Tag: spike protein

Dear MAGA: 20250508 ✾ Thank God ± Theistic Evolution ∈ Thursday Open Topic / Q-Level Vaccine Strategy

This man, making Christmas calls from the White House, believes the world is a sphere. And he has even flown around it! So has our beautiful FLOTUS, who happens to be his wife!

Truth and common sense must be valued by us, as individuals, in order to lastingly disempower the authoritarian fake news media. This includes the perniciously smarmy science media, which never answers for its errors and lies. I believe that the media has been responsible not only for leftist pathologies like scientism, medical fascism, and radical gender ideology, but also for reactionary movements like modern flat Earth, rejection of all medicine, and Biblical geological literalism.

Just as Wheatie’s Stormwatch Monday Open Thread was created as a place for people to openly express their thoughts and opinions, so, too, is this Thank God Thursday Open Thread, where honest but civil discussion of all topics is encouraged. This thread is also to be known as Theistic Evolution Thursdays, due to the author’s expected “pontification” about his scientific, religious, and political opinions. You are welcome to pontificate back! Free speech matters!

Please label all AI-generated content as being such, unless it is patently obvious (e.g., humorous AI images). It is important that we as individuals not begin to pretend that socially derived artificial intelligence is actually our own, as this form of stealthy social information averaging and feedback would be one more pretense and deception between people, in service of stupid Marxist socialism, and of those who wish to substitute their communally protected lies for actual truth.

The source of alleged truth matters, not for the truth itself, but for validation.

And yes, it’s THURSDAY…again.

And that’s it. We’re done stealing from Wheatie.

OK – maybe her rules need to be posted.

  • No food fights.
  • No running with scissors.
  • If you bring snacks, bring enough for everyone.

Other rules may be derivable from these, and that conjecture is left for discussion.

If there is nothing beyond the “W” below, then this is a placeholder. For health reasons, I can’t always post a timely opinion before each Thursday, but I will try. Otherwise, you have this placeholder post, where YOU provide the content. Enjoy!

W

I begin this first post with an aside. The header for Thank God / Theistic Evolution Thursdays is a stained glass depiction of the first chapter of Genesis from the Tree of Life Synagogue in Pittsburgh, Pennsylvania.

It is the author’s contention that there ARE actual answers in Genesis – but they’re more profound and astounding than even the very smart people of antiquity could imagine, or even more recent minds from the 1800s, when modern humanity fell hard for the “6000 year” trickery.

To uncover the mechanistic details of the creation outline in Genesis, requires the work of many people over a long period of time. THAT very point – big things, long times – being a pattern worth noting.

God works with WAY bigger math than we can comprehend. At least, that is MY conjecture.

Q-Level Vaccine Strategy

It is my belief that what we are seeing unfolding right now, in HHS, NIH, FDA, and CDC, is the result of deep strategy and planning by some very smart and well-intended people, who are changing American healthcare for the better, whether it wants to make the necessary changes or not.

If that sounds like the Q folks, then good. If that merely sounds like the Trump administration, doing what it was elected to do, then good. If that sounds like some super-secret project of some other nature, then good. If that sounds like God taking a hammer to Satan’s bureaucracy, then good. I don’t care so much to convince you WHY it’s happening, as much as I want to show you THAT it’s happening.

What I hope to do here, is to quickly and simply explain where I see this hidden hand making plays, and why it might be making them.

I begin by explaining when and where I became aware that something good was going on.

First, barkerjim reported this item discussed on “Coffee and COVID”:

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454816

Here is the link to Coffee & COVID:

LINK: https://www.coffeeandcovid.com/p/anomalous-thursday-may-1-2025-c-and

Here is the link to the Daily Fail article causing the excitement:

LINK: https://www.dailymail.co.uk/health/article-14668777/trump-admin-rfk-jr-universal-vaccines-project-hhs.html

Gail Combs then explained the significance.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454911

Gudthots then provided a much longer explanation of this significant change in vaccine testing.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454980

In summary, vaccines will now need to be tested against placebos – in ways that will critically distinguish safe vaccines from risky vaccines. This is a HUGE win for honest medicine.

I want to emphasize how strategically brilliant this is. Asking that vaccines be tested “normally” not only reverses outrageous vaccine non-testing that was installed by Fauci and Friends during COVID – it reverses sketchy and abused science all the way back to the 1960s and 1970s.

It’s undoing ALL of the bad stuff that has happened in vaccination since the middle of the last century.

And yet – “nutjob” RFK Jr. isn’t demanding the banning of even a single vaccine, as his opponents screamed and howled he would. No – he’s simply asking that vaccines be tested for safety like everything else.

What is happening here is unassailable. And yet, this move is going to stop sketchy vaccines like the COVID vaxxes IN THEIR TRACKS. Even other vaccines with “good” track records are going to have to prove themselves. And some “good” ones may turn out to be “not so good”.

This is the perfect move right now. Does this sound like something “beginner” secretary RFK Jr. would choose to play, all on his own, in the deadly DC chess game, against highly experienced globalist scum bureaucrats?

I don’t think so. It’s too smart. Something is going on.

But it gets better. And it was at the “gets better” point that I knew something very awesome was going on.

And no – I’m not talking about this, that eilert brought!


WOW. But no, that’s not what I’m talking about.

I’m talking about this, that holly brought.

LINK: https://www.theqtree.com/2025/05/01/dear-maga-open-thread-20250501-fear-not/#comment-1454912

Yes – at first this looks spooky. And probably looks spooky-good to the stupid left.

Here is the Daily Fail link to that one.

LINK: https://www.dailymail.co.uk/health/article-14668777/trump-admin-rfk-jr-universal-vaccines-project-hhs.html

Cuppa Covfefe correctly spots that the Daily Fail is massively fear-mongering here.

Then holly brings the information that perked up my wolf ears BIG TIME.

Here’s the link to that HHS/NIH announcement:

LINK: https://www.hhs.gov/press-room/hhs-nih-announces-generation-gold-standard.html

This is the point where I FREAKED!

It only took about 2 seconds for Aubergine to figure out what I was saying.

Reread that if you have to – that’s the bottom line, pretty much.

I’m going to explain it in more detail below.

And that’s why we’re here. I’ll get to it in a minute, but let’s finish capturing the discussion.

Here, PAVACA notes that this “universal vaccine platform” isn’t being championed by only the good guys, and being openly opposed by the bad guys. Not at all. The bad guys have their fingerprints all over it, too, and seem to be helping it. But note the military connections. I suspect that’s important.

Things get interesting here, and require some explanation.

As Trump says….

“Complicated business.”

IMO Fauci was doing what Fauci does. Get close to it. Get power over it. Then kill it or sabotage it. So we need to watch out for the Fauci Minions trying to take down MAHA.

Kalbo opined that it would be nice to get those deadly COVID mRNA vaccine EUAs withdrawn ASAP, and I have to agree. But again, it looks like what is being done here is strategic, and even in a military way, where a non-zero number of casualties are accepted to insure victory.

What I mean here is that by making two ostensibly pro-vax moves that are going to nuke the COVID vaccines shortly, guaranteed, it will be impossible to stop the withdrawal of the EUAs down the road. No amount of media-Democrat propaganda acting and photo ops will be able to stop the EUAs from being withdrawn.

Finally, this comment of mine, which I will explain.

So what the heck is going on? The “test vaccines against placebos” part sounds like a no-brainer, and also like a “no-risk winner”. But why should we trust ANYBODY talking about some new vaccine platform? They’re even using Fauci’s cynical, cringe-inducing “gold standard” terminology, which was even used for remdesivir and all kinds of other Fauci horrors.

Time for me to explain my opinions on some fundamentals.

The mRNA COVID-19 vaccines were always flawed, but in more fundamental ways than even most scientists realized. By being authoritarian drones, most scientists never questioned the most fundamental problem with the Pfizer, Moderna, Novavax, and Corbevax vaccines, which affected them all, despite their multiple different technologies.

None of these vaccines targeted anything but the spike protein.

NONE of them.

NOTHING more.

In contrast, the Chinese CoronaVac / Sinovac whole-virus vaccine, using the same beta-propiolactone deactivation method as the new proposed universal vaccine platform, targets every protein coded in the viral genome.

Stated differently, immunity created by the Chinese CoronaVac whole-virus vaccine technology, is much more like natural immunity, than is immunity created by the mRNA vaccines.

That means that the immunity is broader – targets more viral proteins – and thus acts against more variants and future variants.

So by now, readers have to be asking why on Earth the Americans would be pursuing the “clot shot” technology – and not the likely best vaccine technology, which was being pursued by China.

This, in spite of (or perhaps because of) the fact that the storage and processing of Pfizer’s clinical data is done in China. ALL of it. In China.

I don’t want to get sidetracked by the “why” of American stupidity and errors on vaccines, which potentially gets into medicine under communism versus under capitalism, as well as what communists might do, medically, in a war on capitalism. But I do want to point out that – for some very good but very weird reason, we are suddenly doing things right in the area of vaccines.

It’s important to look at the HHS announcement on the universal vaccine platform. Reading it really sheds light on what is going on.

I will include the text here, with my comments in ***bold. Note the date of the press release – May 1, 2025. This is happening right now, basically.

HHS, NIH Launch Next-Generation Universal Vaccine Platform for Pandemic-Prone Viruses

*** Note that this is not only changing all these vaccines to a “new” platform – it is clearly targeting anything over which the wicked Fake News Media might declare a “pandemic”. IMO the use of the terms “Next-Generation” and “Universal” are targeted and very intentional.

Washington, D.C. – The U.S. Department of Health and Human Services (HHS) and the National Institutes for Health (NIH) today announced the development of the next-generation, universal vaccine platform, Generation Gold Standard, using a beta-propiolactone (BPL)-inactivated, whole-virus platform.

*** Again, this is the Chinese CoronaVac technology.

This initiative represents a decisive shift toward transparency, effectiveness, and comprehensive preparedness, funding the NIH’s in-house development of universal influenza and coronavirus vaccines, including candidates BPL-1357 and BPL-24910. These vaccines aim to provide broad-spectrum protection against multiple strains of pandemic-prone viruses like H5N1 avian influenza and coronaviruses including SARS-CoV-2, SARS-CoV-1, and MERS-CoV.

*** The goal shift toward broad-spectrum protection is key. This is good for doctors, patients, and society – it is BAD for drug company profits. It does not provide an enduringly problematic if not endless money churn, like spike protein vaccines do.

“Our commitment is clear: every innovation in vaccine development must be grounded in gold standard science and transparency, and subjected to the highest standards of safety and efficacy testing,” said HHS Secretary Robert F. Kennedy, Jr.

*** First note that Kennedy is making this statement. Next, note the tie-in to the improved testing with real placebos and not morally framed but morally sketchy tricks to avoid them. Transparency seems to imply that past vaccine development was done quietly between government and drug companies, and not in public, where it should be done.

The program realigns BARDA’s operations with its statutory mission under the Public Health Service Act—to prepare for all influenza viral threats, not just those currently circulating.

*** Changing the focus of BARDA to include “sustainability” of viral control – meaning it has to think about future virus variants and not just the variant of the week, is a brilliant way to break up the grift between regulators and vaccine makers, which is based on evolutionary churn of targeted proteins (like the spike), and pretending not to know that this is fundamentally designed to continuously fail. The designed failure, which seems to have the purpose of sticking more needles into more people at younger and younger ages, is certainly advantageous for depoppers, who IMO may be identifiable from decisions that ultimately supported the grift. A key point is that Geert vanden Bossche’s warnings about viral mutation under the pressure of leaky vaccines must now be considered – these warnings cannot be ignored by intentionally blind policy, which is a cold but effective technique.

“Generation Gold Standard is a paradigm shift,” said NIH Director Dr. Jay Bhattacharya. “It extends vaccine protection beyond strain-specific limits and prepares for flu viral threats – not just today’s, but tomorrow’s as well – using traditional vaccine technology brought into the 21st century.”

*** Look whose name is on this! Jay Bhattacharya! This shows that honest science is re-taking control of what Pfizer was running. The point about “traditional vaccine technology brought into the 21st century” is talking precisely about CoronaVac, using smarter and smarter inactivation technologies.

Generation Gold Standard, developed exclusively by NIH’s National Institute of Allergy and Infectious Diseases (NIAID):

*** This sounds like bullshit to me, probably to placate the demons in NIAID, but maybe there were honest people in NIAID who were liberated from their captivity and suppression under Fauci, and they created this effort. If so, great!

*** The following points are most excellent, and explain why modern inactivated whole virus vaccines are so good. But the bottom line is that this is a MASSIVE shift away from the mRNA vaccines. Just read this carefully.

  • Recalibrates America’s pandemic preparedness. Unlike traditional vaccines that target specific strains, BPL-inactivated whole-virus vaccines preserve the virus’s structural integrity while eliminating infectivity. This approach induces robust B and T cell immune responses and offers long-lasting protection across diverse viral families. Moreover, the intranasal formulation of BPL-1357 is currently in Phase Ib and II/III trials and is designed to block virus transmission—an innovation absent from current flu and COVID-19 vaccines.
  • Embodies efficient, transparent, and government-led research. The BPL platform is fully government-owned and NIH-developed. This approach ensures radical transparency, public accountability, and freedom from commercial conflicts of interest.
  • Marks the future of vaccine development. In addition to influenza and coronavirus, the BPL platform is adaptable for future use against respiratory syncytial virus (RSV), metapneumovirus, and parainfluenza. It also offers the unprecedented capability to protect against avian influenza without inducing antigenic drift—a major step forward in proactive pandemic prevention.

Clinical trials for universal influenza vaccines are scheduled to begin in 2026, with FDA approval targeted for 2029. The intranasal BPL-1357 flu vaccine, currently in advanced trials, is also on track for FDA review by 2029.

###

SO – you can certainly see that it sure looks like the “good guys” are winning – and winning very easily. Too easily, IMO.

As long as the Fauci embeds are being watched carefully, to make sure they don’t interfere and sabotage, then I think we are headed in a very good direction.

Bottom Line – There is too much winning here to be just lucky beginner success by MAHA.

IMO, MAHA is getting help from behind the green curtain. And I would not be surprised if I was to learn that “Q players and Q friendlies” are part of that help.

JUST SAYIN’!

Have a great Thursday!

W

Wolf Pub

https://en.wikipedia.org/wiki/%CE%92-Propiolactone

DEAR MAGA: Open Thread 20250128 ❀ Call for Authors ❀ Scientific Opinions on the Medical Case of Susie Sampson

A continuation of Dear DePat’s Tuesday Open Thread

A call for weekly open-thread authors on Tuesday and Thursday

A discussion of various pathological possibilities, including some new ones, and an explanation of why I lean toward particular theories

First of all, the boilerplate.

By reference, I call to incorporate the rules spoken of in any of Deplorable Patriot’s recent posts, such as her final one.

DEAR MAGA: Open Thread 20250116

With that settled, I jump to the second item on the agenda.

A call for weekly open-thread authors on Tuesday and Thursday.

I know this seems abrupt, but DePat’s obituary has already published, and I’m already going to talk about even more sensitive topics now – by request – so I don’t feel too much guilt in making sure that DePat’s MISSION of keeping this site running is fully taken care of.

The best thing that we can do, in my opinion, to maintain Susie’s legacy in the MAGA world, is to keep all of her posts here (just under 1000 of them) online and searchable. SO – we need new authors for Tuesday and Thursday, to keep this site running.

Gudthots is thinking about taking over Thursday.

Do we have anybody else, who would like to do Tuesday? Which means that the post goes up Monday night, scheduled for one minute after midnight (I can help with this).

Just to be clear to potential authors, these daily threads are YOUR BABIES – meaning they don’t have to be anything like the way that DePat did them. In fact, it’s probably better not to. I invite new authors to come up with their own new styles.

We do have a very thin guideline post of basics in the sidebar, shown here:

Dear MOAB: YYYYMMDD Open Topic [exemplary daily post]

We were actually more rigorous about format then, but it does help that daily open posts publish on the day listed in the title, and that the titles have a searchable format.

Anyway, if you are interested, just leave a comment.

If you are shy about saying something, you can always do “PMTW” (see “Contact”), commenting on this post, and then I can respond anonymously in public, although I recommend just being open.

Looking forward to somebody picking up DePat’s second sword.

angel sword 2021-08-08 10-46-04.png

And now for the big item.

A discussion of various pathological possibilities, including some new ones, and an explanation of why I lean toward particular theories.

I begin by citing relevant portions of FG&C’s report on the “sudden and unexpected” passing of Susie, which he communicated to me privately.

7-8 weeks ago Susie attended a choir rehearsal, during which she had stood right next to a fellow choir member who she learned afterwards had been Covid vax-boosted for the 4th time that day. Perhaps she mentioned at some point in these pages that in the time since that night she believed she had contracted “long Covid”, experiencing physical weakness, insomnia, a persistent cough, and low appetite. She believed she had inhaled “spike proteins” shedding from the woman she stood next to that night at rehearsal, stating that had she known the woman had been so recently vaxxed she would never have gotten so close to her.

