential threat.

Folks again this is coming from the top.

Now, the Secret Service has a political problem right now. The political problem is serious. The Secret Service needs local partners to do protection. Follow me, because this is really important.

They can not do their job without local police departments. NYPD, LAPD…Butler county. It’s not possible. The Secret Service has what 5 to 6000 agents now, or when I was there it was like 3000 or so. It is not physically possible to do presidential protection with out Law Enforcement.

They are not only partners, they are integral partners. You get what I am saying? They are in a real Political Quandary Right Now. And I do not feel bad for anyone… They SCREWED UP PERIOD.

They do not want to throw the locals under the bus after they appeared to throw the locals under the bus. So they are in this bind right now.

Now my advice to them, if you’re listening right now is Ladies and Gentlemen the truth doesn’t have an agenda. The Truth is the Truth. Just tell the Truth.

I get it. Local Partners in the future are probably going to be pissed off and we’re going to have to mitigate a lot of that and do liaison wor But you got to fix this thing.

So I’m hearing again that there was some communications failure, but there is again, Media people are you writing this down? There is a Text Record Documenting this. That there was some failure to notify about the threats.

Stephen Gardner: As I mentioned a few minutes ago, Senator John Barrasso, who has been up dated, as part of a committee member, he said they knew of the shooter one hour before. They had snipers on him 20 minutes before. So there is a record of all of this stuff.

Dan: Second I have it confirmed from a source that there was no or very limited drone surveillance that day. There was no aerial, No effective aerial surveillance plan, basically what so ever. aerial surveillance would have detected this threat on the roof.

I’ve told you over and over again, I’m going to get to this in a second in with a secret service memo that was sent to me that’s going to prove to you that there couldn’t have been an air security personnel there because they changed the plan after we highlighted it. There was no drone.

So we can now confirm that. Which is an Absolutely ABOMINABLE SECURITY PLAN.

Stephen Gardner summarizes:

There were no dogs sniffing around [Explosives, gun powder?]

The additional snipers were in the building near Crooks.

There were no drones. SS and DHS sent no aerial/drones. But you know who had drones? Somebody who was up on the water tower.

Now 10 wittnesses have come forward, not family, not friends, at different times. Coming forward to authorities telling them “We saw somebody on the water tower just as Trump was being shot.”

I could not get the video to load. however if you go to google maps 3D, the water tower perfectly aligns with shooting Donald Trump. The roof and water tower align from different angles…. There is a video of the person on the Water tower appearing and disappearing at the same time you can hear pop pop…pop pop… We are not being told the full truth…but it gets weirder.

According to the FBI crooks has 3 encrypted bank accts overseas. [I thought the first story was encrypted phones -GC] WHY? What is a 20 year old doing with encrypted international bank accts?….. Was he a distraction the entire time so someone from the Water Tower could take shots? I do not know….

Stephen Gardner: Madcow said Poll out today of African Amer. Women showing that there has been a 31% DROP from 2020 to 2024 in terms of plans to vote for Biden.

Second video from Singingsoul1

Barnes first 18 min of 59 min video

~ 2:30 JD Vance fought in Iraq, thought he got lied to. I talked to him for hr & 1/2 before he came out against Ukraine war. I saw Karl Rove, his hands were shaking with rage when he got the news that JD was going to be the pick… US is unique, we are the only country that always has a ‘Lone Assassin’…

Multiple shooters coming out, Red flag Security lapses. A sign of a false flag is unusual and unexpected security lapses. That means someone on the inside is making sure certain events can occur.

Looks to me, multiple shoots, shots were excellent shots from sniper perspective…. When Trump stood and said Fight, Fight Fight he was signaling HE KNEW. Since then he is talking to RFK Jr about incorporating his vaccine policy. Talked to RFK jr about Biden asking why did you turn your head Don… gets leaked. Picks JD and accelerates nomination to Mon instead of Thurs.

I have talked to Don Jr and some other people. So I think Trump, KNOWS who wants Trump out of the way. And I think their attempt is going to backfire on them in Public Policy and a whole bunch of other ways.

I have ZERO doubts that at some level it was an inside job.

8:50 – First, many of Trump’s normal team was given the day off.

The second is the region had some high quality SS but THEY were re-assigned to Dr Jill…

The third is they had STAKED OUT THAT PRECISE LOCATION. There had been SS snipers on that roof and then they decide NOT to secure the roof… lists impossibles. [New] Had SS snipers on the roof THE DAY BEFORE and then the excuse of sloped roof...

Now coming out they IDed Crook 3 hours before because he is walking around with a range finder! … Almost like the profile of a patsy… He was so over the top that randos were screaming this guy is on the roof with a gun, minutes BEFORE he even fired a shot. They have video of him crawling across the roof! They have video of him near the building with the range finder so we KNOW he was on the SS radar.

He is acting so over the top it is being apparent he is playing a game. Can SS adequately protect a president and that president is a Trump president and he made comments on those games days before AND HE WAS GOING TO REALLY WIN THE GAME IN A SURPRISING WAY. So he is behaving like someone who is meant to be a patsy… couldn’t hit right side of barn according to tryout for rifle team.

And this guy is the one who snuck by SS & local LEOS and got off 5 or 6 shots? In THE primo location too?

So we know he was on everyone’s radar. SS was in the bldg, why were they doing nothing because we now know local Leos notified them TEN MINUTES before saying there is a guy with a gun on the roof. They all got that notice.

I do not buy the do not shoot after alerted. But the real question is WHY was Trump still on the stage AFTER THEY WERE ALERTED A MAN ON THE ROOF WITH A GUN 100 YDS AWAY???

THEY even set him UP!!

They get the notice and then say ‘Hey Don time to go up on stage!’

So the probability of incompetence as a likely explanation, when you go thru step by step, diminishes with each step.

And now we have Chris Martensen doing the sounds… [SEE: RAC contribution — https://video.twimg.com/amplify_video/1814095415127449600/vid/avc1/1280×720/3FjK8z8DFZjvqgvf.mp4?tag=14 ] and people at the scene said they heard shots from multiple locations. Some times that can be tricky.. echoes & all that. BUT Chris and other sound experts have been breaking down the sound and they are saying there are multiple shooters.

There is at least two maybe three. There may have been one on the Water Tower and there may have been someone in the building. The reason they were not taking out the supposed assassin, is because someone may have been shooting from that building. Making it difficult to know how many shots from that area and who.

As Trump said…, there were bullets still going everywhere going over me. That is more like 8 -12 shots instead of the 2 or 3 they guy should have had time to get off at all under their own time line.

Discussion about the photo of bullet path near Trump’s head… Was it flat and not angled down from roof? experts are analyzing.

CNN streaming rally live. Why was photographer taking that photo? My understanding is it was a NY TIMES photographer and had his camera speed at like 800 or what ever which is very rare. very unusual. He apparently is the same guy who caught fellow whispering in GW Bushes ear during 9/11. So this guy has a magical way of showing up during ‘interesting times’

People are curious whether the guy was tipped off. [REMEMBER the CIA has a LOT of Agents in the Fake News. -GC]

You can see how the Deep State would want Trump killed in a public way. The message was: “DO NOT EVER MESS WITH US!”

The message was, not only will we bankrupt you and indict you, we will FLAT OUT MURDER YOU!

After all that is what they did to JFK, RFK, Martin Luther King, Malcolm X, ALL those assassinations at some level had govt complicity and conspiracy. The only question… is what is the scale and scope…. AND I think Trump knows it. You have seen a different tone from him… Thankful to be alive but he will be more aggressive than he might otherwise have been.

His reach out to RFK jr signaled that. Pick of JD Vance signaled that.

The cases to bankrupt him, to put him in prison did not shake him up very much. These are crap political cases and will get overturned at a higher level. But the attempt to assassinate him DID WAKE HIM UP. And you saw… “We need to do some radical change in America” AND he is much more committed to it…

18:30 Rebel Capitalist : Robert, Can you explain the Patsy roll not just this time but thru out history…

And I quit there.

History of assassinations 18:20 t0 24:28

Rebel Capitalist: Can you explain the Patsy role a little bit better. Not just Sat but thru out history. Because that will be the Push back. If that is the Deep State doing this, why on earth would they use this kid who can not hit the broad side of a barn, 20 years old, some say with an inadequate weapon. Why wouldn’t they have a guy there who could get the job done….

Also motivation for the kid? “what’s in it for him?”

Barnes: So there are already inconsistent stories about the kid. So we will start with the profile of a Patsy…. Every great crime needs a great patsy. Particularly a political crime. You need a convenient narrative script. A design. You need somebody that the event can be blamed on that won’t implicate powerful actors, institutional actors, government actors… Ad preferably THEY DIE. So they can never talk. Lee Harvey Oswald shot before he could meaningfully talk. The Vegas Shooter, we will never know if it was even him because he got shot before he could talk.

In America there is a profile pattern of trying to blame a SINGLE CRAZY ASSASSIN for an event. Or in some cases 2 or 3. But it is always some ‘crazy people’ involved….[gives examples] They usually have mental illness issues.

Rebel Capitalist: Legitimate!

Barnes: Yeah and there is already information. With this kid his parents were both mental health councilors which is a little weird.

You can go back to the Manchurian Candidate film, The Parallax View[1974] which Warren Beatty starred in that hinted at this kind of thing in the early 70s because people were wondering how some crazy person keeps getting in and murdering prominent critics of the Military Industrial Complex.

WHY don’t the Crazy People ever kill the Military Industrial Complex? Right? Why isn’t it THOSE GUYS? Why isn’t it the Federal Reserve???

No one has EVER thought to assassinate anyone in the Federal Reserve?? [LOL from Rebel Capitalist] It is just the CRITICS of the Federal Reserve. I am sure that is just a coincidence.

So, they need someone who is a little bit crazy who is a loner, doesn’t have a lot of friends. doesn’t have a lot of family, Doesn’t have a lot of people who can COUNTER THE NARRATIVE. Who can say “No, No this doesn’t make any sense.” And he fits that pattern.

But you are right, these are people you would RARELY trust to be able to pull something like this off.

I was intrigued by Trump talking last night. Saying when he was on the ground, there were still bullets coming. That means someone who was very very good, kept shooting…. That would suggest that did not come from that kid.

His [The Kid’s] social media was non-existent which is very rare in these times.

Rebel Capitalist: They can’t find ANYTHING on him. you mean you can’t find his cell phone record? You do not have a text to a buddy? Every time you have a crazy you have a Manifesto. If he is not leaving any trail, what is his motivation? I mean he KNOWS he is going to die, so that [a manifesto] would be the only motivation. It was to make yourself look like a hero. You are a nobody but this is how you can be a somebody.

Barnes: EXACTLY. That is the usual profile of your mass school shooters and the like. And now TAKE A GUESS what they ARE going to blame on him in a certain way?

If you are the Deep State what sort of an ENEMY, institutional ENEMY if you will?

Rebel Capitalist: Gun Control or something?

Barnes: CRYPTO!

[NOW the Windows CRASH and INDIA CRYPTO LOSS makes a bit more sense! – GC]

That he has CRYPTO ACCOUNTS. So some how CRYPTO is part of the reason for the assassination. That is his reason for the attempt on Trump.

Rebel Capitalist: Is this the narrative that is coming out? I have not heard of this!

Barnes: Nods yes.

YES! The only thing they have found so far, they could not get thru the encrypted aspects of his phone.🙄

Rebel Capitalist: How could you not? Are you kidding me? How could the SS, CIA, NSA, I do not know who is in charge of that, the kids 20 yrs old! It is not like he is Jason Borne for heaven sakes! How do you NOT get into his phone? [Remember back doors?? – GC]

Barnes: This kid has very little foot print, but according to the new report, he had 3 secured crypto accts. around the world. And so the goal is to say: “SEE this is what happens when people use Crypto! They become assassins!” [Hmm Kinda explains Sam Bankman-Fried getting hung out to dry. -GC]

One minute Bitcoin, the next minute they want to kill the president. It is that kind of logic. I figured they would try to demonize crypto some how. And maybe that is the link to Iran. Some how this guy was paid by Iran. And they did it using crypto because Crypto is ONLY FOR CRIMINALS. Good Honest people only use Central Banks and their money and their banking institutions. Because that is a great way to secure your money [Said snickering] And so that is the next step in the narrative.

And the CIA leaked over the weekend that Iran had been making threats and plans to assassinate Trump…

To round it out do not miss Wolfie’s comment about the Church.

SEAN DAVIS ALSO HAS QUESTIONS:

Sean Davis @seanmdav
Here’s an abbreviated list of extremely basic factual questions about the Trump assassination attempt that for some reason haven’t been definitively answered (anonymous leaks don’t count): 
 1) What make, model, and caliber of firearm was used, and when/where/by whom was it purchased? 
 2) What make and model of ammo was used (including the weight of the bullet used)? 
 3) Did the rifle used have any type of magnified optic or red dot sight on it, and if so, what make/model, and what exact setting was the optic on when the shooter used it? 
 4) Have authorities put identical rounds through the rifle with the identical optics settings and confirmed both the zero and the result of shots fired at the range at which they were fired on Saturday? 
 5) How many shell casings were recovered from the crime scene? How many remaining rounds were in the magazine that was found in the rifle? 
 6) How many rounds were fired by the shooter on the warehouse rooftop? Has each round been accounted for (i.e., do investigators know where each round landed, and does the number of bullets found or accounted for match the number of shell casings found? 
 7) Have investigators confirmed, via the recovered bullets and the known trajectory of the bullets, that the shooter on the rooftop fired each one? 
 8) Have investigators reconstructed the shooter’s precise movements over the past days, weeks, and months? If so, have they put together a list of every person with whom he interacted over that time period, but in person and virtually or online? 
 9) Have investigators reviewed video surveillance of the shooter at all various locations he recently visited (e.g., gun range, gun dealer, restaurants, traffic cameras, etc.)? If so, have they canvassed and interviewed each person seen with the shooter? 
 
These aren’t difficult questions to answer. These are usually the types of details promptly provided by authorities in the days following shocking, violent events of national importance. 
Yet we do not have a single one of these questions definitely answered on the record by an official authority. Not one. 
Why the heck not?

Attempted Assassin Thomas Matthew Crooks Flew Drone Over Trump Rally Site on Day of Shooting – 2 Cell Phones, Laptop and USB Drives Being Reviewed – https://theconservativetreehouse.com/blog/2024/07/19/attempted-assassin-thomas-matthew-crooks-flew-drone-over-trump-rally-site-on-day-of-shooting-2-cell-phones-laptop-and-usb-drives-being-reviewed/

SUMMARY – In addition to bringing explosives, a detonator, a ladder, a range finder, a backpack and an AR15 rifle to the rally, while finding a way to sit atop the counter-sniper position, the 20-year-old without a social media footprint apparently had air superiority.