Recently, she had stated she was feeling better, the cough all but gone, and in the past week felt she had gotten over the insomnia hump and was getting good rest. I was optimistic. However, on Monday AM….inauguration day….her brother discovered her in her bedroom, unresponsive, after becoming concerned he had not heard her moving about and she had not come downstairs. Paramedics were subsequently unable to resuscitate her, and it is currently believed she suffered a heart attack and passed away in her sleep. After many attempts to reach her (we texted daily), her brother called me this afternoon with the news. I knew you would want to know as well.

I am going to tease this apart very gently, so that you can see all the possibilities that we’re actually dealing with.

Point 1 – “Shedding”

Now, if you were following along with DePat’s posts in recent weeks, then you realize that she was very convinced that she had been subject to shedding of [COVID-19 vaccine-created] spike protein.

The first problem there, is that very near the end, DePat realized that the vaccine-originated shedding would more likely have been the spike mRNA, not the spike protein.

Here is her comment, which was in fact her third-to-last, made on January 17, 2025.

https://www.midwesterndoctor.com/p/covid-19-vaccine-shedding-experiences “What We’ve Learned from Over a Thousand Vaccine Shedding Reports”, by A Midwestern Doctor, 7 January 2024 (detailing the phenomenon of COVID-19 “vaccine” shedding, and how such shedding affects people);

This one is particularly scary as it claims the shedding is due to mRNA and not the spike protein. Drat.

Does anyone have further evidence on this or a rebuttal? I always thought it was just the spike protein. So far, no heart issues or unexplained pain, true brain fog (I’m sleepy today as the insomnia is FINALLY subsiding. I slept a LOT in the last 24 hours.), or any of the other hard core stuff. A LOT of stiffness keeping warm, and the return of some relatively normal complaints for me in winter.

Fortunately, we haven’t given away the bulk of my mother’s tools she used for the last so many years of her life after the hip replacement, and subsequent ailments. They’ve come in handy. I have another friend who is helping me out in a lot of ways. The next week will be a challenge temperature wise and then I can at least sit in the front door and soak up radiant heat as the sun comes out. Less than a half hour is recommended.

I’ve decided to use this experience as part of writing about an elderly or disabled person. There’s too much challenge at this point to really articulate it, but this is for the birds even if the worst of it is fatigue.

And, yes, stay away from crowds and people you know who get boosters.

So – let me just spell this out. DePat realized that vaccine shedding could be the spike protein, but that it’s more likely (and more dangerously) to be the spike protein mRNA enclosed in lipid nanoparticles that can get into cells. It is by this mechanism that much more spike protein could be created in the body of the shedding recipient.

Not a pleasant thought.

Now – just a side note. DePat and I had discussed all this, many times, WAY BACK in late spring of 2021, so she knew this stuff years ago. Thus, I really believe that she had some brain fog recently. And we know from her comments – DePat understood that she had brain fog, too, despite the fact that it was interfering with her memory.

Years ago, she and I had speculated on the shedding of spike protein, to explain things which were being observed in people close to vaccine recipients. Unlike DePat, I was not a believer in “shedding”, but when Naomi Wolf started reporting observations consistent with some kind of shedding phenomenon, I came up with a scientifically solid explanation of how shed spike protein could actually cause such symptoms, if the spike protein had highly potent, oxytoxin-like pharmacological activities.

Is The Abortion Vaccine Right For You?

The idea of spike protein shedding seemed plausible AS IS, but when Pfizer’s own data, released to vaccine skeptics by the Japanese government, showed the vaccine itself persisting and migrating in test animals, it became clear that shedding of the VACCINE would be an even better explanation.

Which I posted about.

The Spike Protein’s Purpose Betrayed By Its Own Superiority

The point about snake venoms and spike protein is an ANALOGY – it’s not direct – but it’s very useful in understanding both potencies and pharmacological and pathological actions.

I want people to understand this. EVEN if it was just the spike protein being shed, if that protein is even slightly like snake venom in pathogenicity, then it behooves us to look at how snake venoms are dealt with in real life.

Specifically, when cages of venomous snakes are being cleaned, those present have to actually wear respirators. Not just masks – respirators. That is because the dust from dried snake venom in venomous snake cages can literally cause dangerous symptoms in people cleaning the cages.

SO – I want people to understand that DePat had a good theory here – namely, the theory that she got many lung-fulls of either spike protein, or (more dangerously) vaccine nanoparticles, from that vaccine-injected choirmate of hers.

According to this theory, not only did the “shed” vaccine cause typical vaccine-related symptoms – it potentially caused myocarditis, aortal embolism, blood clots, or any one of the many serious cardiovascular events that the vaccines are capable of causing.

This is actually a really reasonable theory.

However, it’s not the only one.

Point 2 – Nicotine

DePat’s last post indicates that she was continuing to use nicotine patches as an off-label way to “inhibit spike protein”. Here is that post.

I’m trying, be sure of that.

Others in my family aren’t. They think this will all go away just with ivermectin. I’m not done with the nicotine protocol yet.

OK – so what is this “nicotine protocol”?

The TL;DR is that one of the alternative medical treatments for “spike protein” / “long COVID” – and particularly “brain fog” – is medicinal nicotine, either as chewing gum, patches, or sublingual.

But before I get into this treatment, it’s helpful to see when and where DePat began investigating nicotine as a solution to her ailment. The entire conversation is very instructive, and begins here, where DePat began asking all of us for suggestions about treatment of her condition.

LINK: https://www.theqtree.com/2024/12/16/dear-kmag-20241216-trump-won-three-times-%e2%9d%80-open-topic/#comment-1383333

Okay, I need to pick a few brains.

After talking over symptoms with a friend who is in the same boat as many of us are with the COVID shots – she didn’t take them, but her husband did and she’s now suffering with the side effects despite all sorts of alternative treatment – I think whatever this is that I have is related to a choir member getting a booster last month and exposing me. The fatigue symptoms pretty much match what she had. Just unloading and loading the dishwasher is a challenge. Forget actual housework which desperately needs to be done. (When the kids get here on Saturday, I’m using them to deck the halls.) This crap is for real.

Other than making a run for Tennessee, which really isn’t that bad of a drive from here, for Ivermectin, any ideas? My friend ordered me a nebulizer and is willing to help me use it to break up biofilm, etc., but is there anything in anyone’s arsenal of natural remedies that may help? I had a talk with our Lord and Savior at Eucharistic Adoration today, and I’m hoping my Novena for wellness is doing some good, but, really, I have a lot to do and no energy to do it. Just about every old injury has flared up – especially in my torso which are pretty much all from singing – and some other things.

I just want and need this to go away.

Any ideas?

Thanks.

P.S. please pray for a cousin, A, and her husband, K, who are suddenly expecting identical twins over the summer. it’s a CLASSIC case of you make plans, God laughs. They are in their late thirties, and their toddler was born via c-section due to pre-eclampsia. Fortunately, her OB services are through a Vanderbilt extension, so we’re all hoping for the best.

P.P.S. Next week, we are going to have a house full of people, so the posts will be placeholders of a sort. I’m going to resurrect an old one and draft something new for the day after Christmas. Just a head’s up.

Now, at that time, all of us came in with a wide variety of suggestions, but one late response came from a hitherto lurking account, I Hate Acronyms, now registered as Sigma.

Very long time lurker here from the great Q purge OT. Please consider nicotine patches. The highest strength, cut into fourths. Apply one of the fourths to your skin, replacing with a fresh one daily. Do a search on Rumble for “nicotine and spike proteins”. “Nicotine vs nanotech”
If they are going to work, you should see results within days, if not hours. Non-addictive.

As I felt this was earnest and helpful advice, and that the nicotine method had solid science behind it, I approved the comment immediately, hoping it might help DePat.

I am sure that DePat thoroughly investigated this, and found all the same information that I did. If you dig deep enough and far enough on this, you will find all of the following.

  • there are valid scientific reasons to think nicotine might work as a treatment for “long COVID” / “long vax” / “spike protein”
  • there is a wide range of voices supporting treatment with nicotine
  • those voices include more “controversial” ones like Dr. Bryan Ardis and Dr. Tau Braun
  • they also include more widely respected ones like Dr. Peter McCullough
  • there are also discrediting connections to “nanomachines” and the like, which I ignore
  • for some people with long COVID, nicotine has helped when nothing else has worked

I advise just doing the recommended Rumble searches, to learn more.

For example, this video shows a variety of scientific papers which not only explain why nicotine affects spike protein-based symptoms, but also show demonstrated clinical benefit in actual patients.

LINK: https://rumble.com/v5wubbq-nicotine-protects-you-from-shedding.html

But now addressing a bigger question.

I do NOT suspect that nicotine poisoning was involved in DePat’s death. Toxic levels of nicotine result in very obvious symptoms (nausea, vomiting, tremors, vertigo, flushing, palpitations, etc.) that quickly make people back off on whatever means by which they were ingesting nicotine. I know, because the first cigar I ever smoked sent me into nicotine poisoning. People learn very quickly how to dose nicotine correctly.

DePat was actually getting some positive results with this method. More specifically, it was making her feel better. I personally think her efforts would have been more successful under a doctor’s supervision (preferably one connected to FLCCC or the like), but when I suggested “doctors and tests” to DePat, she was not a fan.

LINK: https://www.theqtree.com/2025/01/14/dear-kag-20250114-open-thread/#comment-1395665

DEPAT: I’m wondering if some of this fatigue is coming from trying to stay warm in a drafty house.

Hmmm….

ME: That sounds very likely to me.

Your body basically sends your periphery into overdrive to stay warm. Long johns / thick leggings and a sweater indoors can be very helpful. Feeling warm indoors can stabilize you.

Also wondering if your doctor is running a yearly thyroid check (TSH) If the numbers are odd or marginal, you may have something going on there.

DEPAT: Doctor? I learned my lesson with conventional medicine a long time ago.

It just seems the bad days are colder.

LINK: https://www.theqtree.com/2024/12/16/dear-kmag-20241216-trump-won-three-times-%e2%9d%80-open-topic/#comment-1383534

ME: Sounds a lot like COVID. Have you tested yourself at any point?

DEPAT: No. But I was exposed to two people who had their boosters over a month ago. The coughing fits started on the 17th last month. True weakness and needing to sit down for tasks the three days before Thanksgiving. I think I’m just about at the end.

In my opinion, DePat really needed a complete physical checkup, if only because it might have picked up any underlying conditions. But even more than that, there was a need for better diagnosis of what was ailing her. Simply assuming that it was vaccine shedding was risky, IMO.

Point 3 – COVID-19

Notice that I had asked DePat about COVID. The symptoms of being a “shedding recipient” should be almost the same as “long vax” – which should be very similar to the disease itself. Even more to the point, it is extremely easy to pick up COVID in a place like a choir. In fact, it only takes a much smaller dose of an infectious organism, than it does of a “shed vaccine”, to cause the exact same kind of problems that DePat was having.

DePat seemed very resistant to the idea that she might have had COVID or a similar ILI (influenza-like illness). However, to rule out an actual disease takes some effort. And to PREVENT disease takes even more.

Was she taking her temperature daily or twice daily? As far as I know, NO.
Was she taking ivermectin AT ALL, much less regularly? NO.
Was she taking vitamin D? Had she ever tested her levels of vitamin D? NO.
Was she taking enough zinc? I don’t think she was taking ANY zinc.

DePat’s situation was a lot like Wheatie’s. She KNEW – more or less – what sorts of things might be useful if she ever got COVID, but she had NOT prepared by having those things purchased, fully understood, and on hand, ready for trouble. Even more, she was not ready to DIAGNOSE COVID.

I KNOW that I have had COVID three times, because I’ve done the testing and clinical work to make absolutely firm diagnosis. I know that what I have right now is most certainly influenza, and NOT COVID.

And that brings me to my next point.

Point 4 – Influenza

I think it is VERY likely that DePat had the very nasty influenza that is going around right now, which singingsoul1 suffered from greatly, at almost the same time as DePat, and which I am suffering from at this very moment. As is my wife – so I am studying TWO cases, almost identical.

  • “feel bad”
  • aches and pains
  • persistent cough
  • no appetite
  • insomnia
  • chills
  • fatigue
  • sense of smell OK
  • stuffy sinuses and phlegm – mostly upper respiratory
  • “forget doing housework”
  • need a nebulizer (I use saline spray, myself)

Everything DePat was saying about what she was suffering, sounds like what I’m suffering right now. And, in fact, what MANY people are suffering right now.

And here’s the kicker. Influenza is a PRIME candidate for setting up a heart attack afterwards.

https://health.clevelandclinic.org/can-the-flu-trigger-a-heart-attack

I know that many of you (like me) might suspect that this angle is pure post-clot-shot “explain away the vaccine heart attacks” bullshit, BUT the fact is, influenza has ALWAYS been notorious for killing old people, and heart attacks is one of the ways that it does it. Viral diseases – colds and flu – are also notorious as initiators of pericarditis and myocarditis. They didn’t have to make this shit up, to use it to deflect from their horrible vaccines.

As I love to say, there’s no cover like the truth.

Now – one might think DePat would have known if she had the flu, but this thing my wife and I have, has proven to be surprisingly low-fever – especially for my wife. Even after the fever has subsided, we still feel very ill. Were I not monitoring our temperatures every day, getting actual numbers, and signal over noise, it would have been easy to dismiss this thing as something other than influenza.

At numerous times during the last week, I have thought that maybe this was something other than influenza. But the reality keeps coming back, as I read more and more solid information about influenza and its treatment. What I have – what my wife has – what singingsoul had – and what DePat likely had – was a long, slow case of influenza, with a long recovery time.

Bear in mind that viral diseases often leave patients stuffy and suffering many symptoms for 60 days (2 months), long after the virus is gone. That fits perfectly with the timescale that DePat reported.

I think it is very critical to make a correct diagnosis, and to beware of reflexive “it’s the vaccine” thinking, when DISEASE never went away as a significant threat. Maybe even a MORE significant threat.

It’s entirely possible that DePat was exposed to “shed vaccine” – but I would argue that it’s more possible she was exposed to a nasty flu, didn’t have the right tools to diagnose or treat it, and damage by this flu ultimately led to a heart attack or stroke.

Either way, I now urge everybody – investigate treatments ahead of time. Don’t wait for being sick, because you won’t make it to the store – you won’t make that long trip to Tennessee – you won’t figure out which drug, where to get it, and how to take it.

Do all that ahead of time, if you want to live.

With that, I invite people to give me THEIR opinions. Feel free to disagree with me! After all, we have free speech back. THANK GOD!!!

Finally, this. Say a prayer for DePat and her family – grieve as you need, and you WILL need – but trust that God knows what God is doing, and seek comfort in that knowledge.

Trust in God. He is with us, and DePat is with Him.

All the best,

W

Pfizer and Moderna Vaccines Both Contain the PRRARSV Key to the Cell Nucleus

TL;DR-

The bottom line is that I have simply checked the gene sequences of the Pfizer and Moderna vaccines, and verified that they BOTH contain nucleic acid code that translates to the shorter PRRARSV protein code, which is a kind of “hall pass” into the cell nucleus.

Thus, BOTH of these vaccines produce a spike protein which science would predict has the same ability as the virus spike protein, to (1) get into the cell nucleus, and furthermore (2) schlep its own mRNA along with it into the cell nucleus, and finally (3) as proven by experiment on the Pfizer vaccine, integrate the spike protein gene sequence into the human cellular genome.

That’s it. If you want all the gory details, stay tuned. Otherwise, that’s the BLUF (bottom line up front). Have a great day! -Wolf

Introduction

OK – I have an important update to the whole topic of mRNA vaccines messing with people’s genes, and in particular, with a part of the COVID-19 spike protein mRNA sequence called the PRRARSV nuclear translocation signal. This “key” within the whole sequence is like an ID card for the cell nucleus. It was identified in the natural COVID-19 spike protein, and now it appears to remain in both the Pfizer and Moderna vaccines.

I have posted on this topic – the PRRARSV Nuclear Translocation Signal – THREE times before.

First, I posted when I discovered the Mehedi paper, and realized how important it is.

The Mehedi paper explains WHY there is genomic incorporation of the COVID-19 spike protein – specifically, because the spike protein has what is essentially a key to the cell nucleus.

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you. TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic …

The next time I posted, was the moment that I realized that the murdered American scientist Bing Liu had been directing his research focus to the EXACT SAME SPOT in the SARS-CoV-2 gene sequence – the PRRARSV sequence – when he was conveniently murdered by a crazed acquaintance who was apparently contending with him over a lover.

To me, this murder absolutely REEKED of MKULTRA. Bing Liu had a plausible weakness and it was exploited. Not all people realize how dangerous the science world can be. Not so this cowboy – I’ve been through a lot of weird, evil bullshit in Scienceville, over the years.

Bing apparently recognized that this sequence is found in snake venoms and other, more deadly viruses, and was thus potentially close to realizing that this part of the sequence was behind certain aspects of the pathogenicity of SARS-CoV-2, as well as those other things.

Stated another way – maybe nuclear translocation is WHY those other things are so bad.

Dear KMAG: 20230130 Joe Biden Didn’t Win ❀ Open Topic / Bing Liu Murder Potentially Linked to PRRARSV Nuclear Translocation Signal in Spike Protein of COVID Vaccines

Joe Biden didn’t win. This is our Real President: AND our beautiful REALFLOTUS. This Stormwatch Monday Open Thread remains open – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA/KAG/KMAG world (with KMAG being a bit of both). …

Finally, at a certain point I realized that any “accidental” explanation of the presence of a working translocation signal which not only violates the central promise of mRNA vaccine technology, but installs the violation itself in the nucleus, was simply too incongruous to be an accident. It’s a BLOODY HACK. There was no way that – on the very first roll-out of a genetic vaccine – the technology which was PRIZED for making the technology safe against genetic incorporation, instead caused genetic incorporation OF the very instructions for genetic incorporation.

I mean, think about it. What are the chances? It’s almost as crazy as the sinking of the “unsinkable” Titanic.

You see what I’m sayin’? This outrageously excellent attack simply cannot be a case of “whoops”. The TRICK is not the “AW SHUCKS, THAT’S LIFE” which sells as stage two to the hubris of the chumps. That’s just the getaway. The TRICK is the LIE – the PROMISE that is actively worked against from the very beginning, and intentionally not delivered.

Hanlon’s Razor, go to hell!

mRNA Vaccines that Breach the Nucleus and Change the Genome – What are the Chances?

Ask yourself a simple question. Why should the very first examples of mRNA vaccines for humans violate the most important safety standard of the mRNA platform? Why would the vaccines do exactly what they PROMISED US the vaccines would not do? TL;DR – They didn’t just lie to us about the spike mRNA not going …

I wrote that last post with a certain sense of frustration. NOBODY in COVID Dissident World seemed to understand the importance of this whole “nuclear translocation signal” thing. Either that, or they were utterly afraid to speak of it. Indeed, our RDS is one of the few people who has dared to shine a light on the topic.

I set it aside for a while and basically gave up.

The other side did not give up. During that time, I was seriously shadow-banned on Twitter. Elon’s FEDS are busy little beavers, damming up the truth.

But now, something interesting has happened. On Twitter.

A Tale of Two Acronyms: PRRARSV and SV40

RDS posted a comment that included a tweet of a translated video of the brave Japanese professor who publicly challenged the Japanese Ministry of Health over the crappy vaccines.

Here, Murakami is discussing contaminating plasmid DNA (little circles of DNA) which were found in very significant quantity in expired vials of the Pfizer vaccine. It’s easier to watch the video on Twitter.

This SV40 stuff also gets into a shocker about nuclear incorporation, but this is not the same shocker as the PRRARSV stuff. This is ANOTHER ANGLE on a different path into the nucleus.

Are you starting to believe me now about intent? Read on.

The translation is as follows. It is a conversation between Professor Murakami (M) and another person (P). I may have gotten a couple of assignments mixed up, when both are talking, but have done my best to attribute statements properly, based on what I can discern.

Commentary by Professor Murakami

(M) It is now possible to read the DNA sequences present in the vaccines. This is the DNA read from the Moderna vaccine.

(P) It may be difficult for the general public to understand, but this sequence is in the form of a ring. Plasmid DNA is in the form of a ring, and the DNA sequence is described in this ring. Spike proteins are encoded in this part of the DNA sequence.

(M) This part of the DNA sequence shows the spike gene. The Moderna’s vaccine has a vector sequence that is often present in Escherichia coli. However, the Pfizer’s vaccine has a staggering problem. I have made an amazing finding. This figure is an enlarged view of Pfizer’s vaccine sequence. As you can see, the Pfizer’s vaccine sequence contains part of the SV40 sequence here. This sequence is known as a promoter. Roughly speaking, the promoter causes increased expression of the gene. The promoter is a sequence that is essential for gene expression. The problem is that the sequence is present in a well-known carcinogenic virus. The question is why such a sequence that is derived from such a cancer virus is present in the Pfizer’s. There should be absolutely no need for such a carcinogenic virus sequence in the vaccine. This sequence is totally unnecessary for producing the mRNA vaccine. It is a problem that such a sequence is solidly contained in the vaccine. This is not the only problem. If a sequence this is present in the DNA, the DNA is easily migrated to the nucleus. So it means that the DNA can easily enter the genome. The problem is that if such a sequence remains intact, the DNA is easily migrated to the nucleus. It means that the DNA can easily enter the nucleus. These are such alarming problems.

(P) Does it mean that the SV40 promoter also contains sequences that can be migrated to the nucleus?

(M) Yes, that’s what I mean.

(P) So you are saying that the DNA can go to the nucleus easily?

(M) It means that the DNA contains sequences that can easily go to the nucleus. This is a well-known fact. This fact has already been documented in a number of scientific literature. It is essential to remove such sequences. The sequences have to be removed. However, Pfizer produced the vaccines without removing the sequences.

(P) This is outrageously malicious.

(M) That’s right. Pfizer retained the SV40 promoter sequence which is completely unrelated to the in vitro synthesis of the messenger.

(P) This issue should be questioned. Why such a promoter sequence is present in the DNA? This kind of promoter sequence is completely unnecessary for the production of the mRNA vaccine. In fact, SV40 is a promoter of cancer viruses.

(M) Yes, SV40 is well known.

(P) The sequence that promotes the cancer virus is present in the DNA for some reasons. As we know, we use this SV40 promoter sequence in various experiments. However, the question is why the promoter sequence is present in this mRNA vaccine.

Do YOU have some questions at this point? I sure as hell do. And the presence of multiple PHARMA TROLLS on Twitter, muddying the water with disingenuous excuses and throw-away coddles, makes things look even more suspicious.

RDS and I discussed this at some length in Saturday’s open. I urge interested readers to follow the above link, repeated here, to see our talk about this video, but it is not necessary for the following discussion.

I then proceeded to Twitter, and got caught up in a variety of arguments between the awesome Jikkyleaks and various “defenders of the narrative”, to put it kindly.

Many of these people (I will avoid calling them “pharma trolls”) shoot from the hip, and – despite sometimes being what should be experts in their fields, seem to have no grasp of basic logic applied to basic principles of biology. They are perfect, however, for defending scientific orthodoxy in a somewhat religious manner.

Meanwhile, sharper people in biotech who understand the basic WTF (like the presence of extraneous DNA in an RNA vaccine being an actual problem) are literally running toward the enemy with the downfall of the original vaccine sales narrative.

I should add, at this point, that SOMEBODY at Twitter is desperately covering all of this up. Twitter uses a stealthy way of “downgrading replies” to hide really important pharma stuff, without overtly banning content. It’s rather ingenious, but it’s VERY frustrating.

First of all, these Twitter IC people are fooling the hell out of Elon Musk – or maybe they aren’t. Either way, some of the most important biology about the vaccines is being hidden, and IMO it sucks big-time.

Thus, it was nearly impossible for me to find the following conversation again. Twitter had hidden my comments so effectively, that I myself could not find them in my own timelines of Tweets and Replies. But with persistence, I did find them.

This conversation and the interspersed commentary explains the how and why of my verifying that the nuclear translocation signal IS in fact in the two main mRNA vaccines – and in my opinion, intentionally so.

Enjoy.

We begin with a Pharm Boy attacking Murakami’s analysis.

You can smell what is up right away. Taylor had been responded to by one of the more active science fighters, Kevin McKernan.

The linked paper is HERE:

LINK: https://pubmed.ncbi.nlm.nih.gov/16010286/

The cited part of the abstract is here:

The abstract, with the relevant text in BOLD, is here:

ABSTRACT

One of the steps that limit transfection efficiency in non-viral gene delivery is inefficient nuclear import of plasmid DNA, once it has been delivered into the cytoplasm. Recently, via microinjection into the cytoplasm and in situ hybridizations into a few cell types, it was shown that a region of Simian virus 40(SV40), specifically a c. 372-bp fragment of SV40 genomic DNA encompassing the SV40 promoter-enhancer-origin of replication (SV40 DTS), could enable the nuclear import of a plasmid carrying these sequences (Dean D.A. Exp. Cell Res. 230 (1997) 293). In this report, we address the issue of the suitability of the SV40 DTS for cationic lipid-mediated gene delivery, and its capacity to improve the efficiency of the transfection process. For this study, we used transient reporter gene expression assays on various cell types. The gene expression from the plasmid constructs carrying the SV40 DTS varied with cell type and plasmid construct used. Such cell-type and plasmid-construct dependency on gene expression from plasmids containing the SV40 DTS suggests that the gene expression from plasmids is not entirely dependent on its ability to enhance the nuclear import of said plasmids.

The smarmy Taylor responds to this, as follows.

McKernan does not respond to this, and I don’t know whether Taylor’s point is valid, but assuming that it is correct, the point stands – is the fragment included sufficient to enable nuclear translocation?

This is where I decided to “inject” the fact that there already IS a nuclear translocation signal present (in the lipid nanoparticle) in the spike protein mRNA, so that RNA may be covering for DNA transport as well. But I wanted to make sure that McKernan saw it – I don’t particularly care about Taylor. So I answered directly to McKernan, on the same tweet that Taylor used. I included a link to the Mehedi paper, which is sorely under-exposed.

I figured that Taylor would respond, and he/she/it did immediately.

[SIDEBAR – I would not be surprised if Twitter insiders are helping these pharma bots by – e.g. – making sure that Taylor Ray and fellow “influencers” can see my input, but that my fellow free scientists, including Kevin McKernan, cannot.]

Taylor’s comment, beginning with “this paper is about something else”, betrays a kind of battered science syndrome that keeps science exactly where the Cabal wants it – defending its own orthodoxy – never questioning by looking off the plantation. It is based on exactly the kind of authority-and-orthodoxy-defending, “teacher’s pet” science that I detest.

Yes, there is a very legitimate question about “virus versus vaccine” – that a VIRUS result is not exactly the same as a VACCINE result. However, if you’re looking at the same or similar things happening for both, and one has a shared culprit, what does logic say?

The entire vaccine paradigm is built on the idea of virus-vaccine symmetry, so if you’re not looking honestly at “virus predicts vaccine” as your FIRST STEP of analysis, you’re never going to predict anything.

Which, by the way, is exactly what the Cabal wants.

This is a perfect example of “unethical skepticism”, as The Ethical Skeptic teaches us.

Taylor at least has the decency of adding a weak and wobbly excuse for a difference – “whose binding site is inactivated”.

This is chaff and countermeasures, as Sundance likes to say. See if you can put that together from my measured, friendly response.

What I’m saying here implies that the “inactivated binding site” in the vaccine (which itself implies possible changes in the total sequence) does not necessarily affect the presence of a nuclear translocation signal (NTS). These are two different features in the protein. Bringing that up is CHAFF.

Notice that I am not backing down on the idea that data from the virus can and likely is predictive of the vaccines. I am just waiting for Taylor to assert openly that they are not.

Taylor, instead of challenging me, tries a very sneaky deflection.

This gets into bioinformatics. BLAST is a search engine of gene and protein sequences, which allows people to quickly find matching sequences – OR TO MISS THEM.

For sensitive operations, I simply don’t trust BLAST. It’s like Google. It’s a great place to look if you’re willing to throw your cares onto somebody else’s software, but it’s easy to miss things.

The SNEAKY move by Taylor is to MISLEAD me away from PRRARSV into a BAD SEARCH. The suggestion is to use an overly broad search of only 4 amino acids (682-683-684-685). Sorry, Charlie. No dice. I am interested in exactly what I said – PRRARSV – seven amino acids.

Instead, I decided to look for the sequences of the vaccines, and then use simple tools to check for the presence of the PRRARSV signal in them.

To begin with, note that there are TWO kinds of sequences I can potentially get for the vaccines.

  • the actual sequences, obtained by analyzing the vaccines
  • the “official” sequences, released by Pfizer and Moderna, the FDA, or somebody else

I tried to get official versions, but simply could not find them. So I found a link in the broader discussion of the results which Murakami was looking at.

The actual sequences are mentioned HERE:

LINK: https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

From there, I went to this link on GitHub, which contains IMAGES (not text) of the vaccine sequences.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

Here is the Pfizer vaccine sequence, as an image:

The first thing you will note is that this is not likely to contain PRRARSV in it, because it’s all G, T, C, and A, like GATTACA.

This code needs to be translated from DNA/RNA to AMINO ACID, and for that, I need TEXT – not an image. So I looked for a different GitHub upload of the data, with text instead of images, and I found one.

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273

This web page includes a link to the actual sequence data, as a “FASTA” file:

LINK: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta

The sequence data is here:

Figure1_032321_Spike-encoding_contig_assembled_from_BioNTech/Pfizer_BNT-162b2_vaccine
GAGAATAAACTAGTATTCTTCTGGTCCCCACAGACTCAGAGAGAACCCGCCACCATGTTCGTGTTCCTGGTGCTGCTGCC
TCTGGTGTCCAGCCAGTGTGTGAACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCG
TGTACTACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCCTGCCTTTCTTCAGCAACGTG
ACCTGGTTCCACGCCATCCACGTGTCCGGCACCAATGGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGG
GGTGTACTTTGCCAGCACCGAGAAGTCCAACATCATCAGAGGCTGGATCTTCGGCACCACACTGGACAGCAAGACCCAGA
GCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAAGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGC
GTCTACTACCACAAGAACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTTCGA
GTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGCAACTTCAAGAACCTGCGCGAGTTCGTGTTTAAGA
ACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCTGCT
CTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCT
GACACCTGGCGATAGCAGCAGCGGATGGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCC
TGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGATCCTCTGAGCGAGACAAAGTGCACC
CTGAAGTCCTTCACCGTGGAAAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTT
CCCCAATATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTGTGTACGCCTGGAACCGGA
AGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCTGTACAACTCCGCCAGCTTCAGCACCTTCAAGTGCTACGGCGTG
TCCCCTACCAAGCTGAACGACCTGTGCTTCACAAACGTGTACGCCGACAGCTTCGTGATCCGGGGAGATGAAGTGCGGCA
GATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGTGTGATTGCCT
GGAACAGCAACAACCTGGACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCAATCTGAAG
CCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAACGGCGTGGAAGGCTTCAACTGCTA
CTTCCCACTGCAGTCCTACGGCTTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCTTCG
AACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCTCGTGAAGAACAAATGCGTGAACTTCAAC
TTCAACGGCCTGACCGGCACCGGCGTGCTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATAT
CGCCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCACCCCTTGCAGCTTCGGCGGAGTGT
CTGTGATCACCCCTGGCACCAACACCAGCAATCAGGTGGCAGTGCTGTACCAGGACGTGAACTGTACCGAAGTGCCCGTG
GCCATTCACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTTTCAGACCAGAGCCGGCTG
TCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAGTGCGACATCCCCATCGGCGCTGGAATCTGCGCCAGCTACCAGA
CACAGACAAACAGCCCTCGGAGAGCCAGAAGCGTGGCCAGCCAGAGCATCATTGCCTACACAATGTCTCTGGGCGCCGAG
AACAGCGTGGCCTACTCCAACAACTCTATCGCTATCCCCACCAACTTCACCATCAGCGTGACCACAGAGATCCTGCCTGT
GTCCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGATTCCACCGAGTGCTCCAACCTGCTGCTGCAGT
ACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCCGTGGAACAGGACAAGAACACCCAAGAGGTGTTC
GCCCAAGTGAAGCAGATCTACAAGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGATCC
TAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGACACTGGCCGACGCCGGCTTCATCAAGC
AGTATGGCGATTGTCTGGGCGACATTGCCGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCT
CCTCTGCTGACCGATGAGATGATCGCCCAGTACACATCTGCCCTGCTGGCCGGCACAATCACAAGCGGCTGGACATTTGG
AGCAGGCGCCGCTCTGCAGATCCCCTTTGCTATGCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGC
TGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACAGCA
AGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGAATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAA
CTTCGGCGCCATCAGCTCTGTGCTGAACGATATCCTGAGCAGACTGGACCCTCCTGAGGCCGAGGTGCAGATCGACAGAC
TGATCACAGGCAGACTGCAGAGCCTCCAGACATACGTGACCCAGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCC
AATCTGGCCGCCACCAAGATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGGCTACCACCT
GATGAGCTTCCCTCAGTCTGCCCCTCACGGCGTGGTGTTTCTGCACGTGACATATGTGCCCGCTCAAGAGAAGAATTTCA
CCACCGCTCCAGCCATCTGCCACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCATTGG
TTCGTGACACAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGTCTGGCAACTGCGACGTCGT
GATCGGCATTGTGAACAATACCGTGTACGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGACAAGTACT
TTAAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCAGCGTCGTGAACATCCAGAAAGAG
ATCGACCGGCTGAACGAGGTGGCCAAGAATCTGAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTA
CATCAAGTGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGGTCACAATCATGCTGTGTT
GCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGTAGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAG
CCCGTGCTGAAGGGCGTGAAACTGCACTACACATGATGACTCGAGCTGGTACTGCATGCACGCAATGCTAGCTGCCCCTT
TCCCGTCCTGGGTACCCCGAGTCTCCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCT
CTGCTAGTTCCAGACACCTCCCAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAACAG
CAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGGGTTGGTCAATTTCGTGCCAGCCAC
ACCCTGGAGCTAGCA