(Via Wall St Journal)
 […] 
The gunman who tried to kill Donald Trump was able to fly a drone and get aerial footage of the western Pennsylvania fairgrounds shortly before the former president was set to speak there, law-enforcement officials briefed on the matter said, further underscoring the stunning security lapses ahead of Trump’s near assassination.
Thomas Matthew Crooks flew the drone on a programmed flight path earlier in the day on July 13 to scour the Butler Farm Show grounds ahead of Trump’s ill-fated rally, the officials said. The predetermined path, the officials added, suggests Crooks flew the drone more than once as he researched and scoped out the event site.
[…]  
The use of the drone was just one way in which authorities have said Crooks planned his attack. Crooks, described by friends as very smart yet withdrawn, began researching the site shortly after the Trump campaign announced the rally on July 3, and registered for the event on July 7, officials said. He visited the farm show grounds a few days later to scope it out.

On July 13, officials said, he returned with a pair of homemade bombs that appeared to be designed to be set off by remote control, as they were fitted with a receiver like the kind used to set off fireworks remotely. Investigators found the rudimentary explosives in Crooks’ car parked close to the grounds, along with a ballistic carrier, or vest, with three, 30-round magazines in it, an indication that he might have wanted to cause greater carnage. (read more) – https://www.wsj.com/politics/national-security/trump-gunman-flew-drone-over-rally-site-hours-before-attempted-assassination-2d0e2e1a

Who was on that WATER TOWER?” 10 Witnesses Come Forward | Redacted with Clayton Morris (14 minutes)

at 5:20:

Senators got private meeting. Marsha Blackburn: SS KNEW about a threat PRIOR to POTUS Trump walking out on stage.

Harrison H. Smith ✞@HarrisonHSmith https://twitter.com/HarrisonHSmith/status/1814863467901223360


So let me see if I have this Crowdstrike story straight…. When Hillary Clinton was Sec. of State, she was illegally funneling sophisticated weapons through Libya to terrorists in the MidEast in an effort to take out Assad in Syria for Israel.

When the weapons transfer went sideways and the US Ambassador was killed in Benghazi, it was discovered she was using an illegal private server for secret communications.

She destroyed the server, but not before its contents were leaked by Wikileaks, including communications about bizarre occult rituals and inexplicable code words involving children and pizza. Instead of investigating the leak themselves, the FBI relied on a Crowdstrike investigation that falsely claimed the server was hacked by Russia.

The FBI cleared HC despite admitting she broke the law, and launched the Russiagate investigation, using more fake Clinton campaign disinfo to tie Trump to Russia to get a FISA warrant and spy on Trump while leaking dirt to the press to undermine first his campaign, then his presidency.

When Trump had a call with Zelenskyy and asked about Crowdstrike, a “whistleblower” falsely claimed quid-pro-quo and launched the first impeachment to stop Trump’s inquiries. (It was in the midst of this impeachment trial, btw, when Event 201 took place.

But that’s another story.) Fast forward to 2024 and Trump is dominating Biden when he miraculously survives a deep state orchestrated assassination attempt two days before the RNC. Two days later Crowdstrike causes the biggest computer network crash in all of history, knocking millions of corporate and government systems offline for hours.

Other than the fact that Blackrock owns Crowdstrike and a Blackrock affiliated investment firm placed millions of dollars betting against DJT in the hours before the assassination attempt by a shooter who was featured in a Blackrock promo, did I miss anything?

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

OK that was the data dump of my notes.

NEXT IS BOOKMARKS.

Again this is FAST, I am not going to check if I have already included the bookmark in the above notes. I am not going to put them in any order.

https://threadreaderapp.com/thread/1812320872713089071.html

I was the Sniper Employment Officer for my battalion and led hundreds of combat missions. There were major security lapses in the security plan that allowed a shooter to engage President Trump from ~130 meters – an easy shot. A 🧵…..

WHAT?! Trump Shooter Appears to Be Featured in 2023 BlackRock Ad (VIDEO) (GatewayPundit)

DEEP STATE DECLARED WAR YESTERDAY Burning Platform

SPECIAL BULLETIN: America Teeters on the Abyss

Trump shot in assassination attempt in Butler, PA

Who is Thomas Matthew Crooks? Not much is known at this time but a disturbing picture is starting to emerge American Thinker

Rep. Bennie Thompson staffer loses job after posting that gunman needed shooting lessons NBCNews

CBS NEWS: https://video.twimg.com/ext_tw_video/1812544625145458688/pu/vid/avc1/1280×720/7hniic2pHRBC0DHM.mp4?tag=12

“Malice Or Massive Incompetence”: Erik Prince Gives Detailed Assessment Of Secret Service Failure Zero Hedge

They Tried to Kill Trump – Now We’re Going to Fight Twice As Hard –Townhall Kurt Schlichter | Jul 14, 2024


GOP Was Investigating Secret Service Before Assassination Attempt Real Clear Politics

https://threadreaderapp.com/thread/1812547400596435424.html

Susan Crabtree @susancrabtree

Jul 14 • 6 tweets • 2 min read •  Read on X My latest compilation of reporting: GOP Was Investigating Secret Service Before Assassination Attempt | RealClearPolitics

REPORT: Secret Service Resources Were Diverted to Jill Biden’s Saturday Campaign Event in Pittsburgh and Away from Trump’s – Many Agents Assigned to Trump were Temporary Replacements GatewayPundit

Trump superfan describes the terrifying moment he watched horrific assassination attempt from the front row of the rally Daily Mail

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

I have a LOT more info to upload and I think this is getting way too long so I am going to stop here for now. This is the data dump up until Jul 14, 2024. The next is a Daily Mail article with a lot of photos dated July 15th.

American Stories: FIRE!

She died a recluse in 1895, ostracized and shunned by society. She withdrew from social interaction and refused to talk about the events of that period. She denied her cow caused the fire until her death. Over a century later, Mrs. Catherine O’Leary and her cow were officially exonerated by the Chicago City Council in 1997.

Huh?! What are you blabbering about again, TB? Well, just taking another little side trip down on the criminal globalist cabal’s propaganda train that goes back to 1871.

The War of Northern Aggression had ended and the victorius cabal had begun converting their industrial, business, medical, etc. holdings into a peacetime economy in a country that was growing rapidly in the west as well as with trade overseas. It was a time of great scientific invention and application advancement. City leaders had big plans.

The Great Chicago Fire

Urban legend of that day grew as the print media spread the gossip flames during the days that followed The Great Chicago Fire (TGCF). The voices of these influencers planted their seeds in the minds of the local population. They said the cause was a cow in the O’Leary barn that kicked over a lantern. Apparently Elsie the cow did the dirty deed that started all of the devastation and death.

Currently on history.com –

On October 8, 1871, flames spark in the Chicago barn of Patrick and Catherine O’Leary, igniting a two-day blaze that kills between 200 and 300 people, destroys 17,450 buildings, leaves 100,000 homeless and causes an estimated $200 million (in 1871 dollars; roughly $4 billion in 2021 dollars) in damages.

Legend has it that a cow kicked over a lantern in the O’Leary barn and started the fire, but other theories hold that humans or even a comet may have been responsible for the event that left four square miles of the Windy City, including its business district, in ruins. Dry weather and an abundance of wooden buildings, streets and sidewalks made Chicago vulnerable to fire. The city averaged two fires per day in 1870; there were 20 fires throughout Chicago the week before the Great Fire of 1871.

Despite the fire’s devastation, much of Chicago’s physical infrastructure, including its water, sewage and transportation systems, remained intact. Reconstruction efforts began quickly and spurred great economic development and population growth, as architects laid the foundation for a modern city featuring the world’s first skyscrapers. At the time of the fire, Chicago’s population was approximately 324,000; within nine years, there were 500,000 Chicagoans. By 1893, the city was a major economic and transportation hub with an estimated population of 1.5 million. That same year, Chicago was chosen to host the World’s Columbian Exposition, a major tourist attraction visited by 27.5 million people, or approximately half the U.S. population at the time.

In 1997, the Chicago City Council exonerated Mrs. O’Leary and her cow. She turned into a recluse after the fire, and died in 1895.”

In my opinion, none of the many stories and news accounts available on line as well as in history publications and other commentaries are more revealing than these below from The Saturday Evening Post article of Oct. 8, 2021, The New Yorker article that was published on Oct. 2, 2023 and a Chicago Tribune article published on Oct. 1, 2021. They will take you back over 150 years only to discover that the media, gossipers (influencers), corrupt politicians and government officials were in the same spearhead then as they are now.

https://www.saturdayeveningpost.com/2021/10/considering-history-mrs-olearys-cow-didnt-start-the-great-chicago-fire-why-does-it-matter

https://www.newyorker.com/magazine/2023/10/09/the-burning-of-the-world-the-great-chicago-fire-and-the-war-for-a-citys-soul-scott-w-berg-book-review

I hope folks in this nation of ours are at least beginning to see that the representations of historical accounts are often manipulated; changed to influence and reframe narratives to help meet the objectives of the criminal globalist cabal that are in leadership of numerous nations of the world. You and I are great big nothings to them; only allowed to exist to accomplish their wills as needed. We are considered to be replaceable and definitely, deplorable. This condition is also nothing new in mankind’s existence.

Notice in these and most other reports of TGCF that it is now acceptable to consider other possible causes of the great fire since objectives were met and there will be no legal consequences from the shenanigans. Nothing to see here, time to move on – right?

The transplanted former natives of Ireland, Patrick and Catherine O’Leary, the owners of the barn and said cow; were never officially recognized as the source of the fire or charged with negligence despite investigations by the authorities. It appears that their existence nearby was just a convenient explanation to shield what really happened, which has still not been determined or revealed. This needed to be done since many of the accusers had an agenda against Irish immigrants who had been growing rapidly in population in Chicago, especially in the densely populated subject area as well as in nearby neighborhoods impacted most by the fire. In addition, the cabal had business expansion plans for the fire ravaged properties.

How convenient that the city’s infrastructure amazingly remained fully intact after the fire. 👀

Here we are once again with former Irish slaves, indentured servants and the poor being forced to leave their native land to make their way into an expanding America; only for them and their descendants to get the shaft. Most lost everything and their proofs of insurance burned as well. The local and federal governments never raced to their aid. Unless they had access to other funds to rebuild, they had to walk away.

When one studies the actual fire event and the circumstances surrounding it, the stench of nefarious intent waffles through the air. Perhaps the fire truly was an accident that raced out of control quickly. That does not change what happened post fire that sets off all sorts of alarms. Just answering who stood to lose the most and who stood to gain the most answers many questions. However, stopping there would not reveal how the criminal cabal operates.

Numerous internet sources continue to reference article after article of the O’Leary’s cow as the cause of the fire even when they list other potential causes. My grandson’s homeschooling curriculum, Time4learning, had a 2024 lesson about TGCF and its origination point being the O’Leary barn and cow as its sole explanation. They are still selling the false narrative to unsuspecting young people and their parents. I guess teaching children that speculation, gossip and innuendo are facts is called “education” in today’s world.

The Rebuild Per The Left

What happened to Chicago post fire beginning in 1871? Let’s look at one leftist version.

Why of course, it is “The Great Rebuilding” of Chicago!

https://education.nationalgeographic.org/resource/chicago-fire-1871-and-great-rebuilding

Notice that National Geographic states, “While there is little doubt…” Elsie and the lantern started the fire. Then the writer adds a Fast Fact at the end and throws in the possiblity of a thief kicking over the lantern with a reference to some scientists believe a meteor shower started it as possibilities to keep their attorneys happy. If an accident really did cause it, the more likely scenario was the musician neighbor or other local thief stole some of the O’Leary’s milk for themselves and kicked over the lantern. The point is they did not know then or now, who or even how it started. They have no evidence. Nobody even knows with certainty whether it ignited in the immediate vicinity of the barn, much less who started it. Yet, the poor working class O’Leary family was charged in the court of public opinion and over a century later the probable misrepresentation continues.

Cast dispersions much, NG? Why yes, that is their malicious intention revealed openly for all to see.

Lets explore deeper and open the Credits section of the article. You will see it was updated in 10/23. The writer is a Mary Schons, who clearly had access to the Saturday Evening Post and Chicago Tribune articles (among others) linked above before her update. Who is Ms. Schons? A writer who cannot easily be identified that focuses on the women’s suffrage movement, African American rights and movements, etc. This appears to be her; a retired school psychologist in the Denver area.

https://www.linkedin.com/in/mary-schons-a82979122

So we turn our attention to a listed editor for the article, Jeannie Evers. I was unable to provide the link of her linkedin page, however, the University of Denver is in both backgrounds of Schons and Evers – which is a reflection of their possible connection. Evers has been an editor for NG since Soetoro’s term began in 2009. So, what is the 230 student Santa Catalina (CA) independent Catholic prep school for girls for whom Ms. Evers currently works as Asst. Director of Marketing and Communications? It is this place.

https://www.santacatalina.org/upper-school

They proudly display their college referrals across the banner of the home page. Needless to say no conservative schools are shown. Their mission is right in front of you the reader and all of America. Here is Ms. Evers staff bio.

https://www.santacatalina.org/upper-school/who-we-are/faculty-staff/bios/~const-id/9185

There is another leftist connection featured in this NG article of Schons. The Unitarian Church rears its head in the quoted text. Notice that no traditional Christian or Jewish denominations or independent churches, temple or synagogue leaders are quoted.

Unitarian Faith
“We have not lost, first, our geography. Nature called the lakes, the forests, the prairies together in convention long before we were born, and they decided that on this spot a great city would be built.”
The Rev. Robert Collyer, speaking to his congregation after the Chicago Fire of 1871 destroyed their church

😂 at the Reverend’s description of his god’s (nature) actions. That group has never changed after all these years. The truth was not in them, then or now.

The NG article has been saved by 56 educators, who obviously use it when teaching Social Studies, American History, etc. See how that works? Now multiply this type narrative building of false history in multiple academic disciplines times tens of millions of student interactions in every aspect of education across America every day for decades.

Do not dismiss this one seemingly insignificant historical misrepresentation as unimportant. You, your children, your children’s children, and so on have been and are being taught lies as truth. Not just with this subject, this has been done IN EVERYTHING. If you have not already, it is time for you to think things through and take action.

This is an example of our American house being built on sand that the Bible speaks about in Matthew 7:24-27.

24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.”

Which leads to His authority in John 14:6.

Jesus said to him, “I am the way, and the truth, and the life; no one comes to the Father except through Me.