Figure_2_32321_Spike-encoding_contig_assembled_from_Moderna_mRNA-1273_vaccine
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACCATGTTCGTGTTCCTGGTGCTGCT
GCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACCCGGACCCAGCTGCCACCAGCCTACACCAACAGCTTCACCCGGG
GCGTCTACTACCCCGACAAGGTGTTCCGGAGCAGCGTCCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGCAAC
GTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGCGGTTCGACAACCCCGTGCTGCCCTTCAACGA
CGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATCATCCGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCC
AGAGCCTGCTGATCGTGAATAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTG
GGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTGCACCTT
CGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAGGGCAAGCAGGGCAACTTCAAGAACCTGCGGGAGTTCGTGTTCA
AGAACATCGACGGCTACTTCAAGATCTACAGCAAGCACACCCCAATCAACCTGGTGCGGGATCTGCCCCAGGGCTTCTCA
GCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCCGGTTCCAGACCCTGCTGGCCCTGCACCGGAGCTA
CCTGACCCCAGGCGACAGCAGCAGCGGGTGGACAGCAGGCGCGGCTGCTTACTACGTGGGCTACCTGCAGCCCCGGACCT
TCCTGCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCTCTGAGCGAGACCAAGTGC
ACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAGAGCATCGTGCG
GTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAGGTGTTCAACGCCACCCGGTTCGCCAGCGTGTACGCCTGGAACC
GGAAGCGGATCAGCAACTGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTACGGC
GTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTCGTGATCCGTGGCGACGAGGTGCG
GCAGATCGCACCCGGCCAGACAGGCAAGATCGCCGACTACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCG
CCTGGAACAGCAACAACCTCGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACCGGCTGTTCCGGAAGAGCAACCTG
AAGCCCTTCGAGCGGGACATCAGCACCGAGATCTACCAAGCCGGCTCCACCCCTTGCAACGGCGTGGAGGGCTTCAACTG
CTACTTCCCTCTGCAGAGCTACGGCTTCCAGCCCACCAACGGCGTGGGCTACCAGCCCTACCGGGTGGTGGTGCTGAGCT
TCGAGCTGCTGCACGCCCCAGCCACCGTGTGTGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAACTTC
AACTTCAACGGCCTTACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAATTCCTGCCCTTTCAGCAGTTCGGCCGGGA
CATCGCCGACACCACCGACGCTGTGCGGGATCCCCAGACCCTGGAGATCCTGGACATCACCCCTTGCAGCTTCGGCGGCG
TGAGCGTGATCACCCCAGGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTGCCC
GTGGCCATCCACGCCGACCAGCTGACACCCACCTGGCGGGTCTACAGCACCGGCAGCAACGTGTTCCAGACCCGGGCCGG
TTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTACGAGTGCGACATCCCCATCGGCGCCGGCATCTGTGCCAGCTACC
AGACCCAGACCAATTCACCCCGGAGGGCAAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGCGCC
GAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATCAGCGTGACCACCGAGATTCTGCC
CGTGAGCATGACCAAGACCAGCGTGGACTGCACCATGTACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGC
AGTACGGCAGCTTCTGCACCCAGCTGAACCGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAGGTG
TTCGCCCAGGTGAAGCAGATCTACAAGACCCCTCCCATCAAGGACTTCGGCGGCTTCAACTTCAGCCAGATCCTGCCCGA
CCCCAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAGGTGACCCTAGCCGACGCCGGCTTCATCA
AGCAGTACGGCGACTGCCTCGGCGACATAGCCGCCCGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTGCTG
CCTCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGTTAGCCGGAACCATCACCAGCGGCTGGACTTT
CGGCGCTGGAGCCGCTCTGCAGATCCCCTTCGCCATGCAGATGGCCTACCGGTTCAACGGCATCGGCGTGACCCAGAACG
TGCTGTACGAGAACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGCACC
GCTAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAACACCCTGGTGAAGCAGCTGAGCAG
CAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATCCTGAGCCGGCTGGACCCTCCCGAGGCCGAGGTGCAGATCGACC
GGCTGATCACTGGCCGGCTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCCGGGCCGCCGAGATTCGGGCCAGC
GCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGCGGGTGGACTTCTGCGGCAAGGGCTACCA
CCTGATGAGCTTTCCCCAGAGCGCACCCCACGGAGTGGTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACT
TCACCACCGCCCCAGCCATCTGCCACGACGGCAAGGCCCACTTTCCCCGGGAGGGCGTGTTCGTGAGCAACGGCACCCAC
TGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACCTTCGTGAGCGGCAACTGCGACGT
GGTGATCGGCATCGTGAACAACACCGTGTACGATCCCCTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGT
ACTTCAAGAATCACACCAGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAGAAG
GAGATCGATCGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTACGAGCA
GTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGT
GCTGCATGACCAGCTGCTGCAGCTGCCTGAAGGGCTGTTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGACAGC
GAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACCTGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTG
GGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCAAAAA
AAAA

From there, I merely needed a translator, which is a relatively simple tool, and which can be found on the web, such as here:

LINK: https://web.expasy.org/translate/

Plugging in the sequences from the paper on GitHub, it’s straightforward. Here are the two vaccines, translated to amino acids, as both images and text.

Pfizer:

ENKLVFFWSPQTQREPATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT–LELVLHARNASCPFPVLGTPSLPRPRVPGMLPPPPAPLTTSASSRHLPSTQQCSSKRLA-PHPHGKQQ-LTFSNKRKFN-AILTPGLVNFVPATPWS-

Moderna

GK-ERKEE-EEI-DPGAATMFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT—AGASVA-LLAPWASPQPLLPFLHPYPRGL-IKSEWAAKK

In each vaccine, there is one and only one instance of the full PRRARSV nuclear translocation signal mentioned by Mehedi, which I have marked in BOLD.

So what does all this mean?

This means that there is no question – the same nuclear translocation signal which gets natural spike protein into the cell nucleus, and natural spike protein messenger RNA into the nucleus, BOTH as demonstrated by Mehedi, is in the vaccine spike proteins.

Do I have to spell it out any more than that? Are the members of the Pfizer Defense Legion so incurious as to what this might mean, that they have to fight the obvious truth every step of the way?

Watch what happens next.

Taylor’s response was interesting, and I didn’t expect it.

This response actually set me up to explain why the binding site issue is largely irrelevant. First my reply, then the explanation.

TRANSLATION: Even if the vaccine-produced spike protein is “inactivated” toward some unspecified binding interaction in some unspecified way [which is contrary to the use of the largely unchanged full spike protein for immunogenic reasons, but let’s just ignore that point], so that the spike does not engage in some alleged “binding” in some way [I provide a plausible example], it doesn’t mean that the spike is not doing exactly what the viral spike has been proven to do, in terms of getting into the cell nucleus, AND bringing in its own mRNA at the same time.

Twitter’s character limits forced me to make that reply too jargon-filled for most, and possibly even for Taylor, who seemed not to have understood the full life cycle of the vaccine.

Allow me to explain in even more detail what I said, which was designed to clarify the issue for Taylor.

Let’s assume that the vaccine spike is somehow “inactivated” in its interaction with cell surface receptors. This would mean that new vaccine spike created by cells, would not interact with new cells in the same way as new disease spike protein, whether that spike was alone or part of a virus particle. I refer to that as “secondary toxicity”.

What I’m pointing out is that this is irrelevant to a “primary” toxicity concern – in fact a “genotoxicity”. This is the risk that spike protein produced in a cell, due to that cell ingesting a lipid nanoparticle of vaccine, might then get into the nucleus, and change the nature of that cell in a more fundamental way.

Now it is understood that the vaccine is “supposed to” lead to the death of infected cells, when those cells produce a bunch of spike protein, and are attacked by the immune system. The problem is that this doesn’t always happen, and indeed may not even be the primary fate of cells which take in the vaccine nanoparticles. What happens if the bell curve of vaccine intake creates a large number of cells which are damaged but not dead – which are not cleaned up by the immune system – and which have injured nuclei? There are lots of ways for things to go wrong.

What I am basically saying is that if the Mehedi results apply to vaccinated cells that are not cleaned up, we have a “bad cell problem”, and the problem isn’t just the spike – it’s in the nucleus. The cell’s problems have just become more “permanent”.

And that’s where things are. That fight is over, but I’m fighting over the De Marinis paper on another part of Twitter. That one is interesting, too.

STAY TUNED FOR MORE.

W

Title: CAREY TREATMENT, THE ¥ Pers: COBURN, JAMES / AUBREY, SKYE ¥ Year: 1972 ¥ Dir: EDWARDS, BLAKE ¥ Ref: CAR019AF ¥ Credit: [ MGM / THE KOBAL COLLECTION ]

Tough Tendons, Quincy – Give Us The Proof!

It’s Time to Just Say “NO” to “Unknown Causes”

Arm yourself with knowledge and links to the scientific literature, for that moment when they try to spin the jab death of your friend or relative as mere “sudden death”, and you want an autopsy to prove it was the jab.

There was ONE MORE LAMENT in reply to ONE MORE TWEET about ONE MORE “SUDDEN DEATH” that just pissed me off ONE TIME TOO MANY.

That person made the most AMAZING point.

Remember all those Hollywood tales – those geeky murder mysteries – about noble coroners and medical examiners – those brave pathologists who risked their “gun-free” lives to tell the world the TRUTH about some sinister hidden murder?

Yeah? Well, WHERE THE HELL IS QUINCY NOW?

It’s not like there’s no suspect.

There are THOUSANDS of these tweets – dozens more every week – maybe a dozen a day about FAMOUS PEOPLE. The numbers of obscure, anonymous plebes like us, dying “suddenly” of “unknown causes”, must be a thousand a day, in America alone. Or maybe even more.

YOU KNOW WHAT’S DOING IT, TOO.

So – like what – is Quincy just gonna let ’em all SKATE?

It’s not like we’re even getting ALL TALK and NO ACTION from “coroner world”.

It’s not like we’re even getting NO TALK from coroner world.

It’s more like they’re going out of their way to SHUT UP the talkers.

Seriously – the idea of going after one of the few people who is willing to speak the truth – it’s beyond a travesty.

THEY’RE GOING AFTER THE HANDFUL OF REAL QUINCYS.

Just read this propaganda, if you can stomach it.

LINK: https://www.medpagetoday.com/special-reports/features/102702

So what do we do?

I say we FIGHT BACK by SAYING NO – our greatest power.

We say NO to their “fake beef”.

We say NO to their “eat zee bugs”.

We say NO to their defective, cell nucleus-penetrating, gene-hacking jab.

AND WE SAY NO TO “UNKNOWN CAUSES”.

BECAUSE WE CAN.

You see, there is another brave pathologist in Germany, who worked with a brave Thai immunologist, also in Germany, to discover and then tell the truth about the vaccines.

I urge you to at least skim this short article that summarizes the situation.

LINK: https://stevekirsch.substack.com/p/bhakdiburkhardt-pathology-results

For those who prefer videos, here is an initial description of the findings nobody is willing to talk about.

LINK: https://www.bitchute.com/video/fHIT55iM4Zv9/

So what’s the point?

The point is that coroners, pathologists, and medical examiners are being FORCED, by the neo-liberal, NEO-SOVIET state, to PRETEND NOT TO KNOW that it’s the jabs.

What these “neo-Bolsheviks” are doing, is to force their insistence that good Bolsheviks “pretend not to know”, on the rest of us, who DO KNOW, and who are willing to admit it.

All you have to do, is to say NO, when the coroners try to pass that bullshit on to YOU.

If YOU have a “sudden death” in your family or circle of friends, you don’t have to take a diagnosis of “unknown causes”, or worse yet, “blame-casting” to lifestyle, climate change, or whatever else they come up with on the fly.

You do NOT have to play stupid to coroner and medical examiner “authority”.

You have the power to FORCE THE CORONER – LEGALLY – to examine for a specific cause of death, and to give you ALL the evidence, by freedom of information. That way, even if they LIE TO YOUR FACE, you can take the results to another pathologist, and have the results CONTRADICTED PUBLICLY.

What you need – when they play dumb – is (1) a lawyer, and (2) SCIENTIFIC LITERATURE.

You need to TELL THEM – ahead of the autopsy, that you EXPECT them to test relevant tissue for evidence of damage by the jab, and if they say it can’t be done, you TELL them you’re going to send them the necessary scientific literature on how to do it, and that you will have the lawyer send it to them by registered mail.

We are giving you the scientific literature now, so that you have it handy. Having a lawyer’s name and number ready, so that you can be “insistent” on an autopsy, is your responsibility.

Here is the relevant scientific literature – in TWO LINKS (plus backups).

LINK 1: https://doctors4covidethics.org/wp-content/uploads/2022/08/causality-article.pdf

LINK 2: https://link.springer.com/content/pdf/10.1007/s00392-022-02129-5.pdf

LINK 2a: https://link.springer.com/article/10.1007/s00392-022-02129-5

LINK 2b: https://odysee.com/@SixthSense-Truth-Search-Labs:0/s00392-022-02129-5:f

You can download and print out these two PDF files, so that – in the best tradition of a Quincy episode, you can throw back your 80’s hair and SLAP THAT ROLLED-UP PAPER in the coroner’s chest, and tell him (or her):

“IF YOU CAN’T DO IT, THEN CALL QUINCY!”

They may tell you “it’s expensive”. You laugh in their faces. And then you TELL THEM WHY. Whether you join a future class action suit against Pfizer and Moderna, or whether you go to the Deep State Vaccine Payoff Board, either way, PROOF OF INJURY is how you will get it all paid back, with INTEREST.

Right now, coroners only have “pressure from above” – and that is why they NEVER speak the truth.

WE have the power to push back from below, and to GET THE TRUTH.

So HEY, all you FAKE QUINCYS – here’s a message from MISS QUINCY. As you sit back and let them skate. Just like everyone else.

W

Genomic DNA Incorporation of the SARS-CoV-2 Spike Protein Explained by Unique Hidden Key to Nucleus and Spike’s Surprising Ability to Transport mRNA

This is SO HUGE. I must explain this to you.

TL;DR – The spike protein not only contains a special sequence that allows it into the cell nucleus – it also has an ability to bring its own spike mRNA sequence with it. Both features appear to be unique among coronaviruses. The features explain genomic incorporation found for both the virus and the vaccines. The special key and the mRNA shepherding can be considered to be defects in any spike vaccine that has them.

¡Muy explosivo!

Due to comments by WSB and Valerie Curren, I realized that I had to do this post.

Also, NONE of the “bigs” are talking about this, but it is HUGE, if only people will read the paper.

By sheer luck, I was alerted to this new development ASAP on Twitter.

A follower of mine, who I had followed back, posted on Twitter the link to a paper with this title:

Nuclear translocation of spike mRNA and protein is a novel feature of SARS-CoV-2

I immediately realized what this was about.

It’s about how the SARS-CoV-2 (COVID) virus spike protein and its mRNA get into the cell nucleus – an extremely important point which WSB has been hitting on over and over. It’s very important, because THAT is how “genomic incorporation” happens. And genomic incorporation is what HIV does – what retroviruses do. They “get into” the DNA and leave cookies, so to speak.

Sometimes, they leave enough cookies, that the whole virus comes back out, fully functional, and ready to infect. Sometimes, they only leave enough junk in the DNA to cause some damage. Sometimes, they leave enough to change us – and that is why human DNA is filled with “viral leftovers”.

In principle, mRNA technology should NOT do this. We were TOLD that mRNA technology could not do this. But somebody LIED TO US. And not only that – NOBODY – from Bill Gates on down – ever apologized to us about lying, or even about just “being mistaken”.

We’ll get to that later.

You will recall that there are two papers I love to mention.

One is the “Jaenisch paper”, which describes how the SARS-CoV-2 virus manages to get some of its genetic instructions for the spike protein into the DNA of cells.

LINK: https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1

ARCHIVE: https://archive.fo/XWC52

The other is the “De Marinis paper”, which describes how the Pfizer vaccine did the same thing to human liver cells in vitro – meaning that in an experiment using cells in culture, the Pfizer vaccine got its mRNA sequences into the DNA genetic material of human liver cells, and it did so in a matter of minutes.

McCullough got in a lot of trouble with Twitter for posting this, even though it was utterly true. Now we know that the government was trying to shut it down. They likely used the technicality of McCullough’s very VALID speculation (stated as speculation and concern), which turned out to be correct, IMSO.

LINK: https://www.mdpi.com/1467-3045/44/3/73

LINK: https://portal.research.lu.se/en/publications/intracellular-reverse-transcription-of-pfizer-biontech-covid-19-m

These papers explain ALMOST everything. When I saw the Jaenisch paper, I predicted that we would see the De Marinis paper. MEANING – when I saw that the virus could get mRNA into the DNA, I predicted that the vaccine might get its mRNA into the DNA, too. And yes, I was right. Clearly others thought the same thing, and decided to investigate.

Now, after the De Marinis paper, it seemed very obvious to me that one did not need any kind of special conditions or reverse transcription promoters to get the vaccine mRNA to incorporate.

That bothered me, and I suspected, at the time, that MAYBE – just maybe – the spike protein ITSELF was somehow causing genomic incorporation – that it functioned as a kind of reverse transcription promoter.

Well, it sure looks like that is the case.

According to the discoveries revealed in the new paper, which I have taken to calling the “Mehedi paper”, there is a special sequence in the spike protein that acts like a “key to the nucleus” – and this sequence is found in NO other coronavirus spike protein.

LINK: https://www.frontiersin.org/articles/10.3389/fmicb.2023.1073789/full

ARCHIVE: https://archive.fo/kW9Bd

Here is the abstract of the new paper.