As a result if you are a Christian, you cannot accept lies in education (or anything else). Acceptance of lies as truth and speculation as fact undermines the foundation of America and does not reflect your acceptance of Jesus as your Savior. Lies, misrepresentations and disinformation are shifting sand. Build your foundation on the truth, the rock of Jesus Christ. Your role is to shed light on their schemes. Bring the truth as Jesus did. Our American foundation will then stand against Satan and his minions.

That is a primary purpose of this series, to expose some of the lies, misrepresentations, manipulations, and deception employed in America.

Truth

The NG narrative scoundrels cannot refrain from describing the oppressors using the TGCF tragedy as an opportunity to meet their true goals.

Many poorer Chicagoans couldn’t afford the fireproof materials or skilled masons to rebuild. In addition, many could not afford fire insurance. (Before the fire, many people had insurance, but their policies were burned in the fire.) Without the means to rebuild or insure their property, thousands of people and small businesses were crowded out of Chicago.

We could stop with that statement from the NG article and know the primary reason for what happened post fire in 1871. The cabal was simply capitalizing on the conditions of misery they helped create for their fellow man.

As a general truth that applies with all events of this type: the losses, devastation, injuries and death created against one group of people is really good business for others. Which leads to the motives for the fire. I am sure it was just coincidences that the source of water (the public Waterworks utility) for fire responders was quickly burned; for the undermanned responders to be given wrong directions and get lost on their way to the fire (conveniently left out of the referenced article, yet, is in others); for the location of the fire to be essentially isolated to a poor area of the city filled with reviled immigrants; that the more effluent residential areas were not impacted; that the biggest area economic driver – the large stockyards and packing plants on the same south side suffered no damage at all; and so on. See the map in the linked article below.

https://chicagoist.com/2015/10/08/its_the_anniversary_of_the.php

Sickening, isn’t it? Next, consider how quickly the rebuild began. The architects and engineers had not even finished their planning and design work on infrastructure, government buildings, and revamped codes before major reconstruction began. This was done only for it all to be completely ‘built back better’ leading to a business and population explosion in that former working class resident area that culminated in the city hosting the World’s Fair two decades later.

Where have I heard that expression before? Oh, yeah, from the following…

https://www.whitehouse.gov/build-back-better

Now think about Lahaina, Maui.

It is a very familiar refrain that echos from the words of the same political elites and globalist cabal over many, many years.

The rewriters of history such as these with NG are employed to create propaganda and false narratives akin to sweeping the footprints from behind the paths of villains as they leave the scenes of the crimes. They are accessories after the fact using journalistic license as cover. The subject footprints may be removed, however, the trail is still there through common sense, logic, research and observations of the mistakes they make in the cover-ups. Those seeking truth can follow the trails of the more known or self identifying clean-up crews to find where they have been active.

First, the actions of the cleaning crews means somebody instructed these removers of the footprints to do so. They did not just come up with it on their own as lone wolfs; the actions are coordinated similar to the mockingbird press activities. Second, that also means the criminals had reasons to have them removed, that they needed certain things to be kept secret. Finally, it demonstrates they are not doing good as God has commanded; they are serving their master, Satan. Which tells us, We the People, how to react.

The following article gives more detail on reconstruction post fire, but still polishes the apple.

https://chicago.suntimes.com/2021/10/8/22677929/how-great-chicago-fire-changed-chicago-architecture

In relation to what happened over time in the general vicinity, the following is a current list of large businesses with a major presence.

https://www.builtinchicago.org/articles/companies-downtown-chicago

Who knows if Chicago would have still accomplished its size and prominence had there been no fires to force the poor local residents and businesses out in great numbers. Perhaps those who desired to locate there would have paid market value to the property owners to sell and leave over time. Oh, who do I think i am fooling with that?! 🤣

Second Fire

But wait, there’s MOAR! There was a second, smaller, less publicized; yet, devastating and deadly fire in Chicago a few years later in 1874. The new post-1871 buildings with more fire proof materials did not burn, however, about 800 older ones were burned up adjacent to the 1871 fire zone. Dang, that’s just some bad luck, right? Well actually, it was good luck for those who swooped in and purchased property on the cheap and rebuilt the area to meet their needs. The first playbook was used again since it worked so well. The following article is well worth the read.

https://drloihjournal.blogspot.com/2016/11/the-chicago-fire-of-1874.html

So, let’s think this through. The poor neighborhoods that had the largest groups of Jews, predominantly from Russia and Poland, to go with a large number of African American homes and businesses were destroyed in this fire. Add in the benefit of destroying Chicago’s notorious red light district in the process. The theme of stopping the latter activities as being a good thing was then sold by the media and influencers to the unsuspecting public. Post-fire the Jews, African Americans and prostitutes relocated to other areas farther from the city’s center for the most part.

Supposedly the fire started in a Polish Jew’s rag shop located next door to an oil company of sorts, yet, it was established the owner/operator of the rag shop was away from his business when it happened that late afternoon. It was also well known for many years that the water lines in the affected area were too small (4″), insufficient in distribution network, and clogged throughout that part of town due to improper design, modification and lack of maintenance.

🤫

Can you spell A R S O N?

Guess what area was next for reconstruction in the ‘build back better’ with construction crews and services already stationed in the area performing work from the previous fire? Guess what fire accelerated the city’s infrastructure improvements and enforcement of same in the affected area post fire?

Are we awake yet? The conditions on the ground determine the plan and implementation schedule. Take the long view, the criminal cabal does. Sometimes they get lucky and a true accident or unfortunate event happens of which they are positioned to take advantage quickly. Most times it is an intentional act that creates the calamity and the mechanism for cover up has already been activated.

The criminal cabal know there is always plenty of time to organize and implement what has already been planned decades in advance. They do not press the button every time there is an opening. They wait until the time is right for maximum effectiveness.

No person(s) were charged in either Chicago fire. Yet, entire segments of the population lost most everything they owned and were displaced by ethnicity, race and economic status. Many people were killed and injured in these events.

The criminal cabal did not care, they got what they wanted.

There Is A More Important Fire

I Corinthians 3:10-17

According to the grace of God which was given to me, like a wise master builder I laid a foundation, and another is building on it. But each person must be careful how he builds on it. For no one can lay a foundation other than the one which is laid, which is Jesus Christ. Now if anyone builds on the foundation with gold, silver, precious stones, wood, hay, or straw, each one’s work will become evident; for the day will show it because it is to be revealed with fire, and the fire itself will test the quality of each one’s work. If anyone’s work which he has built on it remains, he will receive a reward. If anyone’s work is burned up, he will suffer loss; but he himself will be saved, yet only so as through fire.

Do you not know that you are a temple of God and that the Spirit of God dwells in you? If anyone destroys the temple of God, God will destroy that person; for the temple of God is holy, and that is what you are.

Before you get to the end result in the second paragraph above make sure you consider all of the ramifications of the first. Paul wants us to consider that we should carefully first build a foundation of faith that is built on Christ, which is then applied to our works in life. You will be contributing to the Kingdom of God and providing a platform for others who follow behind you both in spiritual matters and the secular world. How you go about your works in the world and the degree you reflect God’s will in doing so will be tested.

According to Paul, true believers in Christ who errantly build for worldly things without regard to God’s will shall still be saved from an eternity spent in Hell, but barely. Their rewards in Heaven may be quite limited at the judgment seat of Christ.

The pursuit of those worldly things may actually lead to them violating the persons described in the second paragraph. Followers of Christ have the temple of God within them through the Spirit’s dwelling. So harming others is a direct attack against God. I advise against doing that even as the lost about you are doing that very thing.

The Bottom Line

Fire. Used for purification, used for destruction. Used for good, used for evil. Most importantly for Americans, the use of fire is connected to enslavement as well as liberty.

If Mrs. O’Leary, reportedly an Irish Catholic, was a believer in Jesus Christ; all is well as she is with Him in Heaven for eternity. All of the pain she suffered in this cruel world has been replaced with incredible joy. She defended herself and her husband’s honor until her passing from death into eternal life.

But can we say the same about those who committed the subject evil acts that gained them worldly wealth, fame and power for a time? We can hope they saw the error of their pursuits and ways, then repented and accepted Christ before their deaths. If not, eternal destruction awaits the non-believer as well as discipline for the believer who participated in the evil per the quoted scripture above in I Corinthians.

Conclusion

We will continue the discussion of fire events in America for a time in this series. It continues to be one of the cabal’s most visible and effective weapons that has far reaching psychological as well as economic and environmental effects. It is not unreasonable to conclude that the more recent clowns’ use of MKUltra as well as promoting mental illness through gender dysphoria, AI, jabs, transhumanism, etc. will continue to deliver useful victims to assist with the evil activities on behalf of the criminal globalist cabal.

Blessings to all who care to spend time and read these American stories. May something of value be gained.

Wolf’s Statement on the End of Affirmative Action


I have tried to write this several times.

I have decided to be short, blunt, and to the point.

Here it is, very simply.

I was part of the cover-up of the early failure of Affirmative Action.

And when I say EARLY, I mean it failed during the alleged TESTING – meaning the very first year they put AA students on campus, which was supposed to be a test, but was really an unstoppable, unchangeable, unarguable implementation, that was going to happen, no matter what.

Let me be crystal clear.

Affirmative Action failed RIGHT OUT OF THE GATE.

I was there, and was an integral part of the disaster and the cover-up. And, quite frankly, I’m lucky I’m still alive. But I learned to keep my mouth shut for a very long time, and how to stay ahead of the people who needed me “gone” in some legal, plausible, and useful fashion.

Here is a bullet list of what happened. It’s long, but it gets the point across quickly, how the failure of Affirmative Action became known, and was then covered up.

  • I was working on an advanced science degree at a very fancy university
  • The university was informed that we would be getting Affirmative Action students
  • There were only a few of these students
  • This was supposed to be some kind of test, but it really was more of a “done deal”
  • I was warned by a friendly superior to steer clear of these students, and I did, but I didn’t realize why
  • One AA student in my professor’s class was caught cheating
  • I got the scoop from the teacher involved – the cheating was stupid and desperate – it was almost a cry for help
  • The student was clearly out of their depth
  • The failure was likely to mean the student would fail the course
  • AT THIS POINT, AFFIRMATIVE ACTION WAS IN TROUBLE – if this was really a “test”
  • It was obvious to me that Affirmative Action would require a “fix” to actually work
  • I was an idiot and thought I could help Affirmative Action work
  • I suggested the idea of a remedial program, which had worked for unprepared math students at my previous university
  • That was it – I just mentioned this to the professor
  • TIME GOES BY – we hear nothing
  • The next thing I know, this same student was placed into our research laboratory, as an undergraduate researcher, by orders from the university
  • This was absolutely insane, dangerous, and utterly backwards to all common sense – only the BEST students are normally allowed into undergrad research in any university
  • The professor could not stop this – it came from too high up the chain
  • As one might predict, there was a DISASTER involving this student.
  • The disaster resulted in a lawsuit
  • The next five parts are very important – it’s about LAWFARE
    • (1) The lawsuit conveniently prevented the university from reporting anything about the student to the government, due to “conflict of interest”
    • (2) The lawsuit therefore prevented the university from reporting anything bad for Affirmative Action
    • (3) The lawsuit prevented the university from taking any public position regarding Affirmative Action
    • (4) The lawsuit created leverage on everybody involved, to hide what happened
    • (5) The lawsuit resulted in NDAs on everybody involved, to silence them on what happened
  • Bottom line, the “forced disaster” protected the truth about Affirmative Action from ever being known

However, that’s just the superficial, top-level view.

I was close enough on this sucker, and paying enough attention, that I realized things were EVEN WORSE THAN THAT.

This disaster didn’t just happen because putting a deficient student in a dangerous place is a dangerous idea.

SOMEBODY MADE SURE THERE WAS A PROBLEM.

Yes. This was a scam – an engineered accident. And the technology used to pull it off was astounding. So much so, that it was unbelievable, and I had to hide it. I simply could not testify to something that people could not believe.

For a long time I thought that the money of the lawsuit was the driving force behind SOMEBODY deciding to use cutting-edge technology, but the economics just were not there. Nope – it was the millions, and then billions, and eventually TRILLIONS of dollars at stake.

Once I realized that this was really a deep-state thing for billions and trillions of dollars, and not just a lawsuit for measly low millions, it all started making sense.

Now, I don’t want to get any deeper into how they pulled this off, than what I’ve already revealed, because I like keeping a few nukes handy, in case somebody wants to make this into a big deal. They want to go there, I can REALLY make this a big deal.

If you want to know more details than that, just read this earlier post I wrote about the topic.


Déjà Woo

This post is rather long, and it ultimately leads to VALIDATE what Q said about MK. And beyond. WAY beyond. I’m choosing to spill enough now that no matter what happens, or what happens to me, they will no longer be able to keep using MK for murders and getting away clean. People will SPOT …


Now, let me be clear – I’m not saying that all Affirmative Action students can’t handle the rigor of the universities they are pumped into, over more qualified students. But we are lying to ourselves to think that there is no downside to lowering standards of admission. I encountered that downside in the very first Affirmative Action student to come through our department’s classes.

An interesting debate on the topic is this one, which involves Michelle Obama. She was, if I’m dating things properly, admitted in the second year of Affirmative Action.

In my opinion, both sides arguing in the linked article are “right and wrong” about things. There were definitely VERY FEW Affirmative Action students in the first year, and not that many in the second year, if I remember things correctly. Bear in mind – not all black students were Affirmative Action cases. Eventually, though, the effect on the student population was very noticeable. The timing, IMO, isn’t all that important.

Nevertheless, I would not be surprised if Michelle Obama really felt isolated on campus, despite likely being among perhaps a few hundred other AA-admitted students.

But much of what the rabbi is saying is quite right. Students who are not qualified to enter these schools were being prioritized over students who were qualified, due to race, and it was eventually a very big deal, that caused a LOT of problems.


So what’s the point, in the end? We know the Deep State does what it wants. They make their money in the name of some good thing that they inevitably lie about and FAKE.

The Deep State can and will roll over anybody that they need to roll over. We’ve seen what they did to Trump.

But yet, all that is not what matters.

Thanks to all this stuff, I found God. I mean, not like I did when I was a kid. I mean deeply, and in a big way, and as an adult.

It’s DIFFERENT when you walk through the Valley of the Shadow of Death, and you LEARN the hard way that GOD is your only real ally. And it’s not just magic, or the belief in magic, but the reality of how one deals with the universe, and how the universe deals back. God is a very “complex” thing, with both “real” and “imaginary” components. I am grateful for ending up with the understanding that I eventually got.

I lost a lot of things IN THIS WORLD, but in many ways that was purifying. I was stripped of much corruption and my worldly idols, and was left with GOD and the best teacher of all, the LORD JESUS CHRIST, the carpenter who dared to speak truth in a world of lies.

Affirmative Action was a noble cause, for those who believed in its truth, just as the response to 9/11 was a noble cause, for those who believed in its truth.

The problem is, neither one was completely true. Affirmative Action was never meant to be a logical reality. It was Hollywood. It was a story. It was Potemkin. It was fake. It was a societal version of “fake it until you make it”. They had no intention of doing it right.

I still believe in the “ends” of Affirmative Action – that Martin Luther King, Jr.’s dream can and will be achieved. But that end will NOT be achieved through these means – through deception and lies. It can only be achieved through truths. Sometimes those truths will be painful. Sometimes they will be joyous. But in the end, they will be part of the story – the TRUE story – that makes America great.

God bless you, and thank you for listening.

W


Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf


Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.


Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …


The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.


Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …


Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!


mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …


I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.


A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.


Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.


Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.


This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:


Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA


From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.


Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-


Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK


In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.


So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.


Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Spies, Spooks, Snakes and The Sea Eye Aye

I was going to do this as a comment but decided it would be better as an article… And then it grew and grew. I think we are going to be adding to this as events unfold. So put on your tinfoil hats, buckle your seat belts, grab your eye bleach and salt cellar and join me on another trip down a rabbit hole.

This article was prompted by three videos and the BIG QUESTIONS:

Did Allen Welsh Dulles import Nazi war criminals into the USA and his newly formed CIA?

If so did these Nazis shape the CIA into the Deep State we are dealing with today?

Dulles served as CIA director from 26 February 1953 to 29 November 1961. JFK was assassinated on November 22, 1963 after announcing his plan to destroy the CIA. Dulles died January 29, 1969.

Badlands Media had the first video I want to look at:

Altered State Ep 11: Operation Paperclip/Sunrise (Start at 26:45 minutes)

https://rumble.com/v23u5qs-altered-state-ep-11-wed-900-pm-et-.html

After WWII there were actually three programs. Operation Paperclip, Operation Sunrise and Operation Sunshine. Operation Paperclip was for general consumption. Operation Sunrise was for ‘conspiracy theorists’ if they got inquisitive and to HIDE Operation Sunshine. Even Zak conflates the two in the video.

OPERATION SUNRISE

Operation Sunrise was a series of secret negotiations arranged through a number of intermediaries and facilitated by Swiss Army Intelligence. They were held in March 1945 in Switzerland between representatives of the western Allies and Germany.

Allen Dulles (who later became the Director of the CIA) and Waffen-SS General Karl Wolff (a senior Nazi, once known as the “eyes and ears of Heinrich Himmler”) were the senior figures involved. After a number of confidence building measures, the main meeting was on the 19th March 1945 in a secluded estate at Ascona (close to the Italian border north of Milan).

The initial aim was to agree on the terms for a German surrender of their forces in Italy….

https://www.militaryhistories.co.uk/surrender/sunrise

OPERATION SUNSHINE

Zak Paine  was given this document that WAS CLASSIFIED BY THE CIA. It was written by an Ex CIA agent.

How Allen Dulles and the SS Preserved Each Other

by Peter Dale Scott

He talks about it extensively in his video. However it is about Project Sunshine not Project Sunrise. This is probably why it was classified.

ABOVE BILL GATES: THE ROCKEFELLERS. FROM OPERATION PAPERCLIP TO CHINA, WHO AND AIDS

….Following the war, Henry Kissinger, who had become General Alexander Bolling’s German translator and principle assistant.

(Bolling, of course, was the Godfather to the Joint Intelligence Objectives Agency that ran “Project Paperclip,” the secret exfiltration of approximately 2,000 high level Nazis, about 900 of whom were military scientists and medical researchers, including Erich Traub, Hitler’s top biological weapons developer and virus expert. Bolling also served as a high ranking member of the Inter-American Defense Board, a Washington based group that delivered Walter Emil Schreiber, Hitler’s chief medical scientist, the “Angel of Death” Joseph Mengele, and his assistant, “the butcher of Lyon,” Klaus Barbie, among others, to safe Havens in South America where they worked on CIA projects.)

In fact it was Henry Kissinger’s job to seek and find such Nazis that might be of service to America, and Kissinger became the chief of Army Counter-Intelligence in this regard. He trained other agents to hunt down Nazis at the European Command Intelligence School in Oberammergau, not to be tried for war crimes necessarily, but rather to serve U.S. military rather than Russian interests.

It was this operation that principally spirited the creation of the CIA as a cover agency for the powerful Gehlen Org, the German intelligence agency run by Reinhard Gehlen — an organization whose power superseded even the Nazi SS because of its prewar connections with German military intelligence.

After Hitler, Gehlen served Allen Welsh Dulles, whose “Operation Sunshine” brought Nazis into the U.S. spy service….

Remember Kissinger was Klaus Schwab’s mentor and thus fundamental in the development of the World Economic Form.

The ReichsWEF Part V

…We now arrive at Klaus Schwab, the founder of the ReichsWEF. We will explore the man, his family and business connections, and the true intention behind his monstrosity, the World Economic Forum.

Klaus’ family was tied to nobility that maintained business partnerships dating back centuries. These families were involved with Swiss private banking, innovation during the industrial revolution, and the creation of an atomic bomb for the Nazis. Using the Red Cross, they also helped the Nazis wherever and whenever they could.

Klaus would maintain close ties with his family friends, eventually founding the World Economic Forum in the Swiss town where his namesake bought a huge parcel of land. The early years of the ReichsWEF received enormous support from Harvard, as well as an array of former Nazis, SS leaders, militant communists, fascists and accused satanic pedophiles….

Will Zoll

For more information see: Nazi Industrialism, Technocracy, Social Engineering: A History of Klaus Schwab’s Family Values

OPERATION PAPERCLIP

Pivotal Role of Allen Dulles in Shielding Nazi War criminals Operation Paperclip

Allen Dulles was the longest-serving CIA Director who dominated American intelligence for a generation. He personified a cadre of Ivy League pragmatic elitists in high echelons of the government who greatly admired Germany’s scientific achievements. Princeton educated, Dulles affected the demeanor of a diplomat and professor rather than a spy. Prior to his CIA position he headed the operations of the Office of Strategic Services (OSS) in Switzerland. In the 1930s Dulles served as legal adviser to the delegations on arms limitation at the League of Nations where he met with the world’s leaders including: Hitler, Mussolini, Litvinov. He was a senior partner in the law firm, Sullivan & Cromwell.

Dulles and the other high ranking intelligence officials and in the State Department, had the highest regard for the Nazi elite – the Reich’s generals, chemists, medical doctors, and engineers – whose research and achievements were mostly in wartime technology, racial hygiene, torture, and genocide. Dulles exploited his post in OSS to quash war crimes prosecutions of senior Nazi officials and German business leaders who cooperated with him [<– This is important as it explains why the Nuremberg trials were a dud. One lawyer complained about how she was blocked. See further down. — GC] in a series of clandestine schemes to secure a U.S. advantage in Central Europe. Dulles personally intervened to ensure the escape from prosecution of major German bankers and industrialists complicit in the Nazis’ extermination-through-slave-labor program. Throughout the war and the years after, his reports to Washington ignored almost entirely the massacre of Jews – as though they were of no consequence…

Another article:

Operation Paperclip: The Secret US Operation to Use Nazi Scientists And Engineers to Win Cold War

Moving forward in time, another ‘Conspiracy Site’ gives a history of the CIA/Mockingbird Media.
February 17,2018 The Millennium Report – How the C.I.A. completely took over the mainstream media with OPERATION MOCKINGBIRD

ALLEN DULLES

Most are aware of Operation Paperclip, however very few are aware of the details of Allen Dulles and the beginning of the CIA


March 2005 Allen Dulles, the Nazis, and the CIA by Cory Panshin

Supreme Court Justice Arthur Goldberg once stated that “The Dulles brothers were traitors.”  Some historians believe that Allen Dulles became head of the newly formed CIA in large part to cover up his treasonous behavior and that of his clients.

Christian Dewar, Making a Killing


Just before his death, James Jesus Angleton, the legendary chief of counterintelligence at the Central Intelligence Agency, was a bitter man.  He felt betrayed by the people he had worked for all his life.  In the end, he had come to realize that they were never really interested in American ideals of “freedom” and “democracy.”  They really only wanted “absolute power.”
Angleton told author Joseph Trento that the reason he had gotten the counterintelligence job in the first place was by agreeing not to submit “sixty of Allen Dulles’ closest friends” to a polygraph test concerning their business deals with the Nazis.  In his end-of-life despair, Angleton assumed that he would see all his old companions again “in hell.”

Michael Hasty, Paranoid Shift

…Dulles remained a diplomat through the early 1920’s, spending part of that time in Berlin.  However, he left government service in 1926 for the greener pastures of private business, becoming a Wall Street lawyer with the same firm as his older brother, John Foster Dulles.

By the middle 20’s, Germany had started recovering from the effects of the war and its postwar economic collapse, and the great German industrial firms were looking like attractive investment opportunities for wealthy Americans.  W.A. Harriman & Co., formed in 1919 by Averell Harriman (son of railroad baron E.H. Harriman) and George Herbert Walker, had led the way in directing American money to German companies and had opened a Berlin branch as early as 1922, when Germany was still in chaos.  At that time, Averell Harriman traveled to Europe and made contact with the powerful Thyssen family of steel magnates.  It was to be a long-lasting and fateful partnership.

The Thyssens’ steel business had suffered greatly from Germany’s defeat, and old August Thyssen had decided to guard against future setbacks by creating a system of private banks.  He founded one in Berlin and another in the city of Rotterdam in the Netherlands.  In the wake of Harriman’s trip, a third bank was added to the network, the Union Banking Corporation, founded in New York in 1924 with George Herbert Walker as president.  Having their own personal banking system made it easy for the Thyssens to move assets around, launder money, conceal profits, and evade taxes.

By 1926, W.A. Harriman was doing so well that Walker gave his son-in-law, Prescott Bush, the gift of making him a vice president.  In 1931, W.A. Harriman merged with a British firm to create Brown Brothers, Harriman, and Prescott Bush became a senior partner.  During the 1930’s, Brown Brothers, Harriman would increasingly direct its clients’ investments to German companies.  The Rockefeller family was prominent among these clients, and Standard Oil developed particularly close connections with the chemical giant I.G. Farben….

It was into this heady atmosphere of high-level investments and financial manipulation that Allen Dulles entered when he joined the firm of Sullivan and Cromwell in 1926.  He would become the lawyer for the Thyssens’ Rotterdam bank and would also represent other German firms, including I.G. Farben…

After the attack on Pearl Harbor in 1941 brought the United States into the war, the close associations of so many of its leading industrialists with German firms began to catch up with them.  For example, it was discovered that Standard Oil had engaged in a cartel with I.G. Farben to produce artificial rubber and gasoline from coal for the Nazis.  They had renewed this agreement even after war broke out in Europe in 1939 and had supplied certain patents to the Germans while keeping them hidden from the U.S. Navy and American industry.

John D. Rockefeller, Jr., the principal owner of Standard Oil, claimed he had no involvement in day-to-day operations, leaving the blame to fall entirely on company chairman William S. Farish.  Farish — whose daughter was married to Averell Harriman’s nephew — pled “no contest” to charges of criminal conspiracy in March of 1942 and agreed to make the patents available in the US.  However, fresh revelations kept coming out, and Farish was called repeatedly to testify before a Senate committee investigating national defense.  His health broken by the increasingly hostile questioning, he collapsed and died of a heart attack in November 1942.

At the same time, in October of 1942, Prescott Bush was charged with running Nazi front groups, and all shares of the Union Banking Corporation were seized by the U.S. Alien Property Custodian.  The elaborate system of holding companies which Bush and Harriman had created in association with the bank started unraveling as well.  Things were looking very bad for the old gang.

But just then, Allen Dulles worked a miracle.  (to be continued … some day … when I figure out how he managed the trick)

Here is another article on Allen Dulles.

April, 2016 Allen Dulles: America’s Greatest Spymaster and Traitor

In the article Dr. Eric T. Karlstrom does a compilation of quotes from different books and articles. For example one by Dan Estulin who has investigated the Bilderberg group.

XIII. Operation Safehaven (Cleansing the Record of Nazi/American corporate collaboration) and the Marshall Plan

a. Loftus, J., 2011, America’s Nazi Secret: An Insider’s History of How the United States Department of Justice Obstructed Congress by: Blocking Congressional Investigations into Famous American Families Who Funded Hitler, Stalin, and Arab Terrorists; Lying to Congress, the GAO and the CIA about the Postwar Immigration of East European Nazi War Criminals to the US; and Concealing from the 9/11 Investigators the Role of Arab Nazi War Criminals in Recruiting Modern Middle Eastern Terrorist Groups:

“The Special Assistant Attorney General of the United States closed all of the treason cases in Occupied Germany. Not a single corporate officer ever went to jail for doing business with the Nazis, either in America or the United Kingdom. The Justice Department covered it all up. More than a hundred American traitors were returned home after many profitable years of serving Hitler. The Army’s original investigative files, codenamed ASHCAN and DUSTBIN are still off limits to “protect the privacy” of the American citizens involved. An American Intelligence Officer, Allen Dulles, used his position in the OSS to protect himself and his clients from investigation for laundering Nazi funds back to America.

Shredding the captured Nazi records was the favorite tactic of Dulles and corporate “volunteers” who stayed behind to help run the occupation of post-war Germany. Most of the Nazi records were shipped to the old torpedo factory on the Potomac River in Alexandria, Virginia. There the representatives of various intelligence services culled the documents under the guise of the War Department’s European Acquisition Project….

Estulin, D [an]., 2015, Tavistock Institute; Social Engineering the Masses:

“While Allen was employed in Switzerland, his brother John Foster was working at the State Department in Washington. Their uncle, an ultra-conservative Robert Lansing, was President Woodrow Wilson’s Secretary of State. The Dulles brothers actively courted Nazi officials in the 1930’s, as did the Rockefeller and Wall Street corporate interests, such as Ford Motor Company and IBM and helped them escape after the war, especially when Allen Dulles became CIA Director beginning in 1953…..

… operations, amongst them Odessa, which helped relocate Nazis into Peron’s Argentina and Die Spinne or “The Spider,” a loose designation of the post-war remnants of the Nazi secret police and covert intelligence apparatus, whose US point man was a Rockefeller Republican Party supporter, Harold Keith Thompson.