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes severe pathophysiology in vulnerable older populations and appears to be highly pathogenic and more transmissible than other coronaviruses. The spike (S) protein appears to be a major pathogenic factor that contributes to the unique pathogenesis of SARS-CoV-2. Although the S protein is a surface transmembrane type 1 glycoprotein, it has been predicted to be translocated into the nucleus due to the novel nuclear localization signal (NLS) “PRRARSV,” which is absent from the S protein of other coronaviruses. Indeed, S proteins translocate into the nucleus in SARS-CoV-2-infected cells. S mRNAs also translocate into the nucleus. S mRNA colocalizes with S protein, aiding the nuclear translocation of S mRNA. While nuclear translocation of nucleoprotein (N) has been shown in many coronaviruses, the nuclear translocation of both S mRNA and S protein reveals a novel feature of SARS-CoV-2.

Let me put that in plainer English.

COVID-19 really hurts old people and seems to be both deadlier and easier to catch than other coronaviruses. The spike protein seems to be why. Although the spike protein is a surface protein that normally would not do this, it might be predicted to get into the cell nucleus because it has a special sequence “PRRARSV,” a known key to the nucleus which appears in no other coronavirus. Sure enough, the COVID spike protein gets into the nucleus of infected cells. What’s more, the mRNA for COVID spike protein also gets into the nucleus. What happens is that the spike mRNA collects near the spike protein, which helps it get in. While a different protein called the “nucleoprotein” of many coronaviruses is known to get into the nucleus of cells, the penetration of the cell nucleus by BOTH the spike protein AND the mRNA for it, seems to be a unique new feature of the SARS-CoV-2 virus.

Once you read it in plain English, it’s much more mind-blowing.

Now – I really recommend that you read the rest of the paper, but it’s really just technical details about what was mentioned in the abstract. Those details can help you gauge the expectedness or unexpectedness of things, but I have tried to do that as best as I could in the translation.

At this point, you should have all kinds of questions.

  • could this defect of the vaccines have been predicted?
  • should it have been predicted?
  • did the Chinese know this when they sent us the sequence?
  • did we know it when we got the sequence?
  • would NOT using the full spike protein have prevented this?
  • if so, why did we use the full spike protein anyway?
  • would the “forbidden” Winfried Stöcker RBD vaccine have avoided this?
  • if so, why was his vaccine suppressed by the German government?
  • does this affect the Peter Hotez vaccine, Corbevax?
  • if not, why didn’t his vaccine get promoted through the process quicker?
  • is nuclear penetration a common problem with mRNA technology?
  • how did this “key” get into the sequence? Naturally or not?
  • could “directed evolution” of the spike have yielded this?
  • why wasn’t this clear from the moment we got the sequence?
  • did people know this and hide the information?
  • were key people like Bill Gates (their side) and Robert Malone (our side) aware of this possibility?

The last question is a gift to WSB and her virologist friend. I am by default a defender of Dr. Malone, but WSB and her friend are long-time skeptics of the technology, and thus of Dr. Malone. In all fairness, I think we have to ask EVERYBODY the same questions.

  • Did people KNOW that mRNA technology had this vulnerability?
  • Does this look any more like an engineered bioweapon, designed to get into the nucleus?
  • Was this thing made by nature, by people, or by somebody with more advanced technology?
  • What is the purpose of getting into the nucleus, if it is designed to do that?

That should be enough. I will leave some links to prior comments I have made, in an appendix, hopefully added later.

Thank you.

W

John Fink and James Coburn discuss case in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

PS – A great interview of our site mascot!

https://thehollywoodinterview.blogspot.com/2008/02/james-coburn-hollywood-interview.html

depop.gov

An exercise in conceptual shaming

The Population Control Shot – Introduction

Let’s try a different angle on that one…..

See, for example…..

The Population Control Shot – Understanding the Peoples Climate Temple

BUT WAIT! The depop shot doesn’t just work on the euthanasia end of things…..

See, for example, what I was thinking BEFORE the Pfizer data showed us that the VACCINE was migrating – i.e, back when I thought it was ONLY the spike protein itself that was migrating.

Is The Abortion Vaccine Right For You?

Yeah. Funny about that spike protein. Funny how Dr. Malone tried to warn NIH and FDA that the spike protein was way too pathogenic to be used as an immunogen, and they just said “we’re good”. (Y’all can research this one yourselves. Look through multiple Malone interviews to find a nice, long, complete account of it.)

It’s taken us a while for this to be generally recognized, but I think we’re there now.

The answers in the above Twitter video are not as “scientifically complete and direct” as I would have answered, and I actually have some minor scientific quibbles, but overall, this is 99% correct, and completely correct on the outrageous pathogenicity of the spike protein.

Especially the Wuhan-sequence spike protein that they STILL include in the shots, for absolutely no scientifically valid reason.

Yeah, think about that. GODDAMN depoppers.

I have to say, the fact that I came to the same conclusion as Malone about the spike protein a long time ago, but after he did, for completely different reasons, backs the idea that this could have been, should have been, and probably WAS obvious to somebody else.

Spike Protein = Spike Protein ≈ Snake Protein

Using Principles of Protein Equivalence and Analogy as Predictive Tools for Coronavirus Understanding Surely you’ve heard of the BROWN RECLUSE SPIDER. The brown recluse is related to several other recluses, and a couple of other families of spiders, that all have a similar venom – a protein called sphingomyelinase D. This is an enzyme that …

The Spike Protein’s Purpose Betrayed By Its Own Superiority

TL;DR – you MUST listen to a short podcast of a scientist revealing the latest research on the spike protein vaccines. The VACCINE ITSELF (not just the spike protein – the mRNA vaccine itself) is persistent and is not only concentrating in ovaries – THE VACCINE ITSELF IS EXCRETED – e.g., in breast milk. Meaning …

Science vs. Anti-Science: Conservation of Spike Protein Biochemistry vs. Democrat Media Voodoo of Post-Pandemic Stress

As a young science student in the 1970s, I never would have thought that I would have to correct the American and global media over an issue of late 19th century basic science, but yet, here we are. When basic theories of MATTER and CHEMISTRY proved that “Compound A created by one route has the …

Which just makes the idea that some people WANTED this to happen, all the more likely.

Again – and I repeat…..

The Population Control Shot – Introduction

What if I could explain every head-scratcher of the “pandemic” with a simple idea – that vaccination is the ideal format for introducing real, workable, tunable, and long-running “population control” into socialized medicine without anybody really noticing or caring? Intro to the Intro It’s one of those things that – once you see it – …

Bottom line – people are recognizing vaccine-related depop as a REALITY.

Time to make them self-reflect upon what they’re doing, pushing these bad vaccines.

W

Hat Tip Sundance:

Joe Biden Pushing Vaccine Booster, But Only 20 Million Have Decided to Remain on Ronacoaster

Feature image dedicated to Kayla Rose Lumpkins. Hat Tip Jim Hoft.

“I Now Truly 100% Believe It was Because of the [Vaccine]” – Grieving Mother Vows to Bring Justice Following the Sudden Death of Her “Healthy and Athletic” 18-Year-Old Daughter

NOTE: At the moment, “depop.gov” is not a real site – it’s a “parody hypothetical URL”. I have no idea if anything is parked there. What happens after this is not my doing, and the parody URL stands as what was intended. Parody. But deadly serious parody. It’s time to wake the HELL up, world.

The Population Control Shot – Understanding the Peoples Climate Temple

In cases of religious mass suicide/homicide, such as Jonestown, Heaven’s Gate, and Aum Shinrikyo, it is very difficult to regain a humanitarian understanding of the key participants after the infamy of defining events sears the conscience and redefines reality.

Even more difficult, however, is the opposite – to BEGIN to think the unthinkable and speak the unspeakable, that we all seem to know is true, but which we can only comprehend in principle, not in reality.

It is almost impossible to leave the past where we could trust – and yet, we were warned about this.

Who are we taught to trust the most?
This will not be easy.
The END.
Q

You don’t understand “revolutionary suicide”. But you need to understand it – and soon.

Those who believe in “revolutionary suicide” for most of humanity as a “solution”, are acting on that belief, because “there’s no time”.

This message about “there’s no time” was not meant as much for you, as it was meant for the people with the pitchers of Koolaid, and the people with the guns, stationed around the perimeter of the compound.

Put on your seatbelts. The truth about what is going on is going to blow you away.

Those who first noticed and described the “religion of climate change” likely had no idea that they were literally correct, but they were. It’s a cult.

The Frankfurt Marxist experiment called “Peoples Temple” and its fateful concept of “revolutionary suicide” explains all aspects of the current deadly social experiment, from Green New Deal, to Great Reset, to the semi-failed population control shot, meant to transition us into integrated population control as part of [socialized] medicine.

The climate-conned progressives had a dream. That dream, being built on a stolen election, is already “pre-failing”, but not fast enough.

Something is Looming Geopolitically, and We Better Start Taking It Seriously

August 18, 2022 | Sundance | 1,297 Comments

I will tell you what I told Sundance.

We are dealing with a cult. As in the case of many cults, they are a group of well-meaning, good-intentioned people, who have a bit too much faith in their human leadership obsessed with human solutions, and not quite enough faith in God.

When the convincing argument met a pesky commandment, exceptions were made.

Now before you tell me I’m wrong, and that they’re all distinguishably and remarkably evil, unlike us, the good guys and better girls, take a minute to cool off and remember why your Bible said why we should not take too much pride in ourselves, my fellow sinner. Kurt Vonnegut turned the clarity of his PTSD-enhanced vision for our hypocrisy into a career. We could all use a bit of that vision.

Oh, there is evil mixed in – swirled into the goodness like poison until it’s tasteless – and that’s exactly why it’s hard to detect.

It’s easy to think of cults as purely evil and therefore incomprehensible, but it’s not a great way to comprehend their danger. It is when you examine their humanity, as we walk among them and smile, and they smile back with an equally human face, that you see WHERE and HOW the danger arises.

I have learned so much about God in following this story. Hopefully some of that EXTREMELY important part will help to freely convince you that you, too, need God – even if that God exists for you in the most abstract way possible – to keep you from falling into mental traps which, paradoxically, come from our human self-reliance and “realism”.

God is a weird idea that almost has to exist by emergent self-creation from our reality, like calculus does. Where does God come from? For that matter, where does math come from? What is the weird mathematics of infinity a subset of?

Simply believing there is more, and that it is not inherently against us, but for us, as demonstrated by our own existence, seems to be key to avoiding error. If you can accept that much of a Cartesian “God”, good. It is enough.

Ground yourself in God before you go on reading this. It is our lifeline back from diabolical error.

Why [Sometimes] Jones Was Right and We Were Wrong

I’m shocking you with that title of this section for a reason.

Jones was not right about everything, obviously. But he was right about enough, that if you can use that to begin to understand his motivations, and his correct thinking on some things, you can see where and how he and his followers were led astray.

This quality of being “right about too much, but misleading in the end” is VERY typical of communism, and Jones was, if you read Peoples Temple thinking, a communist of the Frankfurt School type. His Peoples Temple was a living experiment in resolving all the accused bugaboos of Western society – the “oppressions” – that critical theory challenged.

Jones saw unnecessary, systemic, racial problems and wanted to do something about them. Jones saw marginalization of women and felt it inherently wrong. Jones saw the collectivist aspects of earlier forms of Judaism and Christianity, and felt that they could not be ignored. Ironically, he did not see the power and possibility of the “greatest collective” – all of us living independently and harmoniously in a free and truthful world – but that is what made Jones perfect as a micro-reactor experiment for the creation of a very progressive “woke Christianity”. And that is exactly what he was. Woke Christianity, only 40 or 50 years ago.

Jones saw that American Christianity could be made more “social” – or socialist – and discovered that it actually worked, when judged by metrics of earthly success.

When I began to read some writings by a leftist sympathizer of Peoples Temple, based largely on the viewpoints of insiders and survivors, and she described my own deficient thinking about the People’s Temple correctly, and how I was part of the misunderstanding and minimizing thereof, I gained deep insight into not only the truly leftist nature of the Peoples Temple, which was clearly a fellow traveler of cultural Marxism, but also how seductive both critical theory is, and the Peoples Temple was. Even the analysis itself was seductive, in correctly describing the flaws of my own views of Jonestown. However, the devil is in the details, because sympathy for the people of Jonestown can easily whitewash the truth about bitter flaws in their collective, and collectivist, dream.

In the end, it’s Jesus versus Stalin. Stalin, sadly, beat Jesus in the world of Jim Jones.

Stalin will mislead you into demanding or committing harm of others for the good of the whole, whereas Jesus will lead you as an individual into sacrifice of self for the good of others.

It’s a subtle difference, but it makes all the difference in the bigger outcome.

To gain the same insights I got, you can beneficially read the same writings I did. Start here.

LINK: https://jonestown.sdsu.edu/?page_id=29475

ARCHIVE: https://archive.ph/N2pWf

Not the least reason to read this, is that it reviews the FACTS of the history and the shocking, sad end of the Jonestown experiment.

Even more importantly, this reading exposes and explains strong parallels to the Climate Cult. It does so by exposing the thinking of Peoples Temple members from the inside. This thinking very obviously maps to the thinking of the Climate Cult.

Formation of the collective – mass formation psychosis – creates a world layered on this one, beautiful and addictive as hell, and soon to be enhanced by the “metaverse”. But threaten that world, or merely create the perception of threat, and the mass can be manipulated into remarkable behaviors.

Ah, the FURY that Malone’s utterance of “mass formation psychosis” provoked in the media.

THEY KNEW.

(Hat Tip Tonawanda)

To provide some contrast with the Jonestown collective’s broken view of itself, I am providing a short “outsider bibliography” on the Jonestown cult, which is differently broken, as you can see from the demonstrated preconceptions, psychological defenses, and capitalist myopias that the insider narrative points out. But be careful. Sympathy for the Jonestown victims, and understanding of them as good people much like us, can lead to sympathy for the devils that seduced them. Just because our devils hounded them, doesn’t mean that their devils didn’t destroy them.

Same goes for the Climate Cult.

If you ever had any sympathy for the Branch Davidians, you will get what I’m saying. It is much easier to see the evil in Cankles and her crew of nogoodniks in the Climate [Control] Cult, by having at least some sympathy for one of their victims – the flawed Christian cult of David Koresh. (Yeah, that gets complicated.)

Anyway, some comparisons. Here – let’s trivialize the victims!

LINK: https://www.vox.com/2015/5/23/8647095/kool-aid-jonestown-flavor-aid

OK, how about gritty truths wrapped in the final assessment of “paranoid”?

LINK: https://www.britannica.com/event/Jonestown

This next one is a rough gem – very anti-Jones, but exposes the dynamic of the suicidal closest layer of followers, who are willing to be homicidal to the greater outer layer – and THAT is exactly what applies to the Climate Cult.

LINK: https://www.history.com/news/jonestown-jim-jones-mass-murder-suicide

Now – I told you that you didn’t understand “revolutionary suicide” – so let’s fix that.

Revolutionary Suicide

What is revolutionary suicide? It is – at its core – simply taking the ultimate exit from an unjust society, instead of fighting against it. Here is Jim Jones in his own words:

We committed an act of revolutionary suicide protesting the conditions of an inhumane world.

Jim Jones, “Death Tape,” 1978

Looking beneath that statement, trying to understand what constitutes “the conditions of an inhumane world”, I believe that what we find is the failure of the Peoples Temple cult to navigate reality. Jim Jones tried everything he could, to make his utopian vision take hold in reality, but his vision ran into more and more conflicts with the real world outside his cult, until the legal and judicial systems had Jones in a state of constant challenge. Even fleeing America itself did not work. In Guyana, the conflicts grew, until legal actions against Jim Jones were imminent. Jones correctly realized that he had nowhere left to go, and thus could not maintain his vision of the Peoples Temple. Jones could not even flee to the Soviet Union – one of the options that was always on the group’s table of discussion. Jones knew that he was politically radioactive, and no longer useful to the Soviets.

“Revolutionary suicide” is the ultimate “take your bag of marbles and go home” move – but remember – THAT is also a perfect description of individual suicide.

As a number of individuals in the Jonestown cult felt the world crashing down upon them, with the increasing problems of the cult, some felt suicide was the answer. Jones was sorely tempted by this route.

I have to ask – was the Climate Cult moved ahead in its schedule by external forces? Ask the question, because it seems to me that the answer is yes. The very defects in their plan that allowed us to see it all, may have been the result of schedule changes forced by the Trump election.

Whether individuals or groups are hounded by their own perception of external criticism, or by actual hounding, it doesn’t matter – suicide can be the result. See January Sixth, as well.

The greatest moral problem with all group suicides, including “revolutionary suicide”, is that these deaths are not free of hounding or worse, this time internal, and themselves approach or even constitute murder. Hounding, tricking, and otherwise coercing the GROUP to fully participate is the reality of the act.

Innocent people who want to LIVE are forced to DIE.

Thus, there is a HUGE footprint of MURDER in “revolutionary suicide”. This is clear in the records of the Jonestown incident. A layer of “diehards” and “inner circle” were used to enforce the group decision, leaving only a few who managed to escape by using their wits.

Shades of the jab.

Most people do not want to commit suicide. Most religions teach against it. But not all, and I believe that the truest believers at the center of the Climate Cult are quite ready to kill and be killed for their goals.