In 1945, Dulles, along with former Gestapo OSS agent, Hans Bernd Gisevius, was accused by the US Treasury Department of laundering Nazi funds from Hungary into Switzerland. The investigation was eventually dropped when the US State Department claimed jurisdiction

If anyone still has any doubts about the close proximity of the Rockefeller clan to the Nazis, in 1945, President Truman fired Nelson Rockefeller for his role in engineering the creation of Peron’s fascist regime, which provided a ‘safe haven’ for over 100,000 Nuremburg criminals delivered by Allen Dulles from Europe….

Here is yet another article on Allen Dulles.

The Dulles Brothers and Their Legacy of Perpetual War: A Brief Review of Two Essential Recent Books

….However, Talbot is more complete than Kinzer regarding Allen’s dark doings. He goes into far more horrifying detail about Project MKUltra (the CIA torture/mind control program). He relates whole stories missed by Kinzer about Allen’s collaboration with Nazi war criminals. And he delves deeply into the issue of Allen’s possible involvement in the Kennedy assassination, which Kinzer only briefly mentions.

Scholarly Kinzer’s chief weakness is a certain lack of cynicism about the Dulleses and what drives them, especially in his concluding passages. Talbot, on the other hand, brilliantly cites C. Wright Mills to depict John Foster as an unctuous servant of the power elite, and perceptively cites Carl Jung to analyze Allen (who actually was psychoanalyzed by Jung) as a manipulative sociopath.

Left-liberal Talbot’s chief weakness is his rather evident fondness for Democratic presidents (especially Franklin D. Roosevelt) which mars several chapters. For example, Talbot’s indictment of Allen’s World War II career rings less true than his other critiques because it largely rests on his agreement with FDR’s monstrous war-extending insistence on unconditional surrender.

Together, the Dulles brothers inaugurated the perpetual war that has extended from the Cold War to today’s Terror War. It is a vitally important tale, and one masterfully told by both Kinzer and Talbot.

Dan Sanchez

And the hits keep coming…

2001 The CIA’s Worst-Kept Secret: Newly Declassified Files Confirm United States Collaboration with Nazis

Honest and idealist … enjoys good food and wine … unprejudiced mind …”

That’s how a 1952 Central Intelligence Agency (CIA) assessment described Nazi ideologue Emil Augsburg, an officer at the infamous Wannsee Institute, the SS think tank involved in planning the Final Solution. Augsburg’s SS unit performed “special duties,” a euphemism for exterminating Jews and other “undesirables” during the Second World War.

Although he was wanted in Poland for war crimes, Augsburg managed to ingratiate himself with the U.S. CIA, which employed him in the late 1940s as an expert on Soviet affairs. Recently released CIA records indicate that Augsburg was among a rogue’s gallery of Nazi war criminals recruited by U.S. intelligence agencies shortly after Germany surrendered to the Allies.

Pried loose by Congress, which passed the Nazi War Crimes Disclosure Act three years ago, a long-hidden trove of once-classified CIA documents confirms one of the worst-kept secrets of the cold war–the CIA’s use of an extensive Nazi spy network to wage a clandestine campaign against the Soviet Union.

______________________________

SO WHERE DID THIS PHILOSOPHY OF THE CIA/DEEP STATE COME FROM?

Will Zoll (a team) has a thesis that Prussia/Germany was never really defeated but instead went underground to become an army without a country.

Summary: #PRUSSIAGATE

An invisible hand sits behind humanity, exerting control over the human will. This hidden virus scours the earth, looking for hosts who will adopt its ideology, and wage war against dissenters.

You cannot leave a captivity that you cannot see.

Prussian ideology is this captivity. The awakening is seeing this invisible enemy, knowing its patterns, recognizing how we engage with it and understanding its ultimate end-game. Revealing the hidden enemy, is how humanity defeats the hidden enemy.

Understanding the ancient Prussian playbook shines unwanted light upon this tyrannical insurgent. This is the road to true freedom.

This is #PrussiaGate.

The #PrussiaGate papers are revealing when and how the most formidable army on earth [appeared] to fade away, but really just became invisible. This was the key to their transition from localized wars to complete world domination. To do this successfully, they would need to control intelligence agencies and media, but they also selected to use central banks, debt and large corporations to control the people. In this way, the US was essentially the “head of the snake”, although the influence was world-wide.

In terms of really understanding this ‘invisible hand’, the 2016 US election would prove to be a turning point for the entire world. Humanity received a four-year lesson in how the media deceive and how intelligence agencies were infiltrated….

This is a story about Prussia. The once great empire that is no more – or at least officially. As Comte de Mirabeau quoted:

Prussia is not a nation with an army, but an army that controls nations.”

Prussia was never anything other than an ideology of War against all that it could not control. From the lands the Teutonic Knights had tamed, Prussia used shrewd methods of diplomatic espionage, carried out by its ambassadors and industrialists. Prussia sought to destroy everything it could not control via campaigns of “comply or die”. Prussian time frames are measured in centuries.

As one US President once said, it “was a Big Idea, a New World Order”.

Will Zoll

“…As one US President once said, it “was a Big Idea, a New World Order”.…” That refers to Bush who is directly connected to the CIA, Dulles and the Nazis as shown above. Now isn’t that a big surprise?

This is a link to all the #PRUSSIAGATE substacks. If you have the means please toss a few fiat dollars at these great writer/historians.

Table of Contents: #PRUSSIAGATE

Another substack by Will Zoll:

The Power of the Prussian Micropenis

…Hitler and the whole Nazi era is said to have been deeply inspired by the 18th Century Prussian king. Even when all appeared lost for Hitler in WWII, as he retreated to the Fuhrerbunker in 1945, he ensured that his prized possessions came with him. One of those included a portrait painting of Frederick the Great – the man he still sought inspiration from, even though all appeared lost….

…Prussia is in a constant state of war. It is not [a] state, but an army seeking to control states. Prussia’s entire quest is about making the best spear in order to implement their New World Order, where they control and tax the world. Prussia does not understand peace.

Prussia is about winning and nothing else. The best spears (micro-penises aside) and the best soldiers, will eventually win all wars. Winning war involves mass deception, which involves mind-control, of your enemy AND your own army….

History will recall that many other events took place under Frederick the Great’s rule of Prussia:

The rise of the Rothschilds; the rise of the Jewish cult of Sabbatai Zevi; the safe harboring of the purged Jesuit order; the birth of the Illumnati; and the American Declaration of Independence.

All but the last occurred under the watchful eye of Frederick the Great.

The discerning reader will now understand that the American Revolution and the US Constitution was a complete affront to everything that was Prussian. The notion of freedom was toxic to a tyrannical ruler. This war continues today.

Will Zoll

Just in case it is not obvious, Frederick the Great ruled when American Patriots revolted against the GERMAN/PRUSIAN crown of England. From WIKI: ” Frederick was the son of Crown Prince Frederick William of Prussia and his wife, Sophia Dorothea of Hanover. She was the daughter of King George I of Great Britain and his wife Sophia Dorothea of Celle, the sister of King George II of Great Britain, and the mother of Frederick the Great (King Frederick II of Prussia).

DURHAM ==> DURHAM BOAT
WHO were the targets of General Washington?
“….Hessian forces, which were the German auxiliaries aiding the British.” – WIKI

Frederick William I was succeeded by his son, Frederick II (1740–86). Frederick immediately disbanded the expensive Potsdam Giants and used their funding to create seven new regiments and 10,000 troops. The new king also added sixteen battalions, five squadrons of hussars, and a squadron of life guards…

In September 1743, Frederick held the first fall maneuver (Herbstübung). The different branches of the Army tested new formations and tactics; the fall maneuvers become annual traditions of the Prussian Army. Austria tried to reclaim Silesia in the Second Silesian War. Although successful in outmaneuvering Frederick in 1744, the Austrians were crushed by the king himself in the Battle of Hohenfriedberg and the Battle of Soor (1745). The Prussian cavalry excelled during the battle, especially the  Zieten Hussars. For his great services at Hohenfriedberg Hans Karl von Winterfeldt, a good friend of King Frederick, rose to prominence….

During the 1740s, Frederick the Great issued a series of new regulations and documents regarding his army’s experiences during the first two Silesian wars and how they would relate to future wars. The doctrines he espoused focused on speed and offense. Lighter and faster cavalry were preferred over heavy cavalry; while Frederick William I had treated hussars as luxury troops, his son made them an integral part of the army. The artillery was to use light three-pound guns which made up for their lack of power with versatility…

WIKI

So the Hussars were Fredrick the Great’s ‘best spear’ and loaned to his cousin, the King of England, to help crush the American Revolution. I doubt he was very happy when General Washington managed to capture 1,000 of the Hussars.


Back to Will Zoll’s The Power of the Prussian Micropenis

…What had been birthed [in Frederick the Great] was a formula to create the perfect soldier and leader for a totalitarian world. These soldiers would be devoid of any personal experience with the family unit. In fact, the family unit would be so decimated that a young person would grow up hating the family unit.

Only a soul, cloaked in complete evil and darkness, would think of such an ideology to cultivate and harness such darkness and depravity, that would lead to the end of humanity, if not checked….

Will Zoll

Transhumanism anyone? And the entire ‘Progressive’ push for the destruction of the family, procreation, Christianity and sanity. Also the corporate dehumanization of employees by gradually treating people as interchangeable cogs (Human Resources) instead of people to be trained and kept for decades (Personnel.)

The Prussian Origins of Modern Education

Children Belonged to Prussia, for Prussia

The “enlightened despot”, King Frederick the Great of Prussia, laid the foundations of the Prussian primary education system in 1763. Prussia was one of the first countries in the world to introduce compulsory primary education. It took over a century for other European nations to follow.

Prussia, however, was in a constant state of war. State-funded compulsory education was never intended for the children to find individual enlightenment, but rather to know their place in society and obedience to the State. There were 6 key outcomes for the Prussian education system:

#1. Obedient soldiers to the army,

#2. Obedient workers for mines, factories, and farms,

#3. Well-subordinated civil servants, trained in their function,

#4. Well-subordinated clerks for industry,

#5. Citizens who thought alike on most issues,

#6. National uniformity in thought, word, and deed.1

Everything within the grasp of Prussia was to be utilised for the benefit of the state. Individuality was a curse that could give rise to free thinking and therefore a population that could potentially question the motives of their government.

Frederick knew this all too well. Renowned as one of the greatest military minds in history, he believed that a thinking soldier would destroy the cohesion of his army….

Will Zoll

Fredrick’s idea was to provide just enough education for his people to be useful but not enough to allow freedom of thought. He was also intent on making sure his people were fed. So he was seen as a ‘benevolent dictator.’

Fredrick was not only a great military leader. “…Frederick the Great’s true passions as he grew up was an intellectual pathway of the Arts, music (composing and playing), and philosophy….”

I think Fredrick’s philosophical inspiration was SPARTA.

Ancient Spartan Communism

According to tradition, Sparta was the handiwork of Lycurgus;… >>> — he persuaded the Spartans to agree to a new distribution of lands on a basis of equality, and by other measures he weaned them from the love of silver and gold, and led them to adopt that harsh simplicity of life which the very name of Sparta has come to connote. Plutarch’s description is of interest because, waiving the question of its historical accuracy, it gives a very adequate definition of the ideal communistic state, as ideally imagined by countless later generations. In general, he says,


he trained his fellow-citizens to have neither the wish nor the ability to live for themselves; but like bees they were to make themselves always integral parts of the whole community, clustering together about their leader, almost beside themselves with enthusiasm and noble ambition, and to belong wholly to their country.

… the Spartan state was probably unique in some respects in the record of political institutions. It is difficult to recall any other state in which the individual was so completely subordinated to the general ends of the community — and such subordination is, of course, of the very essence of socialism in its general sense, as distinguished from that species of socialism generally referred to as communism. From the day of his birth, when he might be not merely subordinated but suppressed for the good of the state, the young Spartan continued to be disposed of in one way or another until death opened up for him a way of escape. The common education, which began at the age of seven, was wholly designed to make good soldiers, to teach men to suffer uncomplainingly the extremes of heat and of cold, of hunger and of pain, and in each was implanted the conviction that he belonged not to himself, but to the state…

And if you move on to modern Britain, you find the same philosophy.


Source: George Bernard Shaw, Prefaces (London: Constable and Co., 1934), p. 296

George Bernard Shaw: The Intelligent Woman’s Guide to Socialism and Capitalism, 1928, pg. 470

Sparta, Prussia, and the Fabian Socialists in the UK all share the same basic philosophy. If we boil it down there are really just two forms of government. Either the subjects are born to serve the State, OR the State is formed to PROTECT the God-given rights of the individual citizen. We are currently fighting to determine WHICH FORM OF GOVERNMENT THE WORLD WILL HAVE GOING FORWARD!

_________

HITLER & FASCIST SUPPORT IN THE USA

Musings from the ChiefIO: Hollywood’s Love Of Fascism

The world “Fascism” has been perverted by political advocates into some kind of “Right Wing Military Dictatorship” and the horror of all things Progressive.

Nothing could be further from the truth…

During the ’30s, Mussolini was a Hollywood Celebrity. He even was invited to do a Cameo in some Hollywood Movie and all the Stars and Starlets wanted to be at the parties where he was celebrated….

E. M. Smith aka Chief I O

E.M. Smith does his usual deep dive.

The Hollywood Reporter: The Chilling History of How Hollywood Helped Hitler

(Exclusive) In devastating detail, an excerpt from a controversial new book reveals how the big studios, desperate to protect German business, let Nazis censor scripts, remove credits from Jews, get movies stopped and even force one MGM executive to divorce his Jewish wife….

Harvard post-doctoral fellow Ben Urwand uncovers a darker side to Hollywood’s past.

Drawing on a wealth of archival documents in the U.S. and Germany, he reveals the shocking extent to which Hollywood cooperated and collaborated with the Nazis during the decade leading up to World War II to protect its business….

Hollywood was not the only American – NAZI collaborators.

This Is the Hidden Nazi History of IBM — And the Man Who Tried to Expose It

…Although dozens of companies, such as Coca-Cola and Kodak, made clients of Nazi Germany, a few American multinational corporations stand out for going the extra mile. They didn’t just sell tools and products; they collaborated with the Nazis in creative ways to help them design and execute the systematic destruction of the Jewish people….

The Big Pharma connection. The Rockefeller Foundation 

…. In 1939 a “Drug Trust” alliance was formed by the Rockefeller empire and the German chemical company IG Farben (Bayer). After World War Two, IG Farben was dismantled but later emerged as separate corporations within the alliance. Well known companies included General Mills, Kellogg, Nestle, Bristol-Myers Squibb, Procter and Gamble, Roche and Hoechst (Sanofi-Aventis). The Rockefeller empire, in tandem with Chase Manhattan Bank (now JP Morgan Chase), owns over half of the pharmaceutical interests in the United States. It is the largest drug manufacturing combine in the world. Since WWII, the pharmaceutical industry has steadily netted increasing profits to become the world’s second largest manufacturing industry; [3], [4] after the arms industry…..