If a CIA operative suggested “revolutionary suicide” to the Jonestown cult, it would not surprise me. Their collectivist nature was highly vulnerable to this form of exploitation. Indeed, the same may apply to other cult suicides.

Either way, whether spontaneous or provoked, the possibility of group error, including group entry into a suicidal choice, is a viral vulnerability of social beings.

So now, let’s apply this fully to the Climate Cult.

Revolutionary Climate Justice

It is my contention that the Climate Cultists who are knowingly behind the Population Control Shot are mostly recruited true believers, much like those closest to Jim Jones. This would be the most obedient layer. Beyond them, however, are many who believe most of the climate cult canon, but could not be counted on to obey morally contradictory orders such as murder or suicide.

So who took the shots? Did they all play “climate roulette”?

Doubly Vaxxed and Boosted

AND logic is your friend here. Some of the “knowing” likely virtue signaled to the climate goal by taking the statistically lethal depopulation shot – others less courageous and more cowardly rationalized their “need to survive for the sake of climate justice” and did not. Bill Clinton is a great example of the latter type of thinking – his view of actual obedience to feminism in men was that “exceptions need to be made for the leaders”.

Hypocrisy. It seems to be “baked in” in communism.

Either way, shot or no shot, the true-believing “there’s no time” climate cultists are, I am certain, committed to the group goal of “saving the world from climate destruction by acting now”.

You can see this in every OTHER hare-brained scheme they are rushing forward now. The “clot shot” was merely one avenue of “saving humanity”. The others are happening right now, as food and energy systems are being destroyed, both economically and physically.

Shades of Pol Pot. Who even the Vietnamese communists knew was wrong.

Yes. It’s all backwards. It’s all deluded. It’s all destructive.

They had to show us. And we are being shown.

Representative Alexandria Ocasio-Cortez (D-NY) and Senator Ed Markey (D-MA) were joined by Democratic lawmakers from both the House and Senate on February 7, 2019, to introduce Green New Deal legislation.

Does this all seem a bit overwhelming? Having doubts? Is it just too much?

Here are two “public” explanations I have given for “higher credibility”. First on Steve Kirsch’s blog, then on Sundance’s post on The Burning Platform. These are the same explanation, only a bit softer and easier to digest.

Wolf Moon

21 hr ago

Great article and statement of principled science.

People refuse to speak up about the nuttiness of it all, even though most know something is wrong, and many suspect that there is an intentional component.

I’ll spell it out. Somebody has to go first. I’m retired. I can’t lose a license or chair, or my pension (yet).

To me this was a fairly smart attempt to integrate top-decided and down-to-the-individual-tunable (see “bad batch phenomenon”) population control into medicine, and in fact a rather ingenious strategy, too. A vaccine – hero of a media-led crisis – unquestionable by the masses or the media – with a known dose-response mortality curve (see again “bad batch phenomenon”) that can in principle be dialed up to achieve ZPG, as long as denial of adverse events is enforced by holding all questions outside the Overton window. The dual nature (decrease BOTH longevity and fertility/productivity) is quite smart. It’s a bit “cinematic” and even “sci-fi”, but it worked pretty well due to human psychology.

The phony climate crisis (“there’s no time!”) was surely used to recruit many of the needed life scientists to carry it out or protect the plan. THAT was ingenious. Use an alleged crisis in one part of science to find unquestioning believers as recruits in a different part of science, who could “do something” about it.

Something very interesting here, is that this theory – which I find neatly explains all the “mistakes” people in charge have made – is crystal clear once you have “sympathy” for solving the population problem. Our leaders have encouraged desperation over the “climate crisis” in the susceptible population, and scoffing in the remainder – a very useful division for concealing the plan. The desperation messaging thus bounces off the very people who would have any inclination to look critically for such a plan or planners. Those people don’t understand the desperation of a scientist driven to “save humanity”, and thus would never bother to REALLY look for such a plan. It just seems too fantastic. One has to open up to the possibility that they might, in principle, be right, just to make the idea conceivable. But just try it. What if people REALLY BELIEVED we were going to all die in ten years, or some other typical “climate scare story”? Would you “join a global team out to save the planet”? Almost sounds like something people have been trained to do by our “entertrainment”.

So have sympathy for the devil – I mean the plan – or at least its motivation – the idea that people who really think we all will die if some are not sacrificed now – why then it all makes sense.

Now, as Steve points out, the numbers aren’t there yet on the shot, although I suspect that the long numbers on cardiac and immune deaths are more than we know yet. And beyond that, perhaps this is a bit like Hiroshima and Nagasaki – a THREAT to force us to get population under control by other means. I suspect they have a strong “Plan B” for us catching them. What is it?

I don’t like being brought to a negotiation at gunpoint, and having grabbed their gun, I’m a bit pissed. But nevertheless, here we are and it is now (and I know that what I’m selling smells like moonshine, but bear with me). Are they going to try something else, or are we going to talk about this reasonably? Judging from CDC falling back to the real science now, methinks the inevitable cover-up is going on. While I myself hang around with a crowd that screams “tribunals”, and look across the aisle at Democrats who would be the first to cry “amnesty for the climate do-gooders” (I suspect the plan counted on this), I think it does behoove us to make this stuff not able to happen again, as the most important solution. Whatever phony “lessons” come out of CDC, just ain’t gonna cut it. Human science and medicine have been damaged incredibly, but I think not irreparably, as I have faith in the truth winning in the end.

I know it all sounds fantastic, but go back over the “errors” people have made, driving toward “fair” universal deployment of the shot, and imagine that they were “trying to help”. Things start to make sense. But yes – it would be a bit cult-like, and it helps VERY much to read about the very lefty People’s Temple and “revolutionary suicide”, which is almost a model for this.

LINK: https://jonestown.sdsu.edu/?page_id=29475

Wolf Moon

Good work, Sundance.

I will say this. These are NOT unforeseen consequences. They are “necessary consequences” in the eyes of the true-believing “climate cult”. A literal cult which was very intentionally created. Created to do exactly what it’s doing. And I have some new thinking on it that is difficult to speak just yet, but essential to understand.

I am now absolutely convinced that the “dumb vaccine” was a very intentional plan by these same people to achieve the same goal.

When people assert that the CIA was behind Jim Jones and Jonestown, or studied Jonestown – oh – they don’t know the half of it.

THIS is essential reading: https://jonestown.sdsu.edu/?page_id=29475

If you know anything about the Frankfurt school, their fingerprints are all over this lab experiment.

They were WAY ahead of us.

In the last couple of days, I have come to understand the relationship of Jones as a model for the Climate Cult. Even the race obsession and CRT figures into prepping this psychological attack on humanity. The weird racial and sexual psychology of that cult was a key feature, also present now.

There is a joke meme about Jonestown and Fauci, but ironically, the very communist followers of Jim Jones who survived have an excellent, critical theory-based, Frankfurt-school critique of how we, the capitalist dupes, joke about their “revolutionary suicide”, as they called it, and don’t take anything they did seriously.

They can describe us accurately. We need to describe THEM accurately. This is no longer a joke.

That mentality has been WEAPONIZED against not just America, but THE WORLD.

I’ll have more about this later today, in my “population control shot” series.

The point is, it all ties together. “They” – whoever “they” are at the top – have used a CULT they have created – to “downsize” and “disempower” humanity against its will, in defiance of all common sense.

It’s VERY culty behavior – the irrationality and schizoid behavior of the key participants (Pete Buttigieg and his SUV-to-show-bike stuff) is a feature, not a bug.

Hopefully those explanations have helped you formulate your own opinions – whether you now think I’m onto something, whether you just can’t buy any of this stuff, or something in between.

Either way – where do we go from here?

Reject Climate Insanity Completely

The world is being destroyed by foolish choices, based on insane “solutions” to BAD SCIENCE which was LOCKED IN BY MONEY.

But don’t worry – we have time.

Trump is right – we can “build back a third time” after their latest destruction, even if many lives are lost or worsened in the process.

It’s tough, but accepting bad elections has consequences. Both GOPe and RINOs need to suffer for their sins. Smart solutions will now take time, where rush jobs (like AGW) lead to HACK SOLUTIONS like Windows Me or the spike protein, take your pick.

I’m not in a rush – I think we can wait until we’re at the brink, so that everybody agrees – this is all nuts.

BUUUUUT – I do have a solution, of how to get to that brink of “all the sane people agree” much faster.

In many ways, I am going to back up Sundance’s approach.

FIRST, we (ourselves) need to quit pretending.

Quit Pretending

August 15, 2022 | Sundance | 1,107 Comments

Stated differently, SCREW THE VIRTUE SIGNALS. We can’t afford to politely agree with the CRAP any more. Let people KNOW that it’s crap, that you don’t agree with it, and that you will not vote for anybody who even puts up with the crap when THEY are faced with it.

The CRAP is destroying the world, and WE don’t go along with it.

I repeat. You need to stop virtue signaling to the mainstream narratives, and most importantly THE CLIMATE NARRATIVE, in any form.

It you want to know the ONE REASON why Trump was not “allowed” to be President, I can tell you with near certainty – it is because he REJECTS the “climate games” in their entirety.

Trump LOVES the environment, but he REJECTS the weird corporate “bad science” that was layered into it, with the absurd CO2-based climate change story. And so do I. I reject their bad science and even more their toxic workarounds that stem from the bad science.

[Note: I have watched “climate science” from the beginning, and I have NEVER seen science that convinced me of anthropogenic global warming climate change being real – much less a threat to humanity, even if it was real. Indeed, I see an incipient ice age as the far greater threat – and one that is EASILY dealt with by following the path we were on before SOMEBODY decided to downgrade humanity rather than upgrading our technology. ]

No. Just NO. We don’t put up with climate insanity (please call it that), nor do we put up with those who TOLERATE IT. Not just those who advocate it. Those who TOLERATE IT.

And THAT gets to the SECOND point.

This point bears on Sundance’s shrewd recognition of the “DeSantis problem”.

We need to goad all GOP candidates into the “WEF unacceptable zone”.

Why is DeSantis acceptable to the establishment Republicans? Is it because he will tolerate climate nuttiness? The ONE necessity for a nod from Davos?

Personally, I like DeSantis, but I see clearly that the other side is using him to derail Trump. They have a smart strategy there. Evil, but smart.

Well, one way to thwart that is for DeSantis to join Trump in denouncing the climate insanity in no uncertain terms. In terms that are so strong, they make him utterly unacceptable to WEF and the quislings in GOPe.

“It’s wrong. It’s a hoax. It’s destroying the planet. It has to stop.”

And then, to spread it, a little criticism of even the slightest climate belief as a RINO position should put the fear of God in Washington.

Oh, DeSantis’s RINO advisors will go through the ROOF, but tough times call for tough measures. Klaus Schwab, Larry Fink and the Rothschild entourage need to burn in anger at the rejection. And while we’re on Fink, ESG needs to DIE. Kill it, before it kills humanity.

Climate insanity is crap, and it needs to end. NOW.

This means that a lot of GOP need to feel the STING – the BURN – of rejection.

When they so much as NOD to the bullshit, they PAY WITH THE BASE.

Are we clear? GOOD.

BURN THEIR GOD, CLIMATE CHANGE, AT THE STAKE.

Final Thoughts

We have to grab the steering wheel. It’s that simple. We’re not going to kill anybody. We’re not going to have an “insurrection”. We’re going to demand that these assholes who have fucked everything up, stand down with their insanity and their corruption.

EVERY. SINGLE. FUCKING. DAY. You are going to have to make these people feel like CRAP for supporting INSANITY and causing HAVOC.

Get tough. It’s the only way forward. But you can do it.

W

The Population Control Shot – Did Bill Gates Gaffe, Troll, Let it Slip, Or None of the Above?

You’ve probably heard OF the Bill Gates “and if we do a REALLY great job on new vaccines“ quote, which many consider to be an admission of population control through vaccines. What is the real story here?

Strap in.

This is a complex question, beneath all the lies, counter-lies, half-truths, and diabolical chaos left in the wake of the elite and their evil plans.

We’re gonna look at the question, and we’re gonna have FUN doing it, too.

Mood Music

Today I feel like an ANNOYING PUNK OF SCIENCE, pointing out the fecklessness of the lying elite and their captive lab coats of FAKE SCIENCE, with their ridiculous population control shot and their wicked lies to try to make us take it (yeah, FJB!), so I’m choosing the sneering, annoying, Billy Idol to be today’s musical mascot.

https://youtu.be/gpo2y4yWFFc

You think raiding Trump ends this?

We’re DOUBLING DOWN, ASSHOLES.

So where do we begin?

Just the Facts, Ma’am

We continue this THIRD installment in our series on The Population Control Shot with a discussion of the notorious Bill Gates quote which incongruously juxtaposes vaccines with reduction of either population or population increase, take your pick.

This is it.

So what’s the real story here? Did he really say this? And what did he mean?

In my opinion, this episode turns out to be one of the most remarkably complex LIES + COVER in history. It is every bit as brilliant as Lancetgate and the HCQ / ivermectin hit job studies.

Get your SNEER on.

Even when the numbers are wrong, the science can be right. Always keep focused on the big picture. “THEY” will try to throw you off on details.

First – Did Gates Really Say That?

Looking only at the quote itself, there is audio of him saying it, that’s very fast and easy to verify that – YES – he said it. Pay careful attention to the exact wording.

That tweet is found on this reddit discussion…..

Bill Gates saying if we 'do a really good job' with vaccines and reproductive health we can lower the population by 10-15 %
byu/Typoqueen00 inconspiracy

As you can see, it’s very easy for “telephone” effects to creep in on this quote, with “great” turning into “good“, and “on” turning into “with“, not to mention “new” (as in “new vaccines”) disappearing. There’s not a LOT of difference in meanings, but there is some.

At the very least, it’s sloppy, and easy to get derailed into trivia about inaccuracy. Fact checkers love such diversions.

Now, the next question is context. Is that quote missing some necessary context when it’s standing alone?

In my opinion, the context is enlightening about Bill Gates’ thinking, but it turns out not to make much difference in the quote. He’s basically making a projection about population, as something that impacts climate change, and then talks about the fact that certain simple changes in how we’re doing things, would only reduce that projected population increase by 10-15%.

Gates is saying, basically, that ALL THIS STUFF HE MENTIONS, even his favorite thing, vaccines, can only lower the projected increase in population by a fraction of that increase.

You can either READ or LISTEN TO the full context of the TED speech at the following link. I’ve also embedded the video below.

Bill Gates talked about using vaccines to control population growth, here is the unedited 2010 TED Talk video plus the transcript

LINK: https://techstartups.com/2021/10/06/bill-gates-talked-using-vaccines-control-population-growth-unedited-2010-ted-talk-video/

ARCHIVE: https://archive.ph/swS2e

VIDEO:

The above article about the video is interesting for several reasons.

  • it triumphantly chides the fact checkers on “Gates really said this”, but pointedly fails to bring up or counter any of THEIR arguments
  • it notes that the YouTube video has disappeared
  • it provides an embedding of the TED video
  • it allows creation of a timeline
    • Gates speech was in 2010
    • author’s first article was in 2020
    • this article was from 2021
  • it does NOT address the question of what Bill Gates MEANT by saying that vaccines would help to reduce population increase

That’s actually a good question.

What in the heck do vaccines have to do with REDUCING population?

As a side note, it’s somewhat MISLEADING that this article lets the reader ASSUME that Gates meant something nefarious here. However, it’s even MORE misleading to go to the fact-checkers, who will conversely tell you SOME MORE TRUTH, and thus misleadingly imply that the story ends THERE.

Indeed, this point is where things get complicated – probably by DESIGN.

If you don’t get past the truth of the article, and THEN the truth of the fact-checkers, you will remain trapped in a kind of diversion, in which Gates wins. It’s actually a very smart defense.

You have to get past this “immunizing fake scandal” to figure out what’s really going on.

You will see later that Gates very likely SAID THIS ON PURPOSE, so that people would “discover” what the fact checkers tell you, and settle on it.

Because “what’s next” amounts to Gates’ ultimate defense.

Ask what they were REALLY getting these medals for.

Gates: The Innocent Do-Gooder

Let’s start off with Bill Gates stating WHY he’s interested in vaccines.

https://youtu.be/UfQxZvg1Y0s

Basically, vaccines save lives CHEAPLY, according to Gates.

But why does he want to save lives?

According to Gates, it’s BECAUSE HE WANTS TO REDUCE POPULATION GROWTH.

Come again? Saving lives to….. reduce population?

Here are two videos explaining how that works.

First, Bill Gates.

https://youtu.be/obRG-2jurz0

Next, Melinda Gates.

https://youtu.be/wPzCDjdHsfY

I’m pretty sure that’s the establishment shill Scott Pelley “interviewing” Melinda Gates.

Pelley was the presstitute who tried to “take down” Mike Cernovich for Hillary Clinton on the whole #HillaryHealth issue during the 2016 election – with a rather amazing backfire.

We can TRUST that this 2018 Melinda Gates interview is a softball set-up for the Gates Foundation.

The establishment WANTS people to suck this up – whether it’s true or false.

What is being alleged here is a paradoxical effect…..

  • …..that by people “living better” they have healthier kids…..
  • …..that better lives and healthier kids leads to fewer kids…..
  • …..that by having fewer kids, the population decreases…..
  • …..and could in principle even stabilize or decline.