IG Farben & Auschwitz

Auschwitz was the largest mass extermination factory in human history. However, few people are aware that Auschwitz was a 100% subsidiary of IG Farben. On April 14, 1941, in Ludwigshafen, Otto Armbrust, the IG Farben board member responsible for the Auschwitz project, stated to board colleagues:

“our new friendship with the SS is a blessing. We have determined all measures integrating the concentration camps to benefit our company.”

Thousands of prisoners died during human experiments, drug and vaccine testing. Before longtime Bayer employee and SS Auschwitz doctor Helmut Vetter was executed for administering fatal infections, he wrote to his bosses at Bayer headquarters:

“I have thrown myself into my work wholeheartedly. Especially as I have the opportunity to test our new preparations. I feel like I am in paradise.”

After WWII, IG Farben attempted to shake its abominable image through corporate restructuring and renaming. So great has been their success that the public has no idea that it many of the men responsible for such atrocities, were able to carry on their work even after the collapse of the Nazi regime. Namely, a medical paradigm that relies almost exclusively highly toxic drugs. Such men were in control of the large chemical and pharmaceutical companies, both well before and after Hitler. The Nuremberg Tribunal convicted 24 IG Farben board members and executives on the basis of mass murder, slavery and other crimes. Incredibly, most of them had been released by 1951 and continued to consult with German corporations. The Nuremberg Tribunal dissolved IG Farben into Bayer, Hoechst and BASF, each company 20 times as large as IG Farben in 1944. For almost three decades after WWII, BASF, Bayer and Hoechst (Aventis) filled their highest position, chairman of the board, with former members of the Nazi regime. Bayer has been sued by survivors of medical experiments such as Eva Kor who, along with her sister, survived experiments at the hands of Dr. Josef Mengele…..

As the above shows, it is important to note that not all of the USA viewed Hitler, the NazIs & Fascism with horror. This explains the next step in history.

After the war we got the Nuremberg Trials. No one mentions that part of the trials were run by a wet behind the ears Lawyer who graduated from HAAAaaarvard and then went into the military.

60 Minutes: What the last Nuremberg prosecutor alive wants the world to know

…Ferencz had immigrated to the U.S. as a baby, the son of poor Jewish parents from a small town in Romania. He grew up in a tough New York City neighborhood….

Lesley Stahl: You look so young.

Benjamin Ferencz: I was so young.  I was 27 years old.

Lesley Stahl: Had you prosecuted trials before?

Benjamin Ferencz: Never in my life. I don’t—

Lesley Stahl: Come on.

Benjamin Ferencz: –recall if I’d ever been in a courtroom actually.

….he finished at Harvard then enlisted as a private in the Army. Part of an artillery battalion, he landed on the beach at Normandy and fought in the Battle of the Bulge. Toward the end of the war, because of his legal training, he was transferred to a brand new unit in General Patton’s Third Army, created to investigate war crimes.  As U.S. forces liberated concentration camps, his job was to rush in and gather evidence….

Lesley Stahl: Did you meet a lot of people who perpetrated war crimes who would otherwise in your opinion have been just a normal, upstanding citizen?

Benjamin Ferencz: Of course, is my answer. These men would never have been murderers had it not been for the war. These were people who could quote Goethe, who loved Wagner, who were polite–

Lesley Stahl: What turns a man into a savage beast like that?

Benjamin Ferencz: He’s not a savage. He’s an intelligent, patriotic human being.

Lesley Stahl: He’s a savage when he does the murder though.

Benjamin Ferencz: No. He’s a patriotic human being acting in the interest of his country, in his mind.

Lesley Stahl: You don’t think they turn into savages even for the act?

Benjamin Ferencz: Do you think the man who dropped the nuclear bomb on Hiroshima was a savage? Now I will tell you something very profound, which I have learned after many years. War makes murderers out of otherwise decent people. All wars, and all decent people….

Here is a Jew, a Romanian, who as a young man went into the Death Camps right on the heels of the Nazis and retrieved evidence of the MURDER of “…over a million people murdered that way, over a million people, that’s more people than you’ve ever seen in your life…” and yet he calls these murderers …otherwise decent people…”

So not only do you have American and international corporations ‘sympathetic’ to the Nazis, you have this young JEWISH soldier, that has witnessed first hand the atrocities, sympathetic to the Nazis as individual people.

In passing I saw a comment by a female Nuremberg Lawyer that some prominent corporations stepped in and interfered with the trials. I cannot find it again. I think Belle Mayer was the lawyer.


BELLE MAYER ZECK DESCRIBES THE IMPACT OF THE NUREMBERG TRIALS ON HER

Belle Mayer trained as a lawyer and worked for the General Counsel of the US Treasury, Foreign Funds Control Bureau. This bureau worked to enforce the Trading With the Enemy Act passed by Congress. In this capacity, Mayer became familiar with the German I. G. Farben chemical company, a large conglomerate that used slave labor during World War II. In 1945, Mayer was sent as a Department of Treasury representative to the polstwar London Conference. She was present as representatives from the Allied nations outlined the principles of law for the prosecution and trial of Europe’s major war criminals. Mayer reported to this commission as it prepared for upcoming war crimes trials. She was then among the attorneys (including her future husband William Zeck) who prepared the indictment against the I. G. Farben company at the Nuremberg trials….

Women at Nuremberg: Belle Mayer Zeck

….In 1933, after losing an election to President Paul von Hindenburg, Adolf Hitler gave a speech to a small group of German industrialists in the home of Hermann Goering. It was persuasive: Chemical company I.G. Farben donated 500,000 Deutsche Marks to the near-bankrupt Nazi party, essentially breathing life back into it.

For this gift, I.G. Farben became one of the largest wartime government contractors for Nazi Germany. The company not only manufactured synthetic rubber and oil for the war effort, it owned a large stake in a subsidiary that produced Zyklon-B, the gas used to kill Jews en masse via the gas chambers at Auschwitz and other death camps….

“Without I.G. Farben and its tremendous resources – particularly, U.S. dollars, foreign exchange – Hitler simply couldn’t have waged war,”

she said in her 1999 interview with USC Shoah Foundation at age 80.

“They manufactured over 90 percent of the explosives in Germany. … Every bomb had their signature on it.”

… Her office in Washington, D.C. worked in partnership with a group of U.S. infantrymen in Europe who’d raided I.G. Farben headquarters in Frankfurt in the months after the war and left with gunny sacks filled with documents.

These documents made their way to Mayer’s office in D.C., and she and other staff began untangling the complex web of corporate trusts and business names meant to camouflage the ownership of the company….

… In her 1999 interview, Mayer – who died in 2006 at age 87 – explained how her investigation into I.G. Farben’s external assets would develop the case against the company.

“The investigation in the United States led to the identification of various factories and banks and warehouses throughout South America,” Mayer said. “I.G. Farben was like an octopus– it really covered the globe and has establishments and installations in every major city of the world.”….

Well that makes the Nazis fleeing to South America more understandable! Of course some did not bother to flee.

Nazi war criminals became high ranking commanders in NATO after WW2

….For decades former Nazis and German war criminals served at the highest echelons of NATO. Most of them were highly decorated Nazis, who later served in top positions in the Western German army, and were later promoted to serve as Commander and Chief of all NATO forces in Europe. This was not a unique event, but a very common phenomenon in post WW2 western Europe and especially in Western Germany. Nazi war criminals and people who supported and helped Hitler to carry out the holocaust and other war crimes, genocides and crimes against Humanity were almost never put on trial for their crimes against the Jews, the Poles, the Greeks, the Russians and the people of Europe, but instead were installed in top positions in NATO, in the western German government, army, industry and western German society at large

The most famous of them was Adolf Heusinger, chief of the Operationsabteilung from 1940-1944. He was actually Hitler’s chief of staff and helped plan the Nazi’s invasions of Poland, Norway, Denmark, and France. He was promoted to colonel on August 1, 1940 and became chief of the Operationsabteilung in October 1940, making him number three in the Army planning hierarchy. After the war, this German war criminal, the man who helped Hitler plan and execute his invasion of neighboring countries which directly led to the deaths of millions of people, was not even put on trial, quite contrary he was allowed to take over the newly established West German army, the “Bundeswehr”. In 1961, Heusinger was made the Chairman of the NATO Military Committee (essentially he was NATO’s chief of staff). He served in that capacity until 1964….

HMMMmmmm, Maybe that is why NATO is so gung-ho to support the Nazis in Ukraine.

_______

THE CURRENT ANTI-AMERICAN CIA

Shadowgate,  16 Aug 2020, by Millennial Millie includes Tore Maras. It covers the characters involved in Russiagate, the Fake News, ANTIFA/BLM riots – ALL the same people and who the string pullers are. She points out the dirty work is OUTSOURCED TO CONTRACTORS. (Think Rodney Joffe, identified as Tech Executive-1 in the Sussmann indictment) In this way FOIA requests are useless.

A look at some of the contractors who supply the labor for the deep state’s psy ops and attacks on the [Trump]0 administration. One involved contractor turned whistleblower calls it “managing the most malevolent operations you can imagine.”

‘ShadowGate’ features two whistleblowers, Tore and Patrick Bergy, who describe a network of government contractors in the Intelligence Community with access to the NSA’s dragnet surveillance and AI programs and who exploit this information to blackmail and control politicians and other powerful people.

These Globalist traitors are the primary administrators of the Fourth Generation warfare being waged against the American people as we speak.

The film details Interactive Internet Activities (IIA) and the military psychological warfare weapon, Shadownet, which is used to control the public narrative through the Fake News, to fix elections, to organize the BLM riots among other things.

Bergy explains how Shadownet was built by the military with US tax dollars and how General James L Jones, Obama’s National Security Advisor took this intellectual property and privatized it for personal gain.

Bergy says Shadownet was used heavily in the Ukraine Color Revolution by Paul Manafort and that an entire cottage industry has since sprung up, with multiple companies using this same software. Watch it before this gets taken down.

https://ugetube.com/watch/shadowgate-documentary-millie-weaver_ODcJoXVoKJu3tvb.html

And finally the last video, a more recent Tore Says video:

Sundance has an article featuring the video: Interesting Video

The VIDEO: Enjoy the Show/ Director’s Cut by Tore Says

https://www.youtube.com/watch?v=FSX7ESKLdTM&t=2735s


GC/wm

The Ongoing January Sixth MKULTRA Experiment on Patriots

I just realized something horrible, which makes it even more imperative that we either get our American prisoners out of DC Gitmo, or ask our military to bomb a certain building conducting inhumane experiments on American prisoners of war.

The House, now under Patriotic American control, needs to stop pussyfooting around. The fastest way to make the evil communist DOJ give up its hold on our patriotic Americans, is to make their friends in CIA sweat for what it is doing to our fellow Americans. The CIA hates exposure, so it’s time to expose.

I am absolutely convinced of the following.

Part of the reason patriots are being slow-walked in DC Gitmo, is so that they can be experimented on by the CIA.


First, some background on CIA human experimentation.

You may or may not be familiar with a documentary which the CIA absolutely HATES, called “The Minds of Men“, by an outfit called Truthstream Media, otherwise known as a couple of filmmakers named Aaron and Melissa Dykes.

This documentary explains, very calmly and rationally, an important PART of the broad and comprehensive research program called MKULTRA. In particular, it discusses the secret history of CIA human experimentation on American mental patients, fronted through a bunch of ingenious American university scientists, who never got Nobel prizes, because their important but shocking work was basically kept on the down low by the CIA and the elite who funded it. This was all very typical of how scientists are ABUSED by politicians, corporations, spies, and “higher powers” (i.e., rich elites, secret organizations, etc.).

The Minds of Men makes all the connections, all the way back to the elite, and it will blow your minds.

Unless things have changed recently, you cannot get this DVD on Amazon, because Amazon is Bezos, and Bezos clicks his heels to CIA orders.

You have to get the documentary mailed directly from Truthstream. In any case, it’s very eye-opening. The CIA has deep ties to American university research, and the whole “CIA recruiting on campus” fake controversy is basically a kind of cover, assisted by dupey communist agitators, who likely have no clue that the CIA which helps run communism in America, is already deep in the universities, and has been from the beginning.

Anyway, today, our friend Aubergine posted a new video by Truthstream, which is this:

If you watch this, you will get a sense of Truthstream’s style, which is very patient and visually reinforcing, so that their message really embeds. It’s worth skimming the above, if you’ve never seen The Minds of Men. That documentary is very much in the same style.

This video is great, of course, and if you watch it, you will realize that it’s extraordinarily “meta” and ironic in regards to this very post. However, that’s tangential to my point.

Aubergine pointed out the new video’s discussion of the Stanford Prison Experiment, in which pretend prison guards abused pretend prisoners. You should already be getting some vibes here.

Gail Combs responded, first quoting Aubergine:

“…it was a real social experiment in which some college students were assigned to play guards while others were to be prisoners. It is most notable for the fact that although it was supposed to last two weeks, it had to be terminated after only six days because the “mistreatment of prisoners escalated so alarmingly.””…”

and then making this connection to January Sixth:

Think of the Jan 6th Political prisoner where the guards KNOW there will be NO REPERCUSSIONS FOR THEIR BEHAVIOR… -Gail Combs

That is when I realized suddenly what is going on.

https://tv.gab.com/channel/trump_won_2020_twice/embed/a-secretly-recorded-video-is-leaked-628e6947996a4c915e8a1998/preview

All of the January Sixth prisoners have reported maltreatment at the hands of guards, appalling living conditions, isolation, and other forms of abuse.

However, SOME of the prisoners have also reported on the PROPAGANDA to which they are being subjected. And I’m not just talking about being forced to watch only CNN, or having been given leftist “defenders” who try to talk them into parroting DOJ propaganda to get out.

In particular, after much initial isolation from the world, they are then given very “read-only” tablets, which are loaded with typical “donkey com” propaganda – pro-left, pro-Islam, anti-Christian, etc., etc.

They don’t get to choose what information they get. They only get REGIME INFORMATION. And when it’s interactive, like these tablets, it has to be like Facebook on steroids.

This was immediately clear to me as CIA experimentation. Let me explain why.


The CIA didn’t just experiment surgically on mental patients, using university scientists. They did a LOT of experimentation on prisoners – both Americans and foreigners. How do I know this?

By reading this book:

This book is what is known as a “limited hangout” by CIA. It’s actually very easy to tell what they’re hiding and what they’re not, by reading it, if you go in with the idea that the CIA actually HELPED this book get written.