If this is correct, and I believe that it IS correct – more or less – then helping people live better, so that they have fewer but healthier kids, can basically “defuse” the so-called population bomb.

I personally believe that the achievement of zero population growth (ZPG) by Japan was a perfect demonstration that this principle CAN work.

It may not work for every society, and it may not be compatible with all the freedoms we desire (gotta stay skeptical), but we know that it’s not a complete loser.

But before we go on, let’s ask a pesky question or two.

WHY would the IMF then try to subvert Japan’s population “success” by trying to force them to take in Muslim immigrants, which would be very likely to cause social problems, including new population problems?

For that matter, why does the UN actually CAUSE migration problems, and then “solve” them in nonsensical ways that make things worse? When we KNOW that migration problems lead directly to new population problems?

Somebody’s not really serious about things – and in my opinion, it’s because “population” is NOT the goal of the people at the top – sometimes referred to as “Mr. Global”. CONTROL is far more likely to be their goal.

In my opinion, the “population crisis” is only a motivator for lower-level DUPES. But we’ll get to that in a moment.

Let’s get back to Gates. It seems like he’s telling the truth! Vaccines (and I’m talking vaccines that are TRULY safe and effective) WILL (or at least could) actually help reduce the rate of population increase, or even help to stop the increase, or help reverse it.

OMG! Is Bill Gates INNOCENT???!!!

AND Logic To The Rescue

Remember what I love to say about Hitler and “2+2=4” – the idea that the truth of that statement does not depend on who is saying it.

Even bigger, this.

Hitler stating publicly, for the world, that “2+2=4”, would not preclude Hitler’s own Nazi camp guards literally grinding Jews under rifle butts until they said “2+2=5”. Nor would it preclude Hitler from secretly believing “2+2=5” in some mystical occult fashion.

The truth of 2+2=4 is independent of who states it, or why.

BUT – remember as well, something I ALSO like to say.

There is no cover like the truth.

Thus, we are led to the truth that Gates may speak openly about a very publicly palatable route to population control, but that fact does NOT preclude him from ALSO secretly pursuing a more aggressive route to the same goal.

To assume it’s one or the other is an ERROR that you are encouraged to make by “exclusive OR thinking”. The kind of thinking which explains why “they want you divided”.

AND – there are certain advantages to DOING BOTH.

  • “bad vaccines” depopulate much faster, while “good depopulation” through “good vaccines” helps to manage public expectations, and can even “succeed more than we thought”
  • a “good cause” always provides the cover of innocence to a “bad cause” (see Aubergine’s razor)
  • “good vaccines” are so adjacent to “bad vaccines”, that only LIES are needed to complete the deception, that ONE is not in fact THE OTHER.

And if you don’t like calling them “bad vaccines”, perhaps we can cynically call them “socially more efficacious” vaccines. Indeed, think about that. “Socially”, they’re not just more effective – the killer vaccines are “safer”! Maybe even “socially more just”! I’m sure Obama would like that.

So what does Wolf think?

“You can’t catch me!” said The Spiky Shot Man

I think that Bill Gates NEVER changed his spots or his stripes.

The same guy who used every underhanded trick imaginable, to sabotage Linux in favor of Windows, while evading all blame in the mainstream press, did NOT go into “curing malaria in our lifetime” because he suddenly found his sweet soul.

Let’s look at this guy’s prior history, between LINUXGATE and DEPOPGATE, just in terms of attacking COVID treatments. What follows here are 7 earlier posts about Gates and/or Lancetgate and/or related conspiracies against treatments other than the Population Control Shot.

Conspiracy to Suppress Competing Science – The Case Against Bill & Melinda Gates

I think it is now quite clear that Bill and Melinda Gates need to get the hell out of science and medicine for the good of humanity. I am going to show you why. I am not saying that Bill Gates is doing anything new. I am saying that he moved his disastrous “Windows Effect” …

Dear KMAG: 20220103 Joe Biden Didn’t Win ❀ Open Topic / Benadryl Could Have Saved Grandma / The Gatesification of Science

Joe Biden didn’t win. This is our Real President: AND our wonderful REALFLOTUS. Hopefully, this great couple is getting some REST, because they may NEED IT. I am telling y’all – the Trumps may very well be on their way back to the White House in 1-3 years. In fact, the way Obammunism has been …

DEAR KAG: 20211224 – Christmas Eve – The Pub is OPEN / How Bill Gates Took Down Hydroxychloroquine

The Pub is OPEN again! With a blend of humor and seriousness, like any good bar, we celebrate this grand re-opening of WOLF’S PUB on Christmas Eve, December 24, 2021, by actually opening near closing time on Christmas Eve Eve, but what the heck. IT’S ALMOST CHRISTMAS. While our beloved bartender takes a needed break …

FIRESTARTER Bill Gates Downplays Effectiveness of Water on Fire – Says “We Need To Study All Kinds of Liquids and Promote The Best Ones”

Yeah. This fucker can PAY FOR MY RESPIRATOR. Just read this. The guy who funded the UNETHICAL virus research that gave me the fucking shortness of breath….. The guy who promoted a curiously fortuitous corona virus “exer-psy-op” while his CHINESE FRIENDS let loose the ChiCom-19 virus….. The guy who worked with DEMOCRATS to try to …

LancetGate Effect 2.0 – Indonesia

The murderous LancetGate Effect is back, and this time it killed thousands before bureaucrats relented and allowed doctors to save patients. [ Hat Tip to barkerjim for alerting me to this Indonesian case. ] Part 1 – LancetGate Effect 1.0 and 1.1 Ah, the memories of LancetGate! That moment when “they” “finally” “proved” that hydroxychloroquine …

Dear KMAG: 20200814 Open Topic / Little Boy, Fat Man & The Sundance Kid / The LancetGateEffect / Ivermectin & COVID-19 / On Staying Therapeutically Agnostic / Masks OFF

This [Q-3]TH of AUGUST FRIDAY open thread is OPEN – VERY OPEN – a place for everybody to post whatever they feel they would like to tell the White Hats, and the rest of the MAGA / KAG! / KMAG world (KMAG being a bit of both MAGA and KAG!). You can say what you want, comment on what …

The #LancetGateEffect Is Taking Names Before Kicking Ass – Please Contribute To The List

Things are happening faster than I expected. Check this out. We need to contribute to this effort. Please dig up EVERY LINK that you can find of anti-HCQ and post it here. Be sure to include a description, including WHO exactly is referenced, to save people time when they go through comments. Also, I highly …

SO – it’s not like I’m just pulling my suspicion of Gates out of the clear blue sky.

I believe all of the following.

  • Gates helped sabotage every exit from the population control shots that he could, including HCQ and ivermectin
  • the Gates divorce is a money and power protection device, invoked because there was too much failure on the COVID scam, and the Gates world is protecting its assets
  • Gates eased into vaccines via malaria, knowing that going directly to vaccines might raise suspicions
  • Gates “owns” CEPI and GAVI so that, combined with the Gates Foundation, he effectively has two votes on all things vaccine-related
  • Gates is by nature “covertly direct”, ruthless, secretive, and aggressive – so he CANNOT not pursue direct depopulation – it’s IN HIS NATURE
  • Gates always takes dangerous fast shortcuts that cause problems (see WINDOWS), so there is no way he would bypass direct depopulation methods in favor of slower methods
  • Gates has tried to keep his fingerprints off the depopulation shots, but was largely undone by the spike protein’s striking success as an abortifacient
  • Gates is very likely behind Surgisphere and LancetGate, but I don’t know if anybody will ever be able to prove it, because these “titans” like Gates, Zuckerberg and Brin can just cover for each other in ways that defy detection. If you can’t follow the money, you can’t find the proof. But Surgisphere just smells like Gates. I’m sure he’s behind it.
  • Gates prepared for his task by developing MSN and MSNBC media ventures. He knows how to manipulate the press.
  • Gates’ statement in the TED talk was a VERY intentional drop, to “fluff the paradox” and center people’s attention on either a disprovable attack, or a glowing defense – leaving nobody to ask the “AND logic” question, which solves everything neatly.
  • Gresham’s law applies to depopulation methods. In other words, bad vaccines drive out good ones. And in secret depopulation conspiracy world, they almost certainly do. People who are “performing” for “them” need stronger actions for bigger “gimmes”.
    • (insert pictures of “nursing home governors” Cuomo, Wolf, Whitmer, Murphy, and Newsom)
  • Oh, what. the heck – here’s the picture

Let’s cut to the chase. Gates is STILL A MONSTER.

The Getaway

So what is my final prediction?

Gates is slick. Gates seems to get away every time.

Why, he’s probably laughing right now!

I think he’s going to get away this time, too.

But I think we may be able to put the heat on these bastards – enough to make them stop killing us for a while, as they crawl back into their evil villain caves, to plot their next insidious attack.

Evil ain’t going away any time soon. But we can make its life pretty rough in the meanwhile.

AND WE SHOULD!

W

https://youtu.be/V3dvpp_kbf8

Vaccine Addiction Slavery Confirmed by Canadian Data

Introduction

You may remember this post (more below) from about a year ago:

How Vaccine Addiction Slavery Works

At that time, I introduced a general concept of vaccine-consequential medical dependence upon vaccines, which I called “vaccine addiction slavery“. I was explaining how spike protein-based vaccines for COVID-19 might in fact become literally addictive like barbiturates – meaning fatally so upon withdrawal.

Barbiturates are very old sleeping pills. They work remarkably well – better than opiates – except for one problem. They are even more addictive than opiates.

If you abruptly stop taking barbiturates once addicted – you die. And they are terribly difficult to withdraw from, slowly. This would be the same thing for the COVID vaccines. Stop taking them, and you die. You would have to KEEP taking them to live.

Keep this in mind. Barbiturates were “old tech”. They were EARLY tech. It took DECADES to find more modern sleeping pills that are less addictive, but still problematic (e.g., benzodiazepines). This technological history is COMPLETELY ANALOGOUS to COVID vaccines, in my opinion. It’s also similar to antibiotics. Remember MERCURY as an antibiotic?

I remember.

In all of these cases – antibiotics, sleeping pills and COVID vaccines – you NOT ONLY don’t want to take these things continuously – you especially don’t want to take the early ones, that are basically poisons of one kind or another.

So how is addiction to a vaccine possible?

The idea is, that if you get “hooked” on vaccines which show certain immunological deficiencies, relative to an evolving disease – meaning they can’t keep up AND they leave you worse off than natural immunity – then you cannot quit the vaccines under pain of death from the disease. You would become locked in a battle of vaccine manufacturers vs. the virus, dependent upon THEIR ability to stay ahead of the evolution of the virus, and the government’s willingness to give you the shot. If you don’t get the vaccine – or don’t get it on time – your vaccine-trashed immunity fails, and you die.

Obviously communists and globalists would LOVE this situation. You don’t comply? You’re gonna die.

On top of THAT, the vaccines themselves would eventually kill you, just like heroin or fentanyl.

Here is that old post.

How Vaccine Addiction Slavery Works

Wherein we explain – at three different levels of scientific and political understanding – how ADE-mediated vaccine slavery works. This post is to PREPARE YOU to watch what the other side is doing RIGHT NOW, so you can spot the deceptions. Right now they are DESPERATELY trying to make a FAILING PLAN work. Their plan …

If you didn’t read that old post, and you got vaccinated, you may be silently freaking out just a bit at this point. Hopefully you already got Omicron. THAT is the real vaccine. A quality vaccine. A NATURAL vaccine, although “upgraded” a bit by somebody. So you can calm down just a bit, if you got Omicron, and have begun to bushwhack your way back to natural immunity.

You’re not gonna die – as long as you STAY OFF THE DAMN VACCINES.

I will explain why in a moment.

But here is the big message.

There has been growing PROOF that the vaccines have the properties necessary for vaccine addiction. And now, there is PROOF of such addiction IN REALITY – from Canada.

I’m not NECESSARILY saying that Mafia daughter Nancy Pelosi and dubious East-coast Italian liar Anthony Fauci might take a mafia trick into government, and upgrade the heroin business to a world-wide scale, using a medical and government mafia, and go after ALL people instead of just black people, but……

Yeah. It is what it is.

So wait a minute – is this actually real?

WAIT FOR THE SCIENCE – and then you can decide.

The Canadian Data

Valerie Curren, in a comment today, just brought THIS Gab post, about a new Alex Berenson article, to my attention.

Vicki McKenna

@VickiMcKenna

·

Canadian data show vaccines now RAISE the risk of death from Covid

“Vaccinated people are now more likely to be hospitalized or die from Covid, even after adjusting for fact they’re older than the unvaccinated, according to official government estimates” 

https://alexberenson.substack.com/p/stunning-official-canadian-data-show/comments?utm_source=substack&utm_medium=email

Please read his article. It’s short and very readable.

Here was my immediate response to the article, after reading it.

OMG – this is exactly what I warned about! Vaccine addiction slavery!

How Vaccine Addiction Slavery Works

THIS right here is the key!!!

In May, the most recent month for which figures are available, only 9 percent of Covid deaths and 14 percent of hospital admissions in Manitoba occurred among unvaccinated people, even though they are 17 percent of the population.

Manitoba, which has about 1.4 million residents, also provides figures that are adjusted for the fact that vaccinated and boosted people tend to be older.

Those show that in May, vaccinated but unboosted people were about 50 percent more likely to be hospitalized or die of Covid than unvaccinated people. People who had received boosters had roughly the same risk of hospitalization or death as the unvaccinated.

Once you’re hooked on the vaccines, instead of the virus, you start to run a higher risk that you will DIE from the disease unless you get and stay boosted – but the vaccines will ALSO kill you by their own effects.

It’s a DOUBLY INSIDIOUS fate. It’s just like heroin addiction. The “cure” of more product will kill you on its own, AND it keeps you locked in.

(End of comment)

That right there is the short version. We now have a very nice example – corrected for numbers – corrected for age – that shows people “needing” to be either boosted or unvaccinated to not die of COVID at the “maximum rate”, which rate happens if you are “addicted to the jabs but late on payments”.

This is EXACTLY what I predicted would happen. And don’t even think about the vaccine being “safer” than being unvaccinated. The scientific trickery that was used to try to hide vaccine deaths has been appalling to this here scientist. The longer you take ANY vaccine which puts spike protein into your bloodstream, the greater your risk of “sudden adult death syndrome”.

You have a choice. Small, periodic, immunity-granting “colds”, or much more frequent vaccines that are guaranteed to put spike protein in your blood twice a year. And if you’re a WOMAN on that vaccine schedule, congratulations – you will likely never get a pregnancy that lasts to term.

It’s a small effect now – 50% greater chance of death on a disease that doesn’t kill many in most age groups – but I will bet money that there is a nice upward delta with the number of vaccinations, just like with the length of time one takes barbiturates.

First new scientific prediction: the longer you are addicted to the COVID vaccines, the greater the chance of death if you get the disease (i.e., the penalty for withdrawal increases with time).

Second new scientific prediction: the penalty for “withdrawal” increases with age (meaning seniors are at the most risk from withdrawal).

Third new scientific prediction: vaccinated kids (who survive the cardiac effects of the spike protein) are fully addicted by adulthood.

Ah, this crime is so smooth, one almost has to think that “this ain’t their first rodeo”. They had to have seen this in animal studies, and kept it under wraps.

Seriously. There had to be animal studies of corona viruses AND corona virus vaccines that showed potential for “depopulation” – both lowering lifespan AND reducing fertility.

And then somebody got ideas.

EVIL.

So what is the mechanism by which this happens? The fact of the matter is that we on the “outside” in “Fake Science” are learning as fast as we can. There are two main effects that we know about, from prior science, which seem relevant – ADE and OAS.

ADE

One effect behind a vaccine “making a disease worse” is called “antibody dependent enhancement”, or ADE for short. We can generalize that even further, to include other mechanisms than just the antibodies of “classic” ADE, by including anything that might be called “vaccine-dependent enhancement”, whether it involves antibodies or not. But for simplicity, let’s just call it all “ADE”.

Classic ADE involves a vaccine’s creation of what can be called “inappropriate antibodies”, which are problematic when the disease strikes later. Vaccination creates antibodies, and for whatever reason, those antibodies are not helpful when the disease strikes, but may actually make the situation WORSE, through various sins of omission or commission.

Now, we can expand that just a bit, to include other vaccine effects that make the disease worse, when one gets it. One such effect which appears relevant for COVID vaccines is a general DECREASE in immunity toward ALL DISEASES. This may be mediated though the interferon system.

There is still a lot of debate as to, and study of, what is going on in the weeks after COVID vaccination, but even the Faucists admit that immunity toward COVID itself is DECREASED immediately after injection, and does not rise to positive for a period of days to low weeks. (This, by the way, turned out to be a great excuse for ignoring vaccine side effects.) THEN, after specific immunity to COVID stays positive for a period of long weeks to low months, it tapers off, and people “need” boosters to maintain immunity toward COVID.

Meanwhile, during that entire time, general immunity is lowered toward EVERYTHING in many people, and does not recover for long weeks to months.

How this situation can possibly be regarded as good, mostly involves Anthony Fauci’s “antibody hypnosis”, which keeps us from seeing the bigger picture.