The basic idea of the MKULTRA hearings back in the 1970s, was to make people think that the project was an old, discredited, FAILURE. Lots of shiny objects in the way of nasty and seemingly pointless experiments, drugs, sex, and mistreatment of CIA personnel BY other CIA personnel were provided.

This is how the CIA closes out a successful project, and makes the success “disappear”.

Kinzer’s book is just more of the same, updated for what has already leaked out or been figured out, since the MKULTRA hearings. New scandalous clickbait information in the same directions, plus a few harmless new angles, help to make it look like:

  • MKULTRA was an abject failure
  • benzodiazepines and modern super-opioids never existed
  • drugged hypnosis and “brainwashing” never worked
  • everything CIA worked on was stupid, bizarre, and “paranormal”
  • Sidney Gottlieb didn’t know what he was doing, and just messed around
  • there was no real plan to MKULTRA
  • there was no successor to MKULTRA
  • the experimentation was mostly on captured foreign spies
  • the experimentation on American prisoners was just stupid LSD trips

Very typical limited hangout. Deny, deny, deny all the successes.

The reality is that Sidney Gottlieb was an excellent top-level researcher, much in the same vein as Oppenheimer, and when tasked with a formidable technical challenge, approached it from all the best logical angles.

The successes of MKULTRA were substantial

  • brainwashing techniques on par with the Soviets and Chinese
  • expertise in drugged hypnotic debriefing and programming
  • ability to suppress conscious memories
  • ability to implant false memories
  • ability to program mental patients to commit crimes
  • strong understanding of human brain electromagnetics
  • strong understanding of psychology, memory, altered states

If you prowl around on this site, searching in the search widget on MKULTRA and similar, you will find much information about those successes, including my personal experiences with the technology, shortly AFTER it was declared “case closed” in the late 1970s. The drugs most likely used are NEVER mentioned in the Kinzer book. Kinzer is New York Times. Yeah he had great contacts – and they either used the hell out of him, or he’s part of their game. I don’t really care which, or need to know.

So how does this fit in with January Sixth?


The Kinzer book does not mention the shocking brain surgical experimentation on American civilians discussed in The Minds of Men, but it does talk about drug experiments on:

  • captured foreign spies during the early cold war
  • Whitey Bulger and other American criminal prisoners

This is why I’m very confident that we’re seeing experimentation on Trump supporters in DC Gitmo. What kind of experimentation do I suspect?

  • typical social stuff – study of resistance to isolation, maltreatment, reward/punishment
  • searching for “John McCains” who are amenable to “reform” / brainwashing
  • drugged hypnotic interviews while sleeping (see my own experience here)
  • social media psychological experimentation (Facebook stuff) using the “tablets”

I suspect that the “American Soviets” who run DOJ and CIA are very busy studying these captured patriots, trying to figure out how to turn them into good socialists.

DC Gitmo = Hanoi Hilton

I suspect that if DC gulag prisoners are given this knowledge, they will be able to think back and realize exactly how they were experimented on by their communist keepers.

Congress, or course, can demand information, but expect that if they are given anything, it will just be limited hangouts.

Nevertheless, it should be interesting to hear from the J6 prisoners themselves, what was done to them, once they realize that they were being experimented on by communists.

W

PS – the CIA is always dumping massive amounts of CHAFF on MKULTRA, to cover up the reality. Don’t believe everything you hear about it – especially the stuff that seems “too attractively controversial”. Shiny objects, IMO. I will discuss that, shortly.

Trans Indoctrination Psychology and Methodology Revealed in Startling Transition Regret (“Detransitioning”) Video

In my opinion, everybody needs to watch this video, to understand the viral nature of what is then easily seen as the trans identity error, and how it spreads.

This is a complex subject, but at its foundation is (in my opinion) a very simple, almost child-like error – that a “desired non-self” can be obtained against the will of the universe by changing the self into that non-self. You will see how internet image memes were consciously used to promote and spread this error.

The internet has promoted this kind of immature thinking in many ways, as a byproduct of both the viral-enhancing and spiritual-enabling nature of the internet. At the same time that the internet allows us to reach every human mind, in principle, it also allows new kinds of error to flow and to grow. The spiritual nature of the internet, for good and bad, is REAL.

For every Duchess meme, spreading the Good News which allows us to appreciate what we have and what we will have, there are antithetical memes and meme-spreaders who seek to make us envy the very objects of our desire, and then to attempt to falsely become those things.

Listen carefully to understand that Facebook is seeking to create a future where this kind of error is even more possible, more likely, and more difficult to avoid. Instead of becoming stronger, spiritually, to contain actual error, Facebook, under election criminal Mark Zuckerberg, creates a new world of even more error, which can deceive even more strongly.

This young lady is one of the most articulate and insightful people I’ve ever heard. Clearly she would have been a “win” for the other side. As it is now, she exposes the trans error at levels I never expected.

Please watch the entire interview, and leave your comments and thoughts below.

Thank you!

W

PS – if this video disappears, look for it on Michael Knowles’ channel on Rumble:

https://rumble.com/c/MichaelKnowles

DEAR KAG: 20220107 – The Pub is OPEN / TES Special Edition / Pimp Your Coof Kit / Dealing With Uncertainty / ThEthSkep’s Big Fix of All Things Coof: CCP Hiding Chinese 2018 Release of SARS-CoV-2 Virus

The Pub is OPEN!

Yeah, we still have staffing problems, but who doesn’t under China Joe?

While off to a rocky start, we are staying open as many days of the week as possible, just like some of the small businesses that I patronize.

Keep up that LOCAL PRESSURE on the Biden cabal by going to school board meetings and supporting TRUE non-monopoly capitalism – it SKEERS Kapo and Little Red Jen somethin’ FIERCE.

Likewise, patronize those SMALL BLOGS that provide new viewpoints and ideas!


We Serve Whiskey And Guns To Indians Here!

Yup! FREEDOM is GOOD TROUBLE, and we’re in favor of it, for everybody, much to the consternation of our local maskies and vaxxies.


I had the special pleasure of being “refused service” by a maskie recently – he simply walked away from the cash register and went into the back. Some of it was due to race. Having been “not served” because of race before, I can spot that fairly easily, and this person was not exactly “hard to read”.

Three other staffers (all forced to wear masks, sadly) came to my assistance and took my order.

I maintained a pleasant demeanor, as part of one of several psychological warfare tactics that I have adopted recently, in fighting against the VAXZIS and MASKZIS.


While our beloved REAL bartender takes a needed break of unknown duration, we continue to ENDEAVOR TO PERSEVERE.

So what’s on the ODD BAR’S CRAZY MENU this week?

We’ve served alcohols our first week, including menthol, ivermectin, and hydroxychloroquine.

Next, we served amines , including second generation antihistamines.

Today, we’ll toast each other with an element that we’ll borrow from Steve…..

…..and some very special natural alcohols and derivatives, including among the 4 of them, 3 terpenoids, 2 phenols, 1 ester, and 1 ether.

More on these wonderful “liqueurs” later!


Christmas Spirit

There’s still time to spread omicron! GET BUSY!!!

While we do have some members out with Omicron now, including Brave and Free, the real question is whether we’re going to see a big peak in March and April, like we did in 2020.

And if you’re gonna get sick, you might at least consider having some willing cohort, looking for that natural immunity, to get sick with you!

thank you
thank you pictures

Ah, thanks to SMILEY for reminding me of the goofy fun of these wonderful but stupid GIFs called “Blingees”!

And now, the rules of the pub.


HOUSE RULES

God bless us, every one! Tiny Tim had such a beautiful soul. He hadn’t a mean bone in his body…unlike most of us. But in keeping with Christmas, we promise to honor Wolf’s rules and keep Scrooge at bay. The Utree is where the Ghost of Christmas Present will conduct you should you need to rattle some chains. Another option, should all hell break loose is here.

Now, back to business.


AMEN!


Current Art On The Wall

Now for something a bit different…..

Vector background. Molecules and chemical formulas

…..and something a bit more familiar.

David Teniers the Younger (1610–1690), The Alchemist, ca. 1643–45. Oil on panel, 20 1/8 x 28 in (51 x 71 cm). Herzog Anton Ulrich Museum, Braunschweig (139)

LINK: https://www.metmuseum.org/blogs/now-at-the-met/2020/alchemy-science-making-marvels


TES Special Edition

As one of the early “discoverers” of The Ethical Skeptic on Twitter, I was happy that I was able to get a few people interested in his precise and well-considered thoughts on things – especially regarding the phony scamdemic. TES was always utterly perturbed by the bad science of the “pandemic”, and worked on a daily basis to “correct the fact checkers” – which was all of hilarious, sad, and joyful.

After I was kicked off Twitter, I rarely saw him, due to my own laziness, really, but in 2021, some GREAT links to The Ethical Skeptic’s work popped up here. THANK YOU, to all who follow him and keep us informed.

THIS was a classic.

LINK: https://theethicalskeptic.com/2019/03/07/nelsonian-inference-and-cultivated-ignorance/

ARCHIVE: https://archive.fo/wZKYb

This work really helped me to GRASP and understand the leftist tactic of “pretending not to know”, and – more importantly – how to spot it.

So let’s look at some of his even more recent stuff.


Pimp Your Coof Kit

LINK: https://theethicalskeptic.com/2021/12/29/our-household-covid-kit-item-listing/

This one got us all thinking about “coof kits”, and GA/FL suggested some of us putting up our own versions. I initially thought that this might not be a good idea, because people’s needs and medical situations really VARY – one of the main reasons that “practicing medicine without a license” is actually a bad idea in normal times. I thought it better to have a broader discussion.

However, I just realized that I did put up a kind of “minimal” kit last week, and it’s worth looking at it.

This kit was designed for people who DON’T have a smart plan already figured out, and don’t want to investigate “hard to find” things like ivermectin and hydroxychloroquine.

Here is what I had, followed by my earlier reasoning. The main change is adding Vitamin C, as discussed below.


Wolf’s COVID Care Package

  • Thermometer (thermal digital is easiest)
  • Antigen test kit(s) (yeah, good luck finding one, although they are coming back after New Years)
  • Antihistamine of your choice (Claritin, Zyrtec, and Allegra are the easiest – 1-2 a day)
  • Aspirin (regular, or low-dose if your stomach doesn’t like it – 1 a day)
  • Listerine or Betadine mouthwash/gargle for mouth and throat
  • Vitamins C and D, Zinc, Calcium, Magnesium, Multivitamin including Selenium.
  • Quercetin (including natural sources) or Green Tea
  • Saline or other nasal spray, rinse, or wash of your choice

The thermometer tells you when to use your precious test kit – when you suddenly have a fever and a sore or tingly throat.

The test kit gets you a positive diagnosis that opens doors for things like antibodies, or an official test.

A positive test means you can BEGIN TREATMENT at THERAPEUTIC DOSES.

The antihistamine insures that YOU WILL ALMOST CERTAINLY NOT DIE, because it stops the second, allergic, inflammatory stage of COVID in its tracks.

The aspirin makes doubly sure you won’t get clots, but be careful – don’t take it if you’ve had trouble with aspirin. Talk to your doctor if unsure.

The gargles (Listerine or Betadine) massively reduce viral load and speed time to recovery.

The saline and nasal washes lower viral load, and maintain nasal breathing.

The quercetin and green tea help zinc’s antiviral action by increasing cellular zinc levels.

The vitamins and mineral supplements keep you at antiviral levels of these things. In particular, zinc and vitamin D3 need to be at non-deficient levels.

Please consult authoritative sources from TRUE medical doctors like the ones at https://flccc.net.


Cthulhu noted that I hadn’t mentioned Vitamin C – I have now added that, because it’s likely to help and can’t hurt (“First, do no harm”) and also follows the McCullough Principle (“Signals of Benefit, Acceptable Safety”). I don’t think it’s nearly as important as the antihistamine and “clot-blocker”, but I do have to admit that Vitamin C was certainly far better than nothing when I survived Wuhan with only mild lung damage.

What I’m going to do now is to encourage all of YOU to talk about your “war chests” and “coof kits”, and explain your reasonings about things.

This will help people who are deciding what THEY might want to add to their kits – OR REMOVE, if there is something better for their particular situation.

Remember – everybody has their own unique medical needs.

I will put my thoughts in the comments, just like everybody else.

NOW – about those natural “essential oils” in Listerine.

Let’s look at them.


Menthol


Thymol


Eucalyptol (2 views)


Methyl salicylate


These are all natural substances of roughly the same molecular size and composition (mostly carbon and hydrogen with 1-3 oxygen atoms), all of them being either pungent oily liquids or smelly, vaporous crystalline solids.

There are some relations between these things.

Thymol is basically menthol where the 6-membered ring has been made benzenoid – meaning like benzene – with 3 double bonds.

Notice that methyl salicylate is also benzenoid. Methyl salicylate is related to aspirin, and has similar activities. Don’t drink Listerine, even though the amounts are (believe it or not) rather small.

Eucalyptol is also structurally related to menthol, although it’s harder to see. Try to see it.

All of these natural substances, when isolated from their sources, were very early pharmaceuticals. They ALL have pharmacological activities, which many would regard as “primitive” by today’s standards, and yet, gargling Listerine is PROVEN to be extremely effective in reducing viral load of COVID-19 variants – about 80% as effective as iodine solutions.

Why might this be? Here is just ONE small line of immunological evidence.

LINK: https://pubmed.ncbi.nlm.nih.gov/9810029/

To be honest, we’re a bit late to the game here. Native Australians from the first wave of immigration, roughly 65,000 years ago, discovered the utility of eucalyptol by their own investigations.

LINK: https://successfulaffiliateru.com/medicinal-use-of-eucalyptus-the-australian-aboriginal-way/

Here is some additional information about early Australian medicine using natural products.

LINK: https://theconversation.com/the-art-of-healing-five-medicinal-plants-used-by-aboriginal-australians-97249

There is a great picture of what is essentially a native doctor’s medical bag in the second link. When it freaks you out a bit, let it. This is a way of getting you to appreciate human intelligence outside your modern experience.


Lastly – IODINE.

I have not tried this, and I am not sure I would like it, but it’s a viable option, IMO. I actually like Listerine, and it worked for me on delta, so I’m happy with that. I did NOT try Listerine in the nasal cavity. Not sure that I’d like that. I stuck to saline.

I did find a paper that showed Listerine to be roughly 80% as effective as povidone-iodine.

Here is link to a review which states something similar, and a summary of the review.

LINK: https://www.ncbi.nlm.nih.gov/labs/pmc/articles/PMC7842245/


Executive summary

Methods

  • A review of literature was conducted regarding the use of commercially available antiseptics and SARS-CoV-2.