Dr. Nathan Thompson was one of the first to disclose loss of general immune function after COVID vaccination, and the powers that be, came after him HARD. His video disappeared everywhere.

Here are several posts where I covered such topics.

Don’t Drink The Kool-ADE

Since Fauci and Pfizer Must Have Known the Jab Reduces Immunity, Was This Also Fauci’s Goal With an AIDS Vaccine?

Ten Fresh Reasons for You, Your Friends, and Your Loved Ones to NOT Get the HAXXINE

“Clot Shot” Needs An Information Warfare Upgrade – What Do We Call The Immune-System-Destroying Shot Now?

But before looking at those fascinating posts, let’s deal with OAS.

OAS

OAS stands for “original antigenic sin”. This is not actually a hard concept to understand. It is a cute way of saying that while our immune systems are designed to IMPRINT on whatever they were last exposed to, as they figure out an immune response, they ESPECIALLY tend to imprint on new things that they are FIRST exposed to. Therefore, if your immune system imprints on something WRONGLY or MISLEADINGLY the first time, that “sin” is carried on.

In some ways, OAS is the flip side of ADE. Two sides of the same coin. ADE blames the bad antibodies coming back to haunt. OAS blames the setting up of the bad antibodies. Almost the same thing, and often indicted in the same breath.

OAS is another way of viewing the failure of immunity to deal with evolving viruses. Relative to the new virus, the memory of the old virus is “sinful”.

OAS is likewise another way of viewing autoimmune disorders, where we accidentally (or intentionally, in the case of sterilization vaccines) create immunity toward something in our own bodies. The original sin of an inappropriate immunity carries on to cause later problems.

Booster Withdrawal Syndrome

So how do we view the Canadian results in terms of ADE and OAS?

In my opinion, the spike protein vaccines have a “narrowing” effect on immunity, which is the source of their OAS / ADE. They are overly focused on the spike protein, and in particular on the original Wuhan variant spike protein. The antibodies that are created and on duty are basically born as “yesterday’s news”, and not even much of that. “Yesterday’s local suburban news” is what those antibodies are.

Worse still, unlike natural, disease-conferred immunity, there is no immunity gained toward OTHER proteins created by the virus. Those MORE CONSERVED proteins are the ones where antibodies to ONE variant are GOOD AGAINST THE NEXT. Those critical antibodies are NOT created by exposure to the spike protein alone.

Score 1 for natural immunity – score 0 for simplistic spike protein vaccines.

Thus, because the vaccinee’s immune system is over-focused on an old spike protein and nothing else, it becomes worthless against new variants, no matter in what way the rapidly evolving spike proteins have changed. Worse, the immune system doesn’t “start over” and produce general antibodies to the unknown new threat – it keeps throwing the wrong specific ammo at the new virus. Worse still, only a RECENTLY BOOSTED (but not TOO recently booosted) immune system has competent immunity. A vaccinated but non-boosted individual is “running on empty” – and with the wrong kind of gasoline. They have low immunity, and what they have is wrong.

In other words, you’d better have a FRESH DOSE of the BAD VACCINE, once you start taking the bad vaccine. Either that, or stick with natural immunity.

Starting to think that the vaccine might not be a good idea? Read on.

What About Novavax?

I had high hopes for the protein-based Novavax vaccine. Sadly, THAT was before I understood that spike protein pathogenicity dooms these vaccines. Robert Malone actually tried to warn FDA about the problems of building a vaccination program on the spike protein. His efforts were rebuffed.

Steve Kirsch has a great take on the Novavax vaccine.

Should you get the Novavax vaccine?

Absolutely not! Here are my top 5 reasons why you shouldn’t.

  1. COVID is a disease which is easily treatable. Why would you take a risk on a new product with unknown risks when you don’t need to?
  2. As Andrew Wakefield and others point out, we’ve never had a vaccine [presumably meaning a COVID vaccine] where the benefits > outweigh the risk. While this might be the first one, you’ll want to wait for an independent study that proves it.
  3. You can’t trust the FDA, CDC, or drug companies. They have to come clean and admit their issues before we can ever trust them again.
  4. You run the risk of original antigenic sin (OAS) and/or antibody dependent enhancement (ADE). In short, you run the risk of making yourself worse off.
  5. We just don’t know. We don’t know anything about their adjuvant — Matrix M. We don’t know anything about safety. We don’t know if they can manufacture it properly (they are now on their third contract manufacturer).

Steve has three additional links which are fantastic reads. They explain FROM THE DATA exactly why Novavax is both low in benefits and high in risks. This is CLEARLY due to the pathogenic spike protein.

In my opinion, it’s very unlikely that a COVID vaccine which beats disease-conferred immunity will be available for YEARS. Sure, I’ll keep watching, but Novavax is almost certainly not it.

So why did I want Novavax to be approved?

FDA and Pfizer/China Throw Shade on Novavax to Keep Data on Safer Vaccines Out of VAERS

TL;DR – “I believe that mRNA vaccines have serious risks that would be REVEALED by approval of the Novavax vaccine.” –Wolf Moon I’m actually surprised that FDA and Pfizer/China allowed Novavax to get this close to approval, but they clearly have the upcoming vote RIGGED, just like the 2020 election. The trusty “board mules” that …

FDA Panel Recommends EUA Approval for Novavax Vaccine

In my opinion, the approval of a “likely safer” coronavirus vaccine is – in the long game – a big win for popular science – here’s why. The approaching approval (or not) of a competing EUA for the NON-mRNA NON-viral-vector NON-genetic Novavax coronavirus vaccine is going to tell us a LOT about how much power …

I wanted Novavax approved, not only because it was “safer”, but so that “popular science” would be able to get the data for Novavax out of VAERS, after which we can compare it with mRNA vaccines. This will give us powerful estimates on the “price” of the industry misleading us away from the safest possible vaccines, to ones that they preferred for research reasons.

Novavax still has to get past the CDC, and I would not put it past “Rochelle The Knife” Walensky to kill Novavax, but as I have explained elsewhere, I do think that Novavax has made implicit promises not to brag up their (somewhat) better safety relative to mRNA vaccines. They will HANG TOGETHER to make sure they don’t hang separately.

Bottom Line

The bottom line is this. DO NOT GET THE JAB. There are too many reasons right now to skip the jab and to rely on natural immunity.

If I change my mind on that, you will be the first to know, and also the first to know WHY.

W

John Fink and James Coburn discuss case in a scene from the film ‘The Carey Treatment’, 1972. (Photo by Metro-Goldwyn-Mayer/Getty Images)

Watching The Water – And Learning To Laugh At The Frogs Jumping In To Get Away

How I Made Scientific and God’s Peace with the Bryan Ardis Snake Venom Conspiracy Theory of COVID-19 and the Vaccines

I like Bryan Ardis. I like Stew Peters. I love Stew’s show. I love that Stew Peters gives people like Bryan Ardis a forum, when nobody else will. Thanks to Stew Peters, critical messages from Peter McCullough, Robert Malone, Jane Ruby, Karen Kingston, and many others have gotten out to the world. Even earlier messages from Bryan Ardis. In my opinion, Stew’s a hero.

However, getting the TRUTH out has a price. Sometimes stuff that’s not quite truth rides along with it.

A recent special presentation of the Stew Peters Show called Watch The Water – which is basically an interview of Bryan Ardis by Stew – is an excellent example of paying that price.

I’m not going to review the whole thing. Let me just say that Bryan Ardis makes some great scientific analogies (which many of us professional scientists have made, over the last two years), but then overdoes them by asserting they are LITERAL REALITY.

OY VEY!

Many of us have used protein venoms as a teaching tool about the pathogenicity of the spike protein. I have done MULTIPLE posts talking about the spike protein, and even called it the “snake protein” in quotes.

In fact, the title of the first reference below is pretty much my argument with Bryan Ardis.

= ≠ ≈

Or something like that.

Spike Protein = Spike Protein ≈ Snake Protein

Using Principles of Protein Equivalence and Analogy as Predictive Tools for Coronavirus Understanding Surely you’ve heard of the BROWN RECLUSE SPIDER. The brown recluse is related to several other recluses, and a couple of other families of spiders, that all have a similar venom – a protein called sphingomyelinase D. This is an enzyme that …

The Spike Protein’s Purpose Betrayed By Its Own Superiority

TL;DR – you MUST listen to a short podcast of a scientist revealing the latest research on the spike protein vaccines. The VACCINE ITSELF (not just the spike protein – the mRNA vaccine itself) is persistent and is not only concentrating in ovaries – THE VACCINE ITSELF IS EXCRETED – e.g., in breast milk. Meaning …

Dr. Charles Hoffe’s Observation of Spike Protein mRNA Vaccine-Induced Pulmonary Hypertension

A Beautiful Demonstration of Real Science in Action, and How Political Correctness Prevents Obvious Correlations and Causations From Being Seen by Monetarily Dependent Scientists Being “Sherlock Holmes” is easy, when everybody else in mainstream science has turned into a character from “The Muppets” or “Sesame Street”. Except for Dr. Charles Hoffe, plus a bunch of …

Science vs. Anti-Science: Conservation of Spike Protein Biochemistry vs. Democrat Media Voodoo of Post-Pandemic Stress

As a young science student in the 1970s, I never would have thought that I would have to correct the American and global media over an issue of late 19th century basic science, but yet, here we are. When basic theories of MATTER and CHEMISTRY proved that “Compound A created by one route has the …

However, in science, just like math, there is a difference between ANALOGY and EQUIVALENCE.

So here is an analogy about analogies not being equivalence.

Ardis’ mistake would be (somewhat badly) analogous to going from “Helium inhalation makes people talk like Donald Duck, which is so gay,” to “Helium inhalation is a Disney plot to turn kids gay.”

Yeah, these statements are kinda similar, but they are NOT identical.

Ardis didn’t HAVE TO GO all the way to saying “it’s not a virus and a spike protein – it’s snake venom”, and “remdesivir is really snake venom”, but he did, and now it’s too late.

I highly recommend just watching the video. Yes, it’s an hour that you will never get back, but I only ask that you watch it until you either finish it, or turn it off and shake your head.

Here is the link:

LINK: https://rumble.com/v10mnew-live-world-premiere-watch-the-water.html

Here is the video:

We have discussed this video a bit on the site – here are links to comments on prior open threads.

LINK 1: https://www.theqtree.com/2022/04/11/dear-kmag-20220411-joe-biden-didnt-win-%e2%9d%80-open-topic/comment-page-2/#comment-892088

LINK 2: https://www.theqtree.com/2022/04/12/dear-kag-20220412-open-thread/comment-page-1/#comment-892102

I think I’ve found all the “watch the water” links.

However, I am going to add one more, as a kind of “negative control”.

You see, almost anything can be “watch the water” if you look hard enough.

eilert brought in this tweet video, and EllieLA noted that the surfer sails past a large and almost distinct “Q” composed of foam on the water – beginning at exactly 17 seconds.

See for yourself!

So – is THAT what “watch the water” – the QAnon phrase – means?

Or does it mean, like the title implies, that they’re putting VENOMS in the water supply?

Who KNOWS what it means? There have been literally HUNDREDS of speculations as to what “watch the water” means.

Frankly, at this point, my “care” is on hold.

What I DO care about is anything that we can PROVE, or even just prove to be PROBABLY TRUE.

In the context of the TITLE of the Stew Peters documentary, the use of the phrase “watch the water” is clearly a tie to the QAnon saying, but IMO it will do neither the QAnon people nor the COVID critics any good.

I just shake my head thinking that Ardis is invoking QAnon to “prove” his contention, when it’s far more likely that he’s helping “snake venom in drinking water” and “QAnon” undergo some kind of mutual annihilation.

In other words, “Thanks for the help we didn’t need, and didn’t ask for. In fact, if you don’t mind, you can have your shit sandwich back – I’m not hungry.”

I’m not angry at Ardis – in fact, I’m seriously excited about the possibility of making some excellent lemonade out of the lemons he gave us. And I’m not alone. Here is Jordan Sather’s critique of the interview, which he posted on Telegram (h/t GA/FL).

LINK: https://t.me/jordansather/5782

Watched Stew’s “Watch the Water” video with Dr. Bryan Ardis. (I find it funny Stew calls Q a deep state op, but names his movie after a common Q-ism, ‘watch the water’. Helps with marketing I suppose. Though that’s not the point here..)

I think Ardis is onto something, but not the something he thinks he’s onto. He makes a variety of jumps to conclusions that I don’t think are rooted in sound logic. For instance, “because it’s in the TV show, it must be real”, “if the CDC says don’t do it, then do it”, “if the fact checkers debunk it, it must be real”, etc.

Also still going on with this “there’s no such thing as a virus” line – I don’t resonate with this.

I think it’s possible that snake genes were used in the production of the COVID virus, along with bat DNA, eye of newt, toe of frog, and whatever the heck else they used for the witches brew. Who the heck knows. Could this explain some of his points with remdesivir, monoclonal antibodies, and fact checkers he brought up? There are other claims he makes that I think are far fatched though.

I definitely don’t think they put snake venom in water supplies around the country and that’s what caused the “COVID outbreak”. A bioengineered virus and faulty PCR tests are reasonable enough explanations.

One point: the mainstream media is going to have a field day with hit pieces on this one, seeing as people are already sharing it all over the place like it’s fact. And I think this is only going to add to the confusion when trying to wake normies up about COVID. “Now you think it’s snake venom and viruses don’t exist you crazy conspiracy theorist??”. Only going to make life tougher on ourselves.

I’m not totally sold on this doc and do think there’s a possibility of it being a red herring. Don’t let your guard down.

My two cents on it.

This is one of the reasons I follow Jordan Sather – he is open-minded yet SO level-headed. I totally agree with what he’s saying here.

And while we’re at it, here is another TWO-HOUR interview of Ardis by RedPill78.

This interview is VERY interesting, because Ardis talks about Trump’s position on vaccines, and various attempts to set up meetings between Trump and various vaccine opponents, including Ardis and Peter McCullough.

His take on Trump and vaccines may shock a lot of MAGA people.

Also note that around 33-36 minutes into the video, Ardis acknowledges many scientists holding MY viewpoint on this – that SARS-CoV-2 is the agent, being a virus with a venom-like spike protein – although he calls this viewpoint “agreeing with him”. In other words, his fallback position is – COUGH, COUGH – my position.

*SMIRK*

NOW – let’s get to my NEW AND IMPROVED take on all of this.

At first, I was thinking that I was going to have to do a lot of “defending” of truth and basic logic here, but really, the truth defends itself. You know damn well “they” are not putting snake venom in the water supply. You know in your gut that remdesivir isn’t snake venom.

Whether certain key sequences were put into the spike protein is a question that is exquisitely up for grabs – THAT is a real question. We see HIV-related sequences, we know what those sequences DO, that they are in the right place, that they do what is predicted, and we know that they were patented, etc. Smoking guns.

We ALSO see amino acid sequences related to venomous snakes, but they’re the wrong type of venom – mostly neurotoxic – whereas I personally found the ‘snake venom” pharmacological linkage closer to hemotoxic venoms. Whatever. Please note that *I* was primarily using protein snake venoms as an ANALOGY to show why the pathogenic and hemotoxic spike protein was a BAD CHOICE as an immunogen. My analogy doesn’t require similar sequences, although that would be interesting.

But “they’re” not putting venom in the water supply to cause COVID-19. The idea doesn’t jibe with the facts on any end of the assertion. I leave that to YOU to work out.

Remdesivir – the horrible bad drug that it is – has no need of being snake venom.

The OUTCOMES are still the same.

Don’t let anybody give you remdesivir. Don’t take any drugs from a lying company like Pfizer. This is all very simple. I don’t NEED snake venom for any of it.

The only reason *I* needed to invoke “snake venom” was to help people understand why the spike protein was so nasty, and clearly responsible for the fact that the COVID vaccines were every bit as bad as the disease – maybe WORSE.

SO – here is where I suddenly laugh at the frogs jumping needlessly in the water to “get away” from me – a person who has no intention of harming them.

For ALL the bitching and blog-posting that I did, trying to get people to learn a little biology and pharmacology about protein toxins, and how SNAKE VENOMS and SPIDER VENOMS demonstrated the plausibility of a toxic spike protein in the vaccines, causing both disease and vaccine injuries, I probably enlightened a few dozen people, TOPS.

But CHECK THIS OUT. Bryan Ardis’ stuff now has engagement in the MILLIONS.

Bryan Ardis is dropping a BOMB on the other side, that is MISSING the target, but it is going to wake a LOT of people up – in a way that I had hoped to do, but could not.

The parts of what Ardis is saying that are WRONG are going to get “washed away”, so to speak.

But the parts that are right – meaning getting people to think about venoms as very much analogous to the spike protein – that is gonna STICK.

And in my opinion, THAT is GOD’S WORK.

So, is this “How I learned to stop worrying and love the bombshell?”

Maybe so.

Yup. The frogs jump in stupidly, but they’re still God’s wonderful creatures, and they do what they do for a reason.

TRUST THAT THERE IS A REASON.

Peace, Y’all.

W

8Then the LORD said to Moses, “Make a fiery serpent and mount it on a pole. When anyone who is bitten looks at it, he will live.” 9So Moses made a bronze snake and mounted it on a pole. If anyone who was bitten looked at the bronze snake, he would live.

Numbers 21:8-9.