Results

  • Povidone-iodine (betadine), ethanol and essential oils (Listerine) and a combination of xylitol and iota-carrageenan (purified from red marine algae) were shown to reduce viral load of SARS-CoV-2 in vitro by 3–4 log10 in 30 s.
  • Chlorhexidine, a widely used oral rinse, does not act as quickly in reducing viral load in 30 s as povidone-iodineI, but binds to cell proteins, extending protection.
  • Hydrogen peroxide is not as effective as other oral rinses in vitro and cell toxicity is a concern.
  • Hypertonic saline is not directly virucidal, but halts replication by increasing hypochlorous acid inside the cell.

Conclusion

  • Several commonly used nasal antiseptics and gargles have shown efficacy against SARS-CoV-2 in vitro and clinical trials are currently underway to study their impact on disease course and transmission.

Future perspective

  • These commercially available products should be further evaluated due to their potential ability to reduce the transmission of SARS-CoV-2 and other viruses that are yet to emerge.

You can also make your own povidone-iodine gargles and nasal rinses – Dr. McCullough has retweeted a nice recipe for this. Click through to Twitter for more information.

Here is a great long post on all of these methods, including hydrogen peroxide – an alternative to iodine.

LINK: https://jeffreydachmd.com/2021/09/povidone-iodine-mouth-wash-rinse-gargle-for-c0-ld-prevention/

Do beware that some people need to be careful with iodine, including people with hypothyroid.

LINK: https://www.webmd.com/diet/foods-high-in-iodine#1

LINK: https://www.webmd.com/vitamins/ai/ingredientmono-35/iodine


Dealing With Uncertainty

LINK: https://theethicalskeptic.com/2021/12/24/the-riddle-of-certainty/

ARCHIVE: https://archive.ph/wpfWu

This is another GREAT article, talking about one of my FAVORITE complaints about modern science, which has resulted from a really SICK and UNHEALTHY compartmentalization, as well as insulation of scientists from internal criticism (lack of “herd review”). This condition has allowed all sorts of pathological science to gain ascendancy without check, balance, or proper community criticism.

For example, CLIMATE CHANGE gets more input from FINANCIERS than it does from the many scientists like me who think we are acting irrationally and presumptuously on ERRORS. These errors have been induced by the WRONG forces – beneficiaries not committed to truth – within a small pathologically influenced community – much like what’s going on with improperly influenced government science and the “clot shot”.

This piece by The Ethical Skeptic contains a graphic using a BULLSEYE which you really need to see. It makes a very important point about science – which I can apply DIRECTLY to Anthony Fauci.

Fauci’s extreme focus on antibodies to the spike protein as a nearly sole measure of “success” of the “clot shot”, is a perfect example of what TES is talking about.

I have referred to Fauci’s over-focus as “antibody hypnosis”. In fact, I see this kind of obsession and compulsion repeatedly throughout his career, and would wager that:

  • it’s why he always “wins” against the Judy Mikovitses and the Kary Mullises
  • it’s why he’s so highly paid
  • it’s why he’s tied to so many “grim reaper” experiments
  • it’s why corrupt industry loves him, and is in bed with him

TES makes a general point about the kinds of information which actually provide STRONGER PROOF – and this set includes something I love – INDEPENDENT CONFIRMATION BY ALTERNATE LINES OF REASONING – not just “duplication of results” and “confirmation of results” – which are both sadly lacking as well, but not nearly as important.

I have powerful, direct experiences in science with the need for RESOLVED DIVERSE INPUTS and AVOIDANCE OF HYPNOTIC REASONING as safeguards against pathological science.

However, THEY (and I mean “they”) are using various forms of hypnosis, including MASS, COMMUNITY, PEER, and INDIVIDUAL to advance science in ways that THEY want.

Human science is far more controlled than we either admit or understand.

Anyway, back to the article.

There is a quote from Elon Musk therein which is really worth your while, and which TES puts in the context of what he is talking about.

Bluntly, it feels wonderful to know that SOMEBODY GETS IT.

What Musk is talking about here is basically the “bullseye” metaphor that TES uses. And THAT is related to the following item.

While Fauci is very committed to the LEVELS of his antibodies, he has not properly processed feedback that would indicate he’s OPTIMIZING THE WRONG THING.

Here is a link to Steve Kirsch’s interpretation of Sucharit Bhakdi’s and Arne Burkhardt’s analysis of people who died after vaccination, showing that these deaths were ALMOST ALL related to the “clot shot”.

LINK: https://stevekirsch.substack.com/p/bhakdiburkhardt-pathology-results

Kirsch REALLY explains this well. Malone takes note of this, too.

IMO, it would appear that Fauci is optimizing the WRONG ANTIBODIES in the WRONG WAY, because the vaccines are CREATING the WRONG ANTIBODIES in the WRONG PLACES.

Please read Kirsch’s article and then the Bhakdi-Burkhardt paper to understand this.

PAPER: https://doctors4covidethics.org/wp-content/uploads/2021/12/end-covax.pdf

Now, Fauci may be optimizing the wrong antibodies in the wrong places for a variety of reasons. Those exact reasons are not nearly as important as the fact that they are simply WRONG.

I believe Bhakdi, Burkhardt, and Kirsch – this is a risky vaccine, and now we begin to understand WHY.

Based on this knowledge, I personally will not be taking these vaccines.

In my opinion, these results CLEARLY show that vaccination against SARS-CoV-2 should not be effected by IM injections of a full SARS-CoV-2 spike protein, and even more emphatically so, NOT by genetic vaccines delivered by IM injections. In my very early opinion, this is going to be a CLASSIC case for using RBD antigen (protein) and/or nasal delivery as a concession to the virus – with nasal delivery being used as a SAFETY feature and NOT merely a convenience.

To have SAFER vaccines for DISCRIMINATING SHOPPERS like me, we’re going to have to compromise with the virus. That’s just the way it is.

There may be SOME who thought that we could arrive at a compromise that would reduce human populations, but frankly I don’t like that deal.

In my opinion, ANYBODY with vascular, cardiac, clotting, or other issues like WANTING TO HAVE KIDS SOMEDAY, or NOT RISKING CANCER, should absolutely avoid the current clot shots.

In my opinion, the clot shot is stupidity advanced by greedy people who are controlled and manipulated by really evil people. In other words, it’s not stupid, greedy, or evil – it’s ALL OF THE ABOVE.

The DISEASE is no picnic, and I can see some people making the risk-benefit calculation in favor of the vaccine – particularly newer RBD antigen vaccines like Corbevax (Hotez/Baylor/India/open-source). But if people are dying in 5 years from experimental mRNA vaccines with the full spike protein – well, that is exactly like the RISK that one takes with SMOKING SOMETHING YOU DON’T UNDERSTAND.

Seriously, most Americans would refuse to take a novel “legal” or illegal designer drug, given stories like the “bath salts” and “Parkinson’s heroin” experiences which shocked the public in horror headlines.

Parkinson’s from Designer Heroin (Ironically related to Paraquat)

LINK: https://www.latimes.com/archives/la-xpm-1985-07-29-me-5136-story.html

LINK: https://pubmed.ncbi.nlm.nih.gov/28282815/

VIDEOS: https://duckduckgo.com/?q=mptp&iax=videos&ia=videos (warning – they’re really sad)

Effects of “Bath Salts” (Euphemism for CCP Designer Drugs)

LINK: https://www.npr.org/sections/parallels/2014/06/16/321779232/how-bath-salts-a-drug-made-in-china-wreaked-havoc-in-the-u-s

LINK: https://www.justice.gov/usao-wdny/pr/akron-man-arrested-importing-bath-salts-china

The CLOT SHOT is a RISK, and not all of us will want to take that risk.

Mandating that risk is EVIL, IMO, and Democrats deserve to DIE AT THE POLLS in November for it.

Period.

They have BLOOD on their hands.


ThEthSkep’s Big Fix of All Things Coof

LINK: https://theethicalskeptic.com/2021/11/15/chinas-ccp-concealed-sars-cov-2-presence-in-china-as-far-back-as-march-2018/

ARCHIVE: https://archive.fo/zww1q

This is what I really wanted to show you, right here.

The Ethical Skeptic, or TES, or “ThEthSkep“, as I sometimes call him, has proven to my satisfaction that CCP lied even MORE than we previously thought possible.

Is this hard to believe? That we got CHUMPED by CHINA yet again?

Yeah. Getting chumped by China YET AGAIN is a thing.

I am tempted to try to construct an “elevator pitch” of ThEthSkep’s argument, and have even asked him (in a moderated comment) if he could provide such a short explanation that I could pitch to others.

If he DOES provide one, I will do an entire post on it.

For the moment, I will just give you my “two paragraph description” of his very long and elegant post, which post I can guarantee most here will have trouble following.

TES argues that setting an earlier date for the actual initial Chinese release of an ancestral pathogen to current SARS-CoV-2, provides a far better explanation of the facts at hand, as well as some facts which he generated through analysis of the genetics of SARS-CoV-2 variants, than does the “standard model” of a late 2019 release, whether that late release is taken from the early Chinese LIES about a zoonotic outbreak in December 2019, or from the October 2019 Wuhan lab activities which have always struck me as potential disinformation.

In particular, an early 2018 release of a less pathogenic ancestor explains the omicron variant’s surprisingly early 2020 appearance and low pathogenicity so well, and China’s population resistance to the more pathogenic Wuhan variant, whether that was a descendant or (my thinking) a new release, that IMO it is the duty of the “standard model” to explain all of the facts better than the TES theory.

Now, like I said, this post by TES is not an easy read, even for those with some knowledge of the field, and even for those experienced in reading the scientific literature. He moves at “review speed” through a lot of reasoning and even his own work, which is not all shown, but which is all fully described and referenced.

I am actually WAITING for my first reading to fully sink in, but I can tell you this. As soon as I “freed myself” from the necessity of a late 2019 release, everything “coof” just started falling into place.

This is one of those things that starts generating RESETS in my mind, on everything I had thought before. Once you see what TES is getting at, it’s almost impossible to unsee it.

AND I CAN GO FURTHER.


I talk to a LOT of people, and listen carefully to their thinking about COVID. One of my sources is somebody who has a lot of contacts in Europe and Asia, especially India, due to working for an international firm.

That person strongly believes, based on illnesses within the corporation as well as associated entities, that something like COVID-19 was already circulating worldwide during ALL of 2019.

I had set this aside, unable to fit it into everything else I knew. NOW, however, it makes easy sense. In fact, the details which I don’t want to give, fit his model of spread EXACTLY.

If TES is correct, and I believe he is, then WE WERE DEALING WITH VARIANTS EVEN BEFORE THE CDC BEGAN TALKING ABOUT VARIANTS. In fact, they never told us that THE ORIGINAL WAS LIKELY JUST A VARIANT OF SOME PRIOR VARIANT.

And THIS explains much better why Fauci, Baric, Dazsak, and all the others were ready to cover up – because a virus related to their research had already gotten out in 2018. Going along with the Chinese story was a RELIEF to them – and they grabbed on tightly.

In other words, a conspiracy of aligning interests, not something discussed on paper or by phone. It’s a brilliant Chinese move, actually. Proffer a lie and see if our own scientists will join them in it.

The USEFUL IDIOT American media? NO PROBLEM.


And not just THAT stuff, but now we have much more evidence that these bugs could have been “in the wild” EVERYWHERE – including possibly just outside the Baric lab, near where Gail Combs picked up a “coofy” bug much earlier than would have been possible with a late 2019 release. (I will let her address the time-frames.)

Consider that China could even have been trying to FRAME or intimidate Baric with a stateside release in the vicinity of his lab. Why? Because NOW we have MOTIVE.

Does it make sense NOW that these highly contagious bugs could have been getting out willy-nilly from these laboratories? Or that China has been playing fast and loose with biological releases?

What does this mean?

It means that the whole NIH-Fauci-Wuhan complex has been in cover-up mode, trying to SAVE THEIR DANGEROUS RESEARCH which they know is VERY likely to be SHUT DOWN BY A CONGRESS RUN BY THE PEOPLE – no matter WHAT THE CAUSE OF THIS RELEASE.

Remember how I said the President Wolf Moon would send a cruise missile into every BSL level 4 that didn’t shut down immediately upon his inauguration? Those missiles armed with whatever insured that all viruses were FRIED?

See the motive to get rid of Trump now? WE THE PEOPLE cannot be allowed to interfere with their “holy” research.

And wait – there’s MOAR.


Somewhere in the years between 2005 and 2010, around the time I got an extremely SARS-CoV-2-like infection, complete with anosmia, exhaustion, and “sore lung”, I took note of the fact that all of my Asian colleagues in the “anti-CCP” camp became very religious about taking COVID-like precautions in our CCP-Chinese-infested workplace. These precautions included isolation, surface and aerosol measures, like wipes, air filters, and even clothing choices.

Most of us dismissed it as an “Asian thing” like masks, even though it was a sudden and new social phenomenon, but because I had contacts in that community who were sometimes sources of insight on CCP skulduggery, I noticed that ONLY the “antis” were engaging in the protective behaviors – the mainlanders and pro-CCP Hong Kongers/Taiwanese were not.

Interestingly, I was not getting any good information on the trend – unlike other scuttlebutt at the time.

Was it real or disinformation? Was it an op to flush out the antis? Was it “anti” paranoia?

I have no idea. But I personally think that China has been up to “bio-tricks” for a LONG time – as in back BEFORE SARS (2003).

If 2018 is the first time China released any biologicals, I would be VERY surprised.

SO – see what you think. Read this sucker, and then think about it.

I think TES is onto something.


A Note About January 6 – and More

I have been avoiding all things January 6, largely because I don’t want to give Nancy Gambino any “lift” as far as her phony “investigation” into HER OWN CRIME.

I understand her game plan, and I’m not going to play along.

I would have loved to have recounted that amazing day in another long, glowing, “all about me and my experiences” post, but no.

THIS IS WAR.

In my opinion, we can bring down these horrible communists faster by focusing on whatever WE want to focus on.

Nancy says “the fight is over here”.

NOPE. Go to hell, Mafia Bitch. We know what you did. With Kapo’s dirty FBI. And the backing of Mitch McConnell and SCOFFLAW SCOTUS.

Some may want to join the fight against Pelosi right now, and please feel free to “follow Darren Beattie into Pelosi’s breach”, but I think that MANDATES are going to kill these bastards at the polls, if we just help them commit electoral suicide.

Expose the “clot shot” risks more fully, and show that the mandates are MORE EVIL.

We need to make Democrats – destroying America for GREED under the cover of virtue signals – absolutely unelectable, and I think we can.

ENJOY THE SHOW.

Thank you all for being here. Have a great weekend.

